Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QW07

- PLCB4_RAT

UniProt

Q9QW07 - PLCB4_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4

Gene

Plcb4

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei328 – 3281PROSITE-ProRule annotation
Active sitei375 – 3751PROSITE-ProRule annotation

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. mitogen-activated protein kinase binding Source: RGD
  3. phosphatidylinositol phospholipase C activity Source: UniProtKB-EC
  4. signal transducer activity Source: UniProtKB-KW

GO - Biological processi

  1. intracellular signal transduction Source: InterPro
  2. lipid catabolic process Source: UniProtKB-KW
  3. negative regulation of potassium ion transport Source: RGD
  4. phototransduction Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BRENDAi3.1.4.11. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-beta-4
Phospholipase C-beta-4
Short name:
PLC-beta-4
Gene namesi
Name:Plcb4
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi3345. Plcb4.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: RGD
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11RemovedBy similarity
Chaini2 – 117511741-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4PRO_0000088496Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanineBy similarity
Modified residuei886 – 8861PhosphothreonineBy similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9QW07.
PRIDEiQ9QW07.

PTM databases

PhosphoSiteiQ9QW07.

Expressioni

Tissue specificityi

Preferentially expressed in the retina.

Gene expression databases

GenevestigatoriQ9QW07.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000045972.

Structurei

3D structure databases

ProteinModelPortaliQ9QW07.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini313 – 463151PI-PLC X-boxPROSITE-ProRule annotationAdd
BLAST
Domaini565 – 681117PI-PLC Y-boxPROSITE-ProRule annotationAdd
BLAST
Domaini688 – 78699C2PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 C2 domain.PROSITE-ProRule annotation
Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG149692.
HOGENOMiHOG000232046.
HOVERGENiHBG053609.
InParanoidiQ9QW07.
KOiK05858.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PfamiPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q9QW07-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKPYEFNWQ KEVPSFLQEG AVFDRYEEES FVFEPNCLFK VDEFGFFLTW
60 70 80 90 100
KSEGKEGQVL ECSLINSIRL AAIPKDPKIL AALESVGKSE NDLEGRILCV
110 120 130 140 150
CSGTDLVNIG FTYMVAENPE ITKQWVEGLR SIIHNFRANN VSPMTCLKKH
160 170 180 190 200
WMKLAFLTNT SGKIPVRSIT RTFASGKTEK VIFQALKELG LPSGKNDEIE
210 220 230 240 250
PAAFTYEKFY ELTQKICPRT DIEDLFKKIN GDKTDYLTVD QLVSFLNEHQ
260 270 280 290 300
RDPRLNEILF PFYDAKRAMQ IIEMYEPDEE LKKKGLISSD GFCRYLMSDE
310 320 330 340 350
NAPVFLDRLE LYQEMDHPLA HYFISSSHNT YLTGRQFGGK SSVEMYRQVL
360 370 380 390 400
LAGCRCVELD CWDGKGEDQE PIITHGKAMC TDILFKDVIQ AIKETAFVTS
410 420 430 440 450
EYPVILSFEN HCSKYQQYQM SKYCEDLFGD LLLKQALESH PLEPGRLLPS
460 470 480 490 500
PNDLKRKILI KNKRLKPEVE KKQLEALKSM MEAGESAAPA SILEDDNEEE
510 520 530 540 550
IESADQEEEA HPEYKFGNEL SADDFSHKEA VANSVKKGLV TVEDEQAWMA
560 570 580 590 600
SYKYVGATTN IHPYLSTMIN YAQPVKFQGF HVAEERNIHY NMSSFNESVG
610 620 630 640 650
LGYLKTHAIE FVNYNKRQMS RIYPKGGRVD SSNYMPQIFW NAGCQMVSLN
660 670 680 690 700
YQTPDLAMQL NQGKFEYNGS CGYLLKPDFM RRPDRTFDPF SETPVDGVIA
710 720 730 740 750
ATCSVQVISG QFLSDKKIGT YVEVDMYGLP TDTIRKEFRT RMVMNNGLNP
760 770 780 790 800
VYNEESFVFR KVILPDLAVL RIAVYDDNNK LIGQRILPLD GLQAGYRHIS
810 820 830 840 850
LRNEGNKPLS LPTIFCNIVL KTYVPDGFGD IVDALSDPKK FLSITEKRAD
860 870 880 890 900
QLRAMGIETS DIADVPSDTS KNDKKGKANP AKANVTPQSS SELRPTTTAA
910 920 930 940 950
LGSGQEAKKG IELIPQVRIE DLKQMKAYLK HLKKQQKELN SLKKKHAKEH
960 970 980 990 1000
STMQKLHCTQ VDKIVAQYDK EKSTHEKILE KAMKKKGGSN CLEIKKETEI
1010 1020 1030 1040 1050
KIQTLTSDHK SKVKEIVAQH TKEWSEMINT HSAEEQEIRD LHLSQQCELL
1060 1070 1080 1090 1100
RKLLINAHEQ QTQQLKLSHD RESKEMRAHQ AKISMENSKA ISQDKSIKNK
1110 1120 1130 1140 1150
AERERRVREL NSSNTKKFLE ERKRLAMKQS KEMDQLKKVQ LEHLEFLEKQ
1160 1170
NEQAKEMQQM VKLEAEMDRR PATVV
Length:1,175
Mass (Da):134,497
Last modified:January 11, 2001 - v2
Checksum:i7379C6BB95B8FCED
GO
Isoform B (identifier: Q9QW07-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1013-1022: VKEIVAQHTK → GKQRDASPSG
     1023-1175: Missing.

