Reviewed,
UniProtKB/Swiss-Prot Q9QW07 (PLCB4_RAT)
Last modified
February 9, 2010.
Version 85.
History...
Clusters with 100%,
90%,
50% identity |
Documents (1) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4 EC=3.1.4.11 Alternative name(s): Phosphoinositide phospholipase C-beta-4 Phospholipase C-beta-4 Short name=PLC-beta-4 | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus |
Protein attributes
| Sequence length | 1175 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level. |
General annotation (Comments)
| Function | The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction. |
| Catalytic activity | 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol. |
| Cofactor | Calcium. |
| Tissue specificity | Preferentially expressed in the retina. |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PI-PLC X-box domain. Contains 1 PI-PLC Y-box domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9QW07-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9QW07-2) The sequence of this isoform differs from the canonical sequence as follows: 1013-1022: VKEIVAQHTK → GKQRDASPSG 1023-1175: Missing. | ||||||
| Isoform C (identifier: Q9QW07-3) The sequence of this isoform differs from the canonical sequence as follows: 1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed By similarity | ||||||
| Chain | 2 – 1175 | 1174 | 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-4 | PRO_0000088496 | |||||
Regions | |||||||||
| Domain | 313 – 463 | 151 | PI-PLC X-box | ||||||
| Domain | 565 – 681 | 117 | PI-PLC Y-box | ||||||
| Domain | 688 – 786 | 99 | C2 | ||||||
Sites | |||||||||
| Active site | 328 | 1 | By similarity | ||||||
| Active site | 375 | 1 | By similarity | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine By similarity | ||||||
| Modified residue | 620 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 623 | 1 | Phosphotyrosine By similarity | ||||||
| Modified residue | 890 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1013 – 1022 | 10 | VKEIVAQHTK → GKQRDASPSG in isoform B. | VSP_004724 | |||||
| Alternative sequence | 1023 – 1175 | 153 | Missing in isoform B. | VSP_004725 | |||||
| Alternative sequence | 1154 – 1175 | 22 | AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform C. | VSP_004726 | |||||
Experimental info | |||||||||
| Sequence conflict | 255 | 1 | L → M in AAD10403. Ref.2 | ||||||
| Sequence conflict | 255 | 1 | L → M in AAC98145. Ref.2 | ||||||
| Sequence conflict | 308 | 1 | R → A in AAD10403. Ref.2 | ||||||
| Sequence conflict | 308 | 1 | R → A in AAC98145. Ref.2 | ||||||
| Sequence conflict | 417 | 1 | Q → E in AAD10403. Ref.2 | ||||||
| Sequence conflict | 417 | 1 | Q → E in AAC98145. Ref.2 | ||||||
| Sequence conflict | 470 | 1 | E → K in AAD10403. Ref.2 | ||||||
| Sequence conflict | 470 | 1 | E → K in AAC98145. Ref.2 | ||||||
| Sequence conflict | 504 | 1 | A → AA in AAK13557. Ref.1 | ||||||
| Sequence conflict | 545 – 546 | 2 | EQ → DE in AAD10403. Ref.2 | ||||||
| Sequence conflict | 545 – 546 | 2 | EQ → DE in AAC98145. Ref.2 | ||||||
| Sequence conflict | 734 | 1 | I → L in AAD10403. Ref.2 | ||||||
| Sequence conflict | 734 | 1 | I → L in AAC98145. Ref.2 | ||||||
| Sequence conflict | 741 | 1 | R → H in AAD10403. Ref.2 | ||||||
| Sequence conflict | 741 | 1 | R → H in AAC98145. Ref.2 | ||||||
| Sequence conflict | 764 | 1 | L → M in AAD10403. Ref.2 | ||||||
| Sequence conflict | 764 | 1 | L → M in AAC98145. Ref.2 | ||||||
| Sequence conflict | 776 | 1 | D → N in AAD10403. Ref.2 | ||||||
| Sequence conflict | 776 | 1 | D → N in AAC98145. Ref.2 | ||||||
| Sequence conflict | 828 | 1 | F → L in AAK13557. Ref.1 | ||||||
| Sequence conflict | 843 | 1 | S → Y in AAD10403. Ref.2 | ||||||
| Sequence conflict | 843 | 1 | S → Y in AAC98145. Ref.2 | ||||||
