Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4

Gene

Plcb4

Organism
Rattus norvegicus (Rat)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.

Catalytic activityi

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactori

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei328PROSITE-ProRule annotation1
Active sitei375PROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

  • intracellular signal transduction Source: InterPro
  • lipid catabolic process Source: UniProtKB-KW
  • negative regulation of potassium ion transport Source: RGD
  • phototransduction Source: RGD

Keywordsi

Molecular functionHydrolase, Transducer
Biological processLipid degradation, Lipid metabolism
LigandCalcium

Enzyme and pathway databases

BRENDAi3.1.4.11 5301

Names & Taxonomyi

Protein namesi
Recommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4 (EC:3.1.4.11)
Alternative name(s):
Phosphoinositide phospholipase C-beta-4
Phospholipase C-beta-4
Short name:
PLC-beta-4
Gene namesi
Name:Plcb4
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeRattus
Proteomesi
  • UP000002494 Componenti: Unplaced

Organism-specific databases

RGDi3345 Plcb4

Subcellular locationi

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedBy similarity
ChainiPRO_00000884962 – 11751-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4Add BLAST1174

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineBy similarity1
Modified residuei886PhosphothreonineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9QW07
PRIDEiQ9QW07

PTM databases

iPTMnetiQ9QW07
PhosphoSitePlusiQ9QW07

Expressioni

Tissue specificityi

Preferentially expressed in the retina.

Interactioni

Protein-protein interaction databases

STRINGi10116.ENSRNOP00000045972

Structurei

3D structure databases

ProteinModelPortaliQ9QW07
SMRiQ9QW07
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini313 – 463PI-PLC X-boxPROSITE-ProRule annotationAdd BLAST151
Domaini565 – 681PI-PLC Y-boxPROSITE-ProRule annotationAdd BLAST117
Domaini688 – 786C2PROSITE-ProRule annotationAdd BLAST99

Phylogenomic databases

eggNOGiKOG0169 Eukaryota
ENOG410XPSW LUCA
HOGENOMiHOG000232046
HOVERGENiHBG053609
InParanoidiQ9QW07
KOiK05858

Family and domain databases

CDDicd13361 PH_PLC_beta, 1 hit
Gene3Di2.60.40.150, 1 hit
3.20.20.190, 2 hits
InterProiView protein in InterPro
IPR000008 C2_dom
IPR035892 C2_domain_sf
IPR011992 EF-hand-dom_pair
IPR001192 PI-PLC_fam
IPR016280 PLC-beta
IPR009535 PLC-beta_CS
IPR037862 PLC-beta_PH
IPR017946 PLC-like_Pdiesterase_TIM-brl
IPR015359 PLC_EF-hand-like
IPR000909 PLipase_C_PInositol-sp_X_dom
IPR001711 PLipase_C_Pinositol-sp_Y
PANTHERiPTHR10336 PTHR10336, 1 hit
PfamiView protein in Pfam
PF00168 C2, 1 hit
PF06631 DUF1154, 1 hit
PF09279 EF-hand_like, 1 hit
PF00388 PI-PLC-X, 1 hit
PF00387 PI-PLC-Y, 1 hit
PIRSFiPIRSF000956 PLC-beta, 1 hit
PRINTSiPR00390 PHPHLIPASEC
SMARTiView protein in SMART
SM00239 C2, 1 hit
SM00148 PLCXc, 1 hit
SM00149 PLCYc, 1 hit
SUPFAMiSSF47473 SSF47473, 1 hit
SSF51695 SSF51695, 2 hits
PROSITEiView protein in PROSITE
PS50004 C2, 1 hit
PS50007 PIPLC_X_DOMAIN, 1 hit
PS50008 PIPLC_Y_DOMAIN, 1 hit

