Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QW07

- PLCB4_RAT

UniProt

Q9QW07 - PLCB4_RAT

Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4

Gene

Plcb4

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 2 (11 Jan 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.

    Catalytic activityi

    1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

    Cofactori

    Calcium.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei328 – 3281PROSITE-ProRule annotation
    Active sitei375 – 3751PROSITE-ProRule annotation

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro
    2. mitogen-activated protein kinase binding Source: RGD
    3. phosphatidylinositol phospholipase C activity Source: UniProtKB-EC
    4. signal transducer activity Source: UniProtKB-KW

    GO - Biological processi

    1. intracellular signal transduction Source: InterPro
    2. lipid catabolic process Source: UniProtKB-KW
    3. negative regulation of potassium ion transport Source: RGD
    4. phototransduction Source: RGD

    Keywords - Molecular functioni

    Hydrolase, Transducer

    Keywords - Biological processi

    Lipid degradation, Lipid metabolism

    Keywords - Ligandi

    Calcium

    Enzyme and pathway databases

    BRENDAi3.1.4.11. 5301.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC:3.1.4.11)
    Alternative name(s):
    Phosphoinositide phospholipase C-beta-4
    Phospholipase C-beta-4
    Short name:
    PLC-beta-4
    Gene namesi
    Name:Plcb4
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi3345. Plcb4.

    Subcellular locationi

    GO - Cellular componenti

    1. cytoplasm Source: RGD

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 117511741-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4PRO_0000088496Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanineBy similarity
    Modified residuei886 – 8861PhosphothreonineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PaxDbiQ9QW07.
    PRIDEiQ9QW07.

    PTM databases

    PhosphoSiteiQ9QW07.

    Expressioni

    Tissue specificityi

    Preferentially expressed in the retina.

    Gene expression databases

    GenevestigatoriQ9QW07.

    Interactioni

    Protein-protein interaction databases

    STRINGi10116.ENSRNOP00000045972.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9QW07.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini313 – 463151PI-PLC X-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini565 – 681117PI-PLC Y-boxPROSITE-ProRule annotationAdd
    BLAST
    Domaini688 – 78699C2PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 C2 domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC X-box domain.PROSITE-ProRule annotation
    Contains 1 PI-PLC Y-box domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG149692.
    HOGENOMiHOG000232046.
    HOVERGENiHBG053609.
    KOiK05858.

    Family and domain databases

    Gene3Di1.10.238.10. 1 hit.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProiIPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR016280. PLC-beta.
    IPR009535. PLC-beta_CS.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view]
    PANTHERiPTHR10336. PTHR10336. 1 hit.
    PfamiPF00168. C2. 1 hit.
    PF06631. DUF1154. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view]
    PIRSFiPIRSF000956. PLC-beta. 1 hit.
    PRINTSiPR00390. PHPHLIPASEC.
    SMARTiSM00239. C2. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view]
    SUPFAMiSSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 2 hits.
    PROSITEiPS50004. C2. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform A (identifier: Q9QW07-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAKPYEFNWQ KEVPSFLQEG AVFDRYEEES FVFEPNCLFK VDEFGFFLTW     50
    KSEGKEGQVL ECSLINSIRL AAIPKDPKIL AALESVGKSE NDLEGRILCV 100
    CSGTDLVNIG FTYMVAENPE ITKQWVEGLR SIIHNFRANN VSPMTCLKKH 150
    WMKLAFLTNT SGKIPVRSIT RTFASGKTEK VIFQALKELG LPSGKNDEIE 200
    PAAFTYEKFY ELTQKICPRT DIEDLFKKIN GDKTDYLTVD QLVSFLNEHQ 250
    RDPRLNEILF PFYDAKRAMQ IIEMYEPDEE LKKKGLISSD GFCRYLMSDE 300
    NAPVFLDRLE LYQEMDHPLA HYFISSSHNT YLTGRQFGGK SSVEMYRQVL 350
    LAGCRCVELD CWDGKGEDQE PIITHGKAMC TDILFKDVIQ AIKETAFVTS 400
    EYPVILSFEN HCSKYQQYQM SKYCEDLFGD LLLKQALESH PLEPGRLLPS 450
    PNDLKRKILI KNKRLKPEVE KKQLEALKSM MEAGESAAPA SILEDDNEEE 500
    IESADQEEEA HPEYKFGNEL SADDFSHKEA VANSVKKGLV TVEDEQAWMA 550
    SYKYVGATTN IHPYLSTMIN YAQPVKFQGF HVAEERNIHY NMSSFNESVG 600
    LGYLKTHAIE FVNYNKRQMS RIYPKGGRVD SSNYMPQIFW NAGCQMVSLN 650
    YQTPDLAMQL NQGKFEYNGS CGYLLKPDFM RRPDRTFDPF SETPVDGVIA 700
    ATCSVQVISG QFLSDKKIGT YVEVDMYGLP TDTIRKEFRT RMVMNNGLNP 750
    VYNEESFVFR KVILPDLAVL RIAVYDDNNK LIGQRILPLD GLQAGYRHIS 800
    LRNEGNKPLS LPTIFCNIVL KTYVPDGFGD IVDALSDPKK FLSITEKRAD 850
    QLRAMGIETS DIADVPSDTS KNDKKGKANP AKANVTPQSS SELRPTTTAA 900
    LGSGQEAKKG IELIPQVRIE DLKQMKAYLK HLKKQQKELN SLKKKHAKEH 950
    STMQKLHCTQ VDKIVAQYDK EKSTHEKILE KAMKKKGGSN CLEIKKETEI 1000
    KIQTLTSDHK SKVKEIVAQH TKEWSEMINT HSAEEQEIRD LHLSQQCELL 1050
    RKLLINAHEQ QTQQLKLSHD RESKEMRAHQ AKISMENSKA ISQDKSIKNK 1100
    AERERRVREL NSSNTKKFLE ERKRLAMKQS KEMDQLKKVQ LEHLEFLEKQ 1150
    NEQAKEMQQM VKLEAEMDRR PATVV 1175
    Length:1,175
    Mass (Da):134,497
    Last modified:January 11, 2001 - v2
    Checksum:i7379C6BB95B8FCED
    GO
    Isoform B (identifier: Q9QW07-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1013-1022: VKEIVAQHTK → GKQRDASPSG
         1023-1175: Missing.

    Show »
    Length:1,022
    Mass (Da):116,073
    Checksum:i6F30C698F4E2AA19
    GO
    Isoform C (identifier: Q9QW07-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN

    Show »
    Length:1,194
    Mass (Da):136,139
    Checksum:i1EE7041FC86772AF
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti255 – 2551L → M in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti255 – 2551L → M in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti308 – 3081R → A in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti308 – 3081R → A in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti417 – 4171Q → E in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti417 – 4171Q → E in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti470 – 4701E → K in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti470 – 4701E → K in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti504 – 5041A → AA in AAK13557. (PubMed:8407970)Curated
    Sequence conflicti545 – 5462EQ → DE in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti545 – 5462EQ → DE in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti734 – 7341I → L in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti734 – 7341I → L in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti741 – 7411R → H in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti741 – 7411R → H in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti764 – 7641L → M in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti764 – 7641L → M in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti776 – 7761D → N in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti776 – 7761D → N in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti828 – 8281F → L in AAK13557. (PubMed:8407970)Curated
    Sequence conflicti843 – 8431S → Y in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti843 – 8431S → Y in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti852 – 8521L → M in AAC24984. (PubMed:9931434)Curated
    Sequence conflicti916 – 9161Q → T in AAD10403. (PubMed:7688223)Curated
    Sequence conflicti916 – 9161Q → T in AAC98145. (PubMed:7688223)Curated
    Sequence conflicti1024 – 10241W → C in AAC24984. (PubMed:9931434)Curated
    Sequence conflicti1043 – 10431L → M in AAC24984. (PubMed:9931434)Curated
    Sequence conflicti1057 – 10571A → V in AAC24984. (PubMed:9931434)Curated
    Sequence conflicti1067 – 10671L → V in AAC24984. (PubMed:9931434)Curated
    Sequence conflicti1084 – 10841S → C in AAC24984. (PubMed:9931434)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1013 – 102210VKEIVAQHTK → GKQRDASPSG in isoform B. 1 PublicationVSP_004724
    Alternative sequencei1023 – 1175153Missing in isoform B. 1 PublicationVSP_004725Add
    BLAST
    Alternative sequencei1154 – 117522AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform C. 1 PublicationVSP_004726Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L15556 mRNA. Translation: AAK13557.1.
    U57836 mRNA. Translation: AAD10403.1.
    AF031370 mRNA. Translation: AAC98145.1.
    AF027571 mRNA. Translation: AAC24984.1.
    PIRiA48047.
    RefSeqiNP_077329.1. NM_024353.1.
    UniGeneiRn.6155.

    Genome annotation databases

    GeneIDi25031.
    KEGGirno:25031.
    UCSCiRGD:3345. rat. [Q9QW07-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    L15556 mRNA. Translation: AAK13557.1 .
    U57836 mRNA. Translation: AAD10403.1 .
    AF031370 mRNA. Translation: AAC98145.1 .
    AF027571 mRNA. Translation: AAC24984.1 .
    PIRi A48047.
    RefSeqi NP_077329.1. NM_024353.1.
    UniGenei Rn.6155.

    3D structure databases

    ProteinModelPortali Q9QW07.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 10116.ENSRNOP00000045972.

    PTM databases

    PhosphoSitei Q9QW07.

    Proteomic databases

    PaxDbi Q9QW07.
    PRIDEi Q9QW07.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    GeneIDi 25031.
    KEGGi rno:25031.
    UCSCi RGD:3345. rat. [Q9QW07-1 ]

    Organism-specific databases

    CTDi 5332.
    RGDi 3345. Plcb4.

    Phylogenomic databases

    eggNOGi NOG149692.
    HOGENOMi HOG000232046.
    HOVERGENi HBG053609.
    KOi K05858.

    Enzyme and pathway databases

    BRENDAi 3.1.4.11. 5301.

    Miscellaneous databases

    NextBioi 605179.
    PROi Q9QW07.

    Gene expression databases

    Genevestigatori Q9QW07.

    Family and domain databases

    Gene3Di 1.10.238.10. 1 hit.
    2.30.29.30. 1 hit.
    2.60.40.150. 1 hit.
    3.20.20.190. 2 hits.
    InterProi IPR000008. C2_dom.
    IPR011992. EF-hand-dom_pair.
    IPR011993. PH_like_dom.
    IPR001192. PI-PLC_fam.
    IPR016280. PLC-beta.
    IPR009535. PLC-beta_CS.
    IPR017946. PLC-like_Pdiesterase_TIM-brl.
    IPR015359. PLipase_C_EF-hand-like.
    IPR000909. PLipase_C_PInositol-sp_X_dom.
    IPR001711. PLipase_C_Pinositol-sp_Y.
    [Graphical view ]
    PANTHERi PTHR10336. PTHR10336. 1 hit.
    Pfami PF00168. C2. 1 hit.
    PF06631. DUF1154. 1 hit.
    PF09279. EF-hand_like. 1 hit.
    PF00388. PI-PLC-X. 1 hit.
    PF00387. PI-PLC-Y. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF000956. PLC-beta. 1 hit.
    PRINTSi PR00390. PHPHLIPASEC.
    SMARTi SM00239. C2. 1 hit.
    SM00148. PLCXc. 1 hit.
    SM00149. PLCYc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF49562. SSF49562. 1 hit.
    SSF51695. SSF51695. 2 hits.
    PROSITEi PS50004. C2. 1 hit.
    PS50007. PIPLC_X_DOMAIN. 1 hit.
    PS50008. PIPLC_Y_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Purification, molecular cloning, and sequencing of phospholipase C-beta 4."
      Lee C.-W., Park D.J., Lee K.-H., Kim C.G., Rhee S.G.
      J. Biol. Chem. 268:21318-21327(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
      Strain: Sprague-Dawley.
      Tissue: Brain.
    2. "Cloning of cDNA encoding rat phospholipase C-beta 4, a new member of the phospholipase C."
      Kim M.J., Bahk Y.Y., Min D.S., Lee S.J., Ryu S.H., Suh P.G.
      Biochem. Biophys. Res. Commun. 194:706-712(1993) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
      Strain: Sprague-Dawley.
      Tissue: Brain.
    3. "A unique isoform of phospholipase Cbeta4 highly expressed in the cerebellum and eye."
      Adamski F.M., Timms K.M., Shieh B.H.
      Biochim. Biophys. Acta 1444:55-60(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 447-1175 (ISOFORM C).
      Tissue: Brain.

    Entry informationi

    Entry nameiPLCB4_RAT
    AccessioniPrimary (citable) accession number: Q9QW07
    Secondary accession number(s): O88356, Q9Z0G6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 11, 2001
    Last sequence update: January 11, 2001
    Last modified: October 1, 2014
    This is version 124 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3