SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QW07

- PLCB4_RAT

UniProt

Q9QW07 - PLCB4_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
Gene
Plcb4
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Calcium.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei328 – 3281 By similarity
Active sitei375 – 3751 By similarity

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. mitogen-activated protein kinase binding Source: RGD
  3. phosphatidylinositol phospholipase C activity Source: UniProtKB-EC
  4. signal transducer activity Source: UniProtKB-KW

GO - Biological processi

  1. intracellular signal transduction Source: InterPro
  2. lipid catabolic process Source: UniProtKB-KW
  3. negative regulation of potassium ion transport Source: RGD
  4. phototransduction Source: RGD
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Transducer

Keywords - Biological processi

Lipid degradation, Lipid metabolism

Keywords - Ligandi

Calcium

Enzyme and pathway databases

BRENDAi3.1.4.11. 5301.

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-beta-4
Phospholipase C-beta-4
Short name:
PLC-beta-4
Gene namesi
Name:Plcb4
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi3345. Plcb4.

Subcellular locationi

GO - Cellular componenti

  1. cytoplasm Source: RGD
Complete GO annotation...

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed By similarity
Chaini2 – 117511741-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
PRO_0000088496Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine By similarity
Modified residuei886 – 8861Phosphothreonine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9QW07.
PRIDEiQ9QW07.

PTM databases

PhosphoSiteiQ9QW07.

Expressioni

Tissue specificityi

Preferentially expressed in the retina.

Gene expression databases

GenevestigatoriQ9QW07.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000045972.

Structurei

3D structure databases

ProteinModelPortaliQ9QW07.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini313 – 463151PI-PLC X-box
Add
BLAST
Domaini565 – 681117PI-PLC Y-box
Add
BLAST
Domaini688 – 78699C2
Add
BLAST

Sequence similaritiesi

Contains 1 C2 domain.

Phylogenomic databases

eggNOGiNOG149692.
HOGENOMiHOG000232046.
HOVERGENiHBG053609.
KOiK05858.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProiIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERiPTHR10336. PTHR10336. 1 hit.
PfamiPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PIRSFiPIRSF000956. PLC-beta. 1 hit.
PRINTSiPR00390. PHPHLIPASEC.
SMARTiSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMiSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEiPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform A (identifier: Q9QW07-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAKPYEFNWQ KEVPSFLQEG AVFDRYEEES FVFEPNCLFK VDEFGFFLTW     50
KSEGKEGQVL ECSLINSIRL AAIPKDPKIL AALESVGKSE NDLEGRILCV 100
CSGTDLVNIG FTYMVAENPE ITKQWVEGLR SIIHNFRANN VSPMTCLKKH 150
WMKLAFLTNT SGKIPVRSIT RTFASGKTEK VIFQALKELG LPSGKNDEIE 200
PAAFTYEKFY ELTQKICPRT DIEDLFKKIN GDKTDYLTVD QLVSFLNEHQ 250
RDPRLNEILF PFYDAKRAMQ IIEMYEPDEE LKKKGLISSD GFCRYLMSDE 300
NAPVFLDRLE LYQEMDHPLA HYFISSSHNT YLTGRQFGGK SSVEMYRQVL 350
LAGCRCVELD CWDGKGEDQE PIITHGKAMC TDILFKDVIQ AIKETAFVTS 400
EYPVILSFEN HCSKYQQYQM SKYCEDLFGD LLLKQALESH PLEPGRLLPS 450
PNDLKRKILI KNKRLKPEVE KKQLEALKSM MEAGESAAPA SILEDDNEEE 500
IESADQEEEA HPEYKFGNEL SADDFSHKEA VANSVKKGLV TVEDEQAWMA 550
SYKYVGATTN IHPYLSTMIN YAQPVKFQGF HVAEERNIHY NMSSFNESVG 600
LGYLKTHAIE FVNYNKRQMS RIYPKGGRVD SSNYMPQIFW NAGCQMVSLN 650
YQTPDLAMQL NQGKFEYNGS CGYLLKPDFM RRPDRTFDPF SETPVDGVIA 700
ATCSVQVISG QFLSDKKIGT YVEVDMYGLP TDTIRKEFRT RMVMNNGLNP 750
VYNEESFVFR KVILPDLAVL RIAVYDDNNK LIGQRILPLD GLQAGYRHIS 800
LRNEGNKPLS LPTIFCNIVL KTYVPDGFGD IVDALSDPKK FLSITEKRAD 850
QLRAMGIETS DIADVPSDTS KNDKKGKANP AKANVTPQSS SELRPTTTAA 900
LGSGQEAKKG IELIPQVRIE DLKQMKAYLK HLKKQQKELN SLKKKHAKEH 950
STMQKLHCTQ VDKIVAQYDK EKSTHEKILE KAMKKKGGSN CLEIKKETEI 1000
KIQTLTSDHK SKVKEIVAQH TKEWSEMINT HSAEEQEIRD LHLSQQCELL 1050
RKLLINAHEQ QTQQLKLSHD RESKEMRAHQ AKISMENSKA ISQDKSIKNK 1100
AERERRVREL NSSNTKKFLE ERKRLAMKQS KEMDQLKKVQ LEHLEFLEKQ 1150
NEQAKEMQQM VKLEAEMDRR PATVV 1175
Length:1,175
Mass (Da):134,497
Last modified:January 11, 2001 - v2
Checksum:i7379C6BB95B8FCED
GO
Isoform B (identifier: Q9QW07-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1013-1022: VKEIVAQHTK → GKQRDASPSG
     1023-1175: Missing.