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform A (identifier: Q9QW07-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAKPYEFNWQ KEVPSFLQEG AVFDRYEEES FVFEPNCLFK VDEFGFFLTW
60 70 80 90 100
KSEGKEGQVL ECSLINSIRL AAIPKDPKIL AALESVGKSE NDLEGRILCV
110 120 130 140 150
CSGTDLVNIG FTYMVAENPE ITKQWVEGLR SIIHNFRANN VSPMTCLKKH
160 170 180 190 200
WMKLAFLTNT SGKIPVRSIT RTFASGKTEK VIFQALKELG LPSGKNDEIE
210 220 230 240 250
PAAFTYEKFY ELTQKICPRT DIEDLFKKIN GDKTDYLTVD QLVSFLNEHQ
260 270 280 290 300
RDPRLNEILF PFYDAKRAMQ IIEMYEPDEE LKKKGLISSD GFCRYLMSDE
310 320 330 340 350
NAPVFLDRLE LYQEMDHPLA HYFISSSHNT YLTGRQFGGK SSVEMYRQVL
360 370 380 390 400
LAGCRCVELD CWDGKGEDQE PIITHGKAMC TDILFKDVIQ AIKETAFVTS
410 420 430 440 450
EYPVILSFEN HCSKYQQYQM SKYCEDLFGD LLLKQALESH PLEPGRLLPS
460 470 480 490 500
PNDLKRKILI KNKRLKPEVE KKQLEALKSM MEAGESAAPA SILEDDNEEE
510 520 530 540 550
IESADQEEEA HPEYKFGNEL SADDFSHKEA VANSVKKGLV TVEDEQAWMA
560 570 580 590 600
SYKYVGATTN IHPYLSTMIN YAQPVKFQGF HVAEERNIHY NMSSFNESVG
610 620 630 640 650
LGYLKTHAIE FVNYNKRQMS RIYPKGGRVD SSNYMPQIFW NAGCQMVSLN
660 670 680 690 700
YQTPDLAMQL NQGKFEYNGS CGYLLKPDFM RRPDRTFDPF SETPVDGVIA
710 720 730 740 750
ATCSVQVISG QFLSDKKIGT YVEVDMYGLP TDTIRKEFRT RMVMNNGLNP
760 770 780 790 800
VYNEESFVFR KVILPDLAVL RIAVYDDNNK LIGQRILPLD GLQAGYRHIS
810 820 830 840 850
LRNEGNKPLS LPTIFCNIVL KTYVPDGFGD IVDALSDPKK FLSITEKRAD
860 870 880 890 900
QLRAMGIETS DIADVPSDTS KNDKKGKANP AKANVTPQSS SELRPTTTAA
910 920 930 940 950
LGSGQEAKKG IELIPQVRIE DLKQMKAYLK HLKKQQKELN SLKKKHAKEH
960 970 980 990 1000
STMQKLHCTQ VDKIVAQYDK EKSTHEKILE KAMKKKGGSN CLEIKKETEI
1010 1020 1030 1040 1050
KIQTLTSDHK SKVKEIVAQH TKEWSEMINT HSAEEQEIRD LHLSQQCELL
1060 1070 1080 1090 1100
RKLLINAHEQ QTQQLKLSHD RESKEMRAHQ AKISMENSKA ISQDKSIKNK
1110 1120 1130 1140 1150
AERERRVREL NSSNTKKFLE ERKRLAMKQS KEMDQLKKVQ LEHLEFLEKQ
1160 1170
NEQAKEMQQM VKLEAEMDRR PATVV
Length:1,175
Mass (Da):134,497
Last modified:January 11, 2001 - v2
Checksum:i7379C6BB95B8FCED
GO
Isoform B (identifier: Q9QW07-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1013-1022: VKEIVAQHTK → GKQRDASPSG
     1023-1175: Missing.

Show »
Length:1,022
Mass (Da):116,073
Checksum:i6F30C698F4E2AA19
GO
Isoform C (identifier: Q9QW07-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN

Show »
Length:1,194
Mass (Da):136,139
Checksum:i1EE7041FC86772AF
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti255L → M in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti255L → M in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti308R → A in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti308R → A in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti417Q → E in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti417Q → E in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti470E → K in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti470E → K in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti504A → AA in AAK13557 (PubMed:8407970).Curated1
Sequence conflicti545 – 546EQ → DE in AAD10403 (PubMed:7688223).Curated2
Sequence conflicti545 – 546EQ → DE in AAC98145 (PubMed:7688223).Curated2
Sequence conflicti734I → L in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti734I → L in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti741R → H in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti741R → H in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti764L → M in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti764L → M in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti776D → N in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti776D → N in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti828F → L in AAK13557 (PubMed:8407970).Curated1
Sequence conflicti843S → Y in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti843S → Y in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti852L → M in AAC24984 (PubMed:9931434).Curated1
Sequence conflicti916Q → T in AAD10403 (PubMed:7688223).Curated1
Sequence conflicti916Q → T in AAC98145 (PubMed:7688223).Curated1
Sequence conflicti1024W → C in AAC24984 (PubMed:9931434).Curated1
Sequence conflicti1043L → M in AAC24984 (PubMed:9931434).Curated1
Sequence conflicti1057A → V in AAC24984 (PubMed:9931434).Curated1
Sequence conflicti1067L → V in AAC24984 (PubMed:9931434).Curated1
Sequence conflicti1084S → C in AAC24984 (PubMed:9931434).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0047241013 – 1022VKEIVAQHTK → GKQRDASPSG in isoform B. 1 Publication10
Alternative sequenceiVSP_0047251023 – 1175Missing in isoform B. 1 PublicationAdd BLAST153
Alternative sequenceiVSP_0047261154 – 1175AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform C. 1 PublicationAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
L15556 mRNA Translation: AAK13557.1
U57836 mRNA Translation: AAD10403.1
AF031370 mRNA Translation: AAC98145.1
AF027571 mRNA Translation: AAC24984.1
PIRiA48047
RefSeqiNP_077329.1, NM_024353.1
UniGeneiRn.6155

Genome annotation databases

GeneIDi25031
KEGGirno:25031
UCSCiRGD:3345 rat [Q9QW07-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPLCB4_RAT
AccessioniPrimary (citable) accession number: Q9QW07
Secondary accession number(s): O88356, Q9Z0G6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 11, 2001
Last modified: May 23, 2018
This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health