Show »
Length:1,022
Mass (Da):116,073
Checksum:i6F30C698F4E2AA19
GO
Isoform C (identifier: Q9QW07-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN

Show »
Length:1,194
Mass (Da):136,139
Checksum:i1EE7041FC86772AF
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti255 – 2551L → M in AAD10403. (PubMed:7688223)Curated
Sequence conflicti255 – 2551L → M in AAC98145. (PubMed:7688223)Curated
Sequence conflicti308 – 3081R → A in AAD10403. (PubMed:7688223)Curated
Sequence conflicti308 – 3081R → A in AAC98145. (PubMed:7688223)Curated
Sequence conflicti417 – 4171Q → E in AAD10403. (PubMed:7688223)Curated
Sequence conflicti417 – 4171Q → E in AAC98145. (PubMed:7688223)Curated
Sequence conflicti470 – 4701E → K in AAD10403. (PubMed:7688223)Curated
Sequence conflicti470 – 4701E → K in AAC98145. (PubMed:7688223)Curated
Sequence conflicti504 – 5041A → AA in AAK13557. (PubMed:8407970)Curated
Sequence conflicti545 – 5462EQ → DE in AAD10403. (PubMed:7688223)Curated
Sequence conflicti545 – 5462EQ → DE in AAC98145. (PubMed:7688223)Curated
Sequence conflicti734 – 7341I → L in AAD10403. (PubMed:7688223)Curated
Sequence conflicti734 – 7341I → L in AAC98145. (PubMed:7688223)Curated
Sequence conflicti741 – 7411R → H in AAD10403. (PubMed:7688223)Curated
Sequence conflicti741 – 7411R → H in AAC98145. (PubMed:7688223)Curated
Sequence conflicti764 – 7641L → M in AAD10403. (PubMed:7688223)Curated
Sequence conflicti764 – 7641L → M in AAC98145. (PubMed:7688223)Curated
Sequence conflicti776 – 7761D → N in AAD10403. (PubMed:7688223)Curated
Sequence conflicti776 – 7761D → N in AAC98145. (PubMed:7688223)Curated
Sequence conflicti828 – 8281F → L in AAK13557. (PubMed:8407970)Curated
Sequence conflicti843 – 8431S → Y in AAD10403. (PubMed:7688223)Curated
Sequence conflicti843 – 8431S → Y in AAC98145. (PubMed:7688223)Curated
Sequence conflicti852 – 8521L → M in AAC24984. (PubMed:9931434)Curated
Sequence conflicti916 – 9161Q → T in AAD10403. (PubMed:7688223)Curated
Sequence conflicti916 – 9161Q → T in AAC98145. (PubMed:7688223)Curated
Sequence conflicti1024 – 10241W → C in AAC24984. (PubMed:9931434)Curated
Sequence conflicti1043 – 10431L → M in AAC24984. (PubMed:9931434)Curated
Sequence conflicti1057 – 10571A → V in AAC24984. (PubMed:9931434)Curated
Sequence conflicti1067 – 10671L → V in AAC24984. (PubMed:9931434)Curated
Sequence conflicti1084 – 10841S → C in AAC24984. (PubMed:9931434)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1013 – 102210VKEIVAQHTK → GKQRDASPSG in isoform B. 1 PublicationVSP_004724
Alternative sequencei1023 – 1175153Missing in isoform B. 1 PublicationVSP_004725Add
BLAST
Alternative sequencei1154 – 117522AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform C. 1 PublicationVSP_004726Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L15556 mRNA. Translation: AAK13557.1.
U57836 mRNA. Translation: AAD10403.1.
AF031370 mRNA. Translation: AAC98145.1.
AF027571 mRNA. Translation: AAC24984.1.
PIRiA48047.
RefSeqiNP_077329.1. NM_024353.1.
UniGeneiRn.6155.