Show »
Length:1,022
Mass (Da):116,073
Checksum:i6F30C698F4E2AA19
GO
Isoform C (identifier: Q9QW07-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN

Show »
Length:1,194
Mass (Da):136,139
Checksum:i1EE7041FC86772AF
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1013 – 102210VKEIVAQHTK → GKQRDASPSG in isoform B.
VSP_004724
Alternative sequencei1023 – 1175153Missing in isoform B.
VSP_004725Add
BLAST
Alternative sequencei1154 – 117522AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform C.
VSP_004726Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti255 – 2551L → M in AAD10403. 1 Publication
Sequence conflicti255 – 2551L → M in AAC98145. 1 Publication
Sequence conflicti308 – 3081R → A in AAD10403. 1 Publication
Sequence conflicti308 – 3081R → A in AAC98145. 1 Publication
Sequence conflicti417 – 4171Q → E in AAD10403. 1 Publication
Sequence conflicti417 – 4171Q → E in AAC98145. 1 Publication
Sequence conflicti470 – 4701E → K in AAD10403. 1 Publication
Sequence conflicti470 – 4701E → K in AAC98145. 1 Publication
Sequence conflicti504 – 5041A → AA in AAK13557. 1 Publication
Sequence conflicti545 – 5462EQ → DE in AAD10403. 1 Publication
Sequence conflicti545 – 5462EQ → DE in AAC98145. 1 Publication
Sequence conflicti734 – 7341I → L in AAD10403. 1 Publication
Sequence conflicti734 – 7341I → L in AAC98145. 1 Publication
Sequence conflicti741 – 7411R → H in AAD10403. 1 Publication
Sequence conflicti741 – 7411R → H in AAC98145. 1 Publication
Sequence conflicti764 – 7641L → M in AAD10403. 1 Publication
Sequence conflicti764 – 7641L → M in AAC98145. 1 Publication
Sequence conflicti776 – 7761D → N in AAD10403. 1 Publication
Sequence conflicti776 – 7761D → N in AAC98145. 1 Publication
Sequence conflicti828 – 8281F → L in AAK13557. 1 Publication
Sequence conflicti843 – 8431S → Y in AAD10403. 1 Publication
Sequence conflicti843 – 8431S → Y in AAC98145. 1 Publication
Sequence conflicti852 – 8521L → M in AAC24984. 1 Publication
Sequence conflicti916 – 9161Q → T in AAD10403. 1 Publication
Sequence conflicti916 – 9161Q → T in AAC98145. 1 Publication
Sequence conflicti1024 – 10241W → C in AAC24984. 1 Publication
Sequence conflicti1043 – 10431L → M in AAC24984. 1 Publication
Sequence conflicti1057 – 10571A → V in AAC24984. 1 Publication
Sequence conflicti1067 – 10671L → V in AAC24984. 1 Publication
Sequence conflicti1084 – 10841S → C in AAC24984. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L15556 mRNA. Translation: AAK13557.1.
U57836 mRNA. Translation: AAD10403.1.
AF031370 mRNA. Translation: AAC98145.1.
AF027571 mRNA. Translation: AAC24984.1.
PIRiA48047.
RefSeqiNP_077329.1. NM_024353.1.
UniGeneiRn.6155.