| Sequence conflict | 852 | 1 | L → M in AAC24984. Ref.3 | ||||||
| Sequence conflict | 916 | 1 | Q → T in AAD10403. Ref.2 | ||||||
| Sequence conflict | 916 | 1 | Q → T in AAC98145. Ref.2 | ||||||
| Sequence conflict | 1024 | 1 | W → C in AAC24984. Ref.3 | ||||||
| Sequence conflict | 1043 | 1 | L → M in AAC24984. Ref.3 | ||||||
| Sequence conflict | 1057 | 1 | A → V in AAC24984. Ref.3 | ||||||
| Sequence conflict | 1067 | 1 | L → V in AAC24984. Ref.3 | ||||||
| Sequence conflict | 1084 | 1 | S → C in AAC24984. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Purification, molecular cloning, and sequencing of phospholipase C-beta 4." Lee C.-W., Park D.J., Lee K.-H., Kim C.G., Rhee S.G. J. Biol. Chem. 268:21318-21327(1993) [PubMed: 8407970] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). Strain: Sprague-Dawley. Tissue: Brain. |
| [2] | "Cloning of cDNA encoding rat phospholipase C-beta 4, a new member of the phospholipase C." Kim M.J., Bahk Y.Y., Min D.S., Lee S.J., Ryu S.H., Suh P.G. Biochem. Biophys. Res. Commun. 194:706-712(1993) [PubMed: 7688223] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B). Strain: Sprague-Dawley. Tissue: Brain. |
| [3] | "A unique isoform of phospholipase Cbeta4 highly expressed in the cerebellum and eye." Adamski F.M., Timms K.M., Shieh B.H. Biochim. Biophys. Acta 1444:55-60(1999) [PubMed: 9931434] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 447-1175 (ISOFORM C). Tissue: Brain. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | L15556 mRNA. Translation: AAK13557.1. U57836 mRNA. Translation: AAD10403.1. AF031370 mRNA. Translation: AAC98145.1. AF027571 mRNA. Translation: AAC24984.1. |
| IPI | IPI00211614. IPI00231558. IPI00231559. |
| PIR | A48047. |
| RefSeq | NP_077329.1. |
| UniGene | Rn.6155 |
3D structure databases | |
| SMR | Q9QW07. Positions 12-821. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9QW07. |
PTM databases | |
| PhosphoSite | Q9QW07. |
Proteomic databases | |
| PRIDE | Q9QW07. |
Genome annotation databases | |
| Ensembl | ENSRNOT00000042853; ENSRNOP00000048553; ENSRNOG00000033119; Rattus norvegicus. [Genome view] |
| GeneID | 25031. |
| KEGG | rno:25031. |
| UCSC | NM_024353. rat. |
Organism-specific databases | |
| CTD | 25031. |
| RGD | 3345. Plcb4. |
Phylogenomic databases | |
| eggNOG | roNOG04728. |
| HOVERGEN | Q9QW07. |
| PhylomeDB | Q9QW07. |
Enzyme and pathway databases | |
| BRENDA | 3.1.4.11. 248. |
Gene expression databases | |
| ArrayExpress | Q9QW07. |
| Genevestigator | Q9QW07. |
| GermOnline | ENSRNOG00000033119. Rattus norvegicus. |
Family and domain databases | |
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR018029. C2_membr_targeting. IPR011992. EF-hand-like_dom. IPR015359. Phospholipase_C_EF-hand-like. IPR001192. Phospholipase_C_Pinositol-sp_C. IPR001711. Phospholipase_C_Pinositol-sp_Y. IPR016280. PLC-beta. IPR017946. PLC-like_Pdiesterase_TIM-brl. IPR000909. PLipase_C_PInositol-sp_X_dom. [Graphical view] |
| Gene3D | G3DSA:1.10.238.10. EF-Hand_type. 1 hit. G3DSA:3.20.20.190. PLC-like_Pdiesterase_TIM-brl. 1 hit. |
| Pfam | PF00168. C2. 1 hit. PF09279. efhand_like. 1 hit. PF00388. PI-PLC-X. 1 hit. PF00387. PI-PLC-Y. 1 hit. [Graphical view] |
| PIRSF | PIRSF000956. PLC-beta. 1 hit. |
| PRINTS | PR00390. PHPHLIPASEC. |
| SMART | SM00239. C2. 1 hit. SM00148. PLCXc. 1 hit. SM00149. PLCYc. 1 hit. [Graphical view] |
| PROSITE | PS50004. C2. 1 hit. PS50007. PIPLC_X_DOMAIN. 1 hit. PS50008. PIPLC_Y_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 605179. |
Entry information
| Entry name | PLCB4_RAT | ||||||||
| Accession | Primary (citable) accession number: Q9QW07 Secondary accession number(s): O88356, Q9Z0G6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||

Clusters with