Genome annotation databases

GeneIDi25031.
KEGGirno:25031.
UCSCiRGD:3345. rat. [Q9QW07-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L15556 mRNA. Translation: AAK13557.1 .
U57836 mRNA. Translation: AAD10403.1 .
AF031370 mRNA. Translation: AAC98145.1 .
AF027571 mRNA. Translation: AAC24984.1 .
PIRi A48047.
RefSeqi NP_077329.1. NM_024353.1.
UniGenei Rn.6155.

3D structure databases

ProteinModelPortali Q9QW07.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10116.ENSRNOP00000045972.

PTM databases

PhosphoSitei Q9QW07.

Proteomic databases

PaxDbi Q9QW07.
PRIDEi Q9QW07.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 25031.
KEGGi rno:25031.
UCSCi RGD:3345. rat. [Q9QW07-1 ]

Organism-specific databases

CTDi 5332.
RGDi 3345. Plcb4.

Phylogenomic databases

eggNOGi NOG149692.
HOGENOMi HOG000232046.
HOVERGENi HBG053609.
InParanoidi Q9QW07.
KOi K05858.

Enzyme and pathway databases

BRENDAi 3.1.4.11. 5301.

Miscellaneous databases

NextBioi 605179.
PROi Q9QW07.

Gene expression databases

Genevestigatori Q9QW07.

Family and domain databases

Gene3Di 1.10.238.10. 1 hit.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProi IPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view ]
PANTHERi PTHR10336. PTHR10336. 1 hit.
Pfami PF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view ]
PIRSFi PIRSF000956. PLC-beta. 1 hit.
PRINTSi PR00390. PHPHLIPASEC.
SMARTi SM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEi PS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Purification, molecular cloning, and sequencing of phospholipase C-beta 4."
    Lee C.-W., Park D.J., Lee K.-H., Kim C.G., Rhee S.G.
    J. Biol. Chem. 268:21318-21327(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
    Strain: Sprague-Dawley.
    Tissue: Brain.
  2. "Cloning of cDNA encoding rat phospholipase C-beta 4, a new member of the phospholipase C."
    Kim M.J., Bahk Y.Y., Min D.S., Lee S.J., Ryu S.H., Suh P.G.
    Biochem. Biophys. Res. Commun. 194:706-712(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
    Strain: Sprague-Dawley.
    Tissue: Brain.
  3. "A unique isoform of phospholipase Cbeta4 highly expressed in the cerebellum and eye."
    Adamski F.M., Timms K.M., Shieh B.H.
    Biochim. Biophys. Acta 1444:55-60(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 447-1175 (ISOFORM C).
    Tissue: Brain.

Entry informationi

Entry nameiPLCB4_RAT
AccessioniPrimary (citable) accession number: Q9QW07
Secondary accession number(s): O88356, Q9Z0G6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 11, 2001
Last modified: November 26, 2014
This is version 126 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3