Genome annotation databases

GeneIDi25031.
KEGGirno:25031.
UCSCiRGD:3345. rat. [Q9QW07-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
L15556 mRNA. Translation: AAK13557.1 .
U57836 mRNA. Translation: AAD10403.1 .
AF031370 mRNA. Translation: AAC98145.1 .
AF027571 mRNA. Translation: AAC24984.1 .
PIRi A48047.
RefSeqi NP_077329.1. NM_024353.1.
UniGenei Rn.6155.

3D structure databases

ProteinModelPortali Q9QW07.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

STRINGi 10116.ENSRNOP00000045972.

PTM databases

PhosphoSitei Q9QW07.

Proteomic databases

PaxDbi Q9QW07.
PRIDEi Q9QW07.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

GeneIDi 25031.
KEGGi rno:25031.
UCSCi RGD:3345. rat. [Q9QW07-1 ]

Organism-specific databases

CTDi 5332.
RGDi 3345. Plcb4.

Phylogenomic databases

eggNOGi NOG149692.
HOGENOMi HOG000232046.
HOVERGENi HBG053609.
KOi K05858.

Enzyme and pathway databases

BRENDAi 3.1.4.11. 5301.

Miscellaneous databases

NextBioi 605179.
PROi Q9QW07.

Gene expression databases

Genevestigatori Q9QW07.

Family and domain databases

Gene3Di 1.10.238.10. 1 hit.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProi IPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view ]
PANTHERi PTHR10336. PTHR10336. 1 hit.
Pfami PF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view ]
PIRSFi PIRSF000956. PLC-beta. 1 hit.
PRINTSi PR00390. PHPHLIPASEC.
SMARTi SM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view ]
SUPFAMi SSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEi PS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Purification, molecular cloning, and sequencing of phospholipase C-beta 4."
    Lee C.-W., Park D.J., Lee K.-H., Kim C.G., Rhee S.G.
    J. Biol. Chem. 268:21318-21327(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
    Strain: Sprague-Dawley.
    Tissue: Brain.
  2. "Cloning of cDNA encoding rat phospholipase C-beta 4, a new member of the phospholipase C."
    Kim M.J., Bahk Y.Y., Min D.S., Lee S.J., Ryu S.H., Suh P.G.
    Biochem. Biophys. Res. Commun. 194:706-712(1993) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
    Strain: Sprague-Dawley.
    Tissue: Brain.
  3. "A unique isoform of phospholipase Cbeta4 highly expressed in the cerebellum and eye."
    Adamski F.M., Timms K.M., Shieh B.H.
    Biochim. Biophys. Acta 1444:55-60(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 447-1175 (ISOFORM C).
    Tissue: Brain.

Entry informationi

Entry nameiPLCB4_RAT
AccessioniPrimary (citable) accession number: Q9QW07
Secondary accession number(s): O88356, Q9Z0G6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 11, 2001
Last modified: June 11, 2014
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi