Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9QW07 (PLCB4_RAT) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 121. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4

EC=3.1.4.11
Alternative name(s):
Phosphoinositide phospholipase C-beta-4
Phospholipase C-beta-4
Short name=PLC-beta-4
Gene names
Name:Plcb4
OrganismRattus norvegicus (Rat) [Reference proteome]
Taxonomic identifier10116 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus

Protein attributes

Sequence length1175 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

The production of the second messenger molecules diacylglycerol (DAG) and inositol 1,4,5-trisphosphate (IP3) is mediated by activated phosphatidylinositol-specific phospholipase C enzymes. This form has a role in retina signal transduction.

Catalytic activity

1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate + H2O = 1D-myo-inositol 1,4,5-trisphosphate + diacylglycerol.

Cofactor

Calcium.

Tissue specificity

Preferentially expressed in the retina.

Sequence similarities

Contains 1 C2 domain.

Contains 1 PI-PLC X-box domain.

Contains 1 PI-PLC Y-box domain.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform A (identifier: Q9QW07-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform B (identifier: Q9QW07-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1013-1022: VKEIVAQHTK → GKQRDASPSG
     1023-1175: Missing.
Isoform C (identifier: Q9QW07-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1154-1175: AKEMQQMVKLEAEMDRRPATVV → LLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 117511741-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
PRO_0000088496

Regions

Domain313 – 463151PI-PLC X-box
Domain565 – 681117PI-PLC Y-box
Domain688 – 78699C2

Sites

Active site3281 By similarity
Active site3751 By similarity

Amino acid modifications

Modified residue21N-acetylalanine By similarity
Modified residue8861Phosphothreonine By similarity

Natural variations

Alternative sequence1013 – 102210VKEIVAQHTK → GKQRDASPSG in isoform B.
VSP_004724
Alternative sequence1023 – 1175153Missing in isoform B.
VSP_004725
Alternative sequence1154 – 117522AKEMQ…PATVV → LLKSCHAVSQTQGEGDAADG EIGSRDGPQTSNSSMKLQNA N in isoform C.
VSP_004726

Experimental info

Sequence conflict2551L → M in AAD10403. Ref.2
Sequence conflict2551L → M in AAC98145. Ref.2
Sequence conflict3081R → A in AAD10403. Ref.2
Sequence conflict3081R → A in AAC98145. Ref.2
Sequence conflict4171Q → E in AAD10403. Ref.2
Sequence conflict4171Q → E in AAC98145. Ref.2
Sequence conflict4701E → K in AAD10403. Ref.2
Sequence conflict4701E → K in AAC98145. Ref.2
Sequence conflict5041A → AA in AAK13557. Ref.1
Sequence conflict545 – 5462EQ → DE in AAD10403. Ref.2
Sequence conflict545 – 5462EQ → DE in AAC98145. Ref.2
Sequence conflict7341I → L in AAD10403. Ref.2
Sequence conflict7341I → L in AAC98145. Ref.2
Sequence conflict7411R → H in AAD10403. Ref.2
Sequence conflict7411R → H in AAC98145. Ref.2
Sequence conflict7641L → M in AAD10403. Ref.2
Sequence conflict7641L → M in AAC98145. Ref.2
Sequence conflict7761D → N in AAD10403. Ref.2
Sequence conflict7761D → N in AAC98145. Ref.2
Sequence conflict8281F → L in AAK13557. Ref.1
Sequence conflict8431S → Y in AAD10403. Ref.2
Sequence conflict8431S → Y in AAC98145. Ref.2
Sequence conflict8521L → M in AAC24984. Ref.3
Sequence conflict9161Q → T in AAD10403. Ref.2
Sequence conflict9161Q → T in AAC98145. Ref.2
Sequence conflict10241W → C in AAC24984. Ref.3
Sequence conflict10431L → M in AAC24984. Ref.3
Sequence conflict10571A → V in AAC24984. Ref.3
Sequence conflict10671L → V in AAC24984. Ref.3
Sequence conflict10841S → C in AAC24984. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform A [UniParc].

Last modified January 11, 2001. Version 2.
Checksum: 7379C6BB95B8FCED

FASTA1,175134,497
        10         20         30         40         50         60 
MAKPYEFNWQ KEVPSFLQEG AVFDRYEEES FVFEPNCLFK VDEFGFFLTW KSEGKEGQVL 

        70         80         90        100        110        120 
ECSLINSIRL AAIPKDPKIL AALESVGKSE NDLEGRILCV CSGTDLVNIG FTYMVAENPE 

       130        140        150        160        170        180 
ITKQWVEGLR SIIHNFRANN VSPMTCLKKH WMKLAFLTNT SGKIPVRSIT RTFASGKTEK 

       190        200        210        220        230        240 
VIFQALKELG LPSGKNDEIE PAAFTYEKFY ELTQKICPRT DIEDLFKKIN GDKTDYLTVD 

       250        260        270        280        290        300 
QLVSFLNEHQ RDPRLNEILF PFYDAKRAMQ IIEMYEPDEE LKKKGLISSD GFCRYLMSDE 

       310        320        330        340        350        360 
NAPVFLDRLE LYQEMDHPLA HYFISSSHNT YLTGRQFGGK SSVEMYRQVL LAGCRCVELD 

       370        380        390        400        410        420 
CWDGKGEDQE PIITHGKAMC TDILFKDVIQ AIKETAFVTS EYPVILSFEN HCSKYQQYQM 

       430        440        450        460        470        480 
SKYCEDLFGD LLLKQALESH PLEPGRLLPS PNDLKRKILI KNKRLKPEVE KKQLEALKSM 

       490        500        510        520        530        540 
MEAGESAAPA SILEDDNEEE IESADQEEEA HPEYKFGNEL SADDFSHKEA VANSVKKGLV 

       550        560        570        580        590        600 
TVEDEQAWMA SYKYVGATTN IHPYLSTMIN YAQPVKFQGF HVAEERNIHY NMSSFNESVG 

       610        620        630        640        650        660 
LGYLKTHAIE FVNYNKRQMS RIYPKGGRVD SSNYMPQIFW NAGCQMVSLN YQTPDLAMQL 

       670        680        690        700        710        720 
NQGKFEYNGS CGYLLKPDFM RRPDRTFDPF SETPVDGVIA ATCSVQVISG QFLSDKKIGT 

       730        740        750        760        770        780 
YVEVDMYGLP TDTIRKEFRT RMVMNNGLNP VYNEESFVFR KVILPDLAVL RIAVYDDNNK 

       790        800        810        820        830        840 
LIGQRILPLD GLQAGYRHIS LRNEGNKPLS LPTIFCNIVL KTYVPDGFGD IVDALSDPKK 

       850        860        870        880        890        900 
FLSITEKRAD QLRAMGIETS DIADVPSDTS KNDKKGKANP AKANVTPQSS SELRPTTTAA 

       910        920        930        940        950        960 
LGSGQEAKKG IELIPQVRIE DLKQMKAYLK HLKKQQKELN SLKKKHAKEH STMQKLHCTQ 

       970        980        990       1000       1010       1020 
VDKIVAQYDK EKSTHEKILE KAMKKKGGSN CLEIKKETEI KIQTLTSDHK SKVKEIVAQH 

      1030       1040       1050       1060       1070       1080 
TKEWSEMINT HSAEEQEIRD LHLSQQCELL RKLLINAHEQ QTQQLKLSHD RESKEMRAHQ 

      1090       1100       1110       1120       1130       1140 
AKISMENSKA ISQDKSIKNK AERERRVREL NSSNTKKFLE ERKRLAMKQS KEMDQLKKVQ 

      1150       1160       1170 
LEHLEFLEKQ NEQAKEMQQM VKLEAEMDRR PATVV 

« Hide

Isoform B [UniParc].

Checksum: 6F30C698F4E2AA19
Show »

FASTA1,022116,073
Isoform C [UniParc].

Checksum: 1EE7041FC86772AF
Show »

FASTA1,194136,139

References

[1]"Purification, molecular cloning, and sequencing of phospholipase C-beta 4."
Lee C.-W., Park D.J., Lee K.-H., Kim C.G., Rhee S.G.
J. Biol. Chem. 268:21318-21327(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
Strain: Sprague-Dawley.
Tissue: Brain.
[2]"Cloning of cDNA encoding rat phospholipase C-beta 4, a new member of the phospholipase C."
Kim M.J., Bahk Y.Y., Min D.S., Lee S.J., Ryu S.H., Suh P.G.
Biochem. Biophys. Res. Commun. 194:706-712(1993) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
Strain: Sprague-Dawley.
Tissue: Brain.
[3]"A unique isoform of phospholipase Cbeta4 highly expressed in the cerebellum and eye."
Adamski F.M., Timms K.M., Shieh B.H.
Biochim. Biophys. Acta 1444:55-60(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 447-1175 (ISOFORM C).
Tissue: Brain.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
L15556 mRNA. Translation: AAK13557.1.
U57836 mRNA. Translation: AAD10403.1.
AF031370 mRNA. Translation: AAC98145.1.
AF027571 mRNA. Translation: AAC24984.1.
PIRA48047.
RefSeqNP_077329.1. NM_024353.1.
UniGeneRn.6155.

3D structure databases

ProteinModelPortalQ9QW07.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING10116.ENSRNOP00000045972.

PTM databases

PhosphoSiteQ9QW07.

Proteomic databases

PaxDbQ9QW07.
PRIDEQ9QW07.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

GeneID25031.
KEGGrno:25031.
UCSCRGD:3345. rat. [Q9QW07-1]

Organism-specific databases

CTD5332.
RGD3345. Plcb4.

Phylogenomic databases

eggNOGNOG149692.
HOGENOMHOG000232046.
HOVERGENHBG053609.
KOK05858.

Enzyme and pathway databases

BRENDA3.1.4.11. 5301.

Gene expression databases

GenevestigatorQ9QW07.

Family and domain databases

Gene3D1.10.238.10. 1 hit.
2.30.29.30. 1 hit.
2.60.40.150. 1 hit.
3.20.20.190. 2 hits.
InterProIPR000008. C2_dom.
IPR011992. EF-hand-dom_pair.
IPR011993. PH_like_dom.
IPR001192. PI-PLC_fam.
IPR016280. PLC-beta.
IPR009535. PLC-beta_CS.
IPR017946. PLC-like_Pdiesterase_TIM-brl.
IPR028404. PLC_beta4/NorpA.
IPR015359. PLipase_C_EF-hand-like.
IPR000909. PLipase_C_PInositol-sp_X_dom.
IPR001711. PLipase_C_Pinositol-sp_Y.
[Graphical view]
PANTHERPTHR10336. PTHR10336. 1 hit.
PTHR10336:SF8. PTHR10336:SF8. 1 hit.
PfamPF00168. C2. 1 hit.
PF06631. DUF1154. 1 hit.
PF09279. EF-hand_like. 1 hit.
PF00388. PI-PLC-X. 1 hit.
PF00387. PI-PLC-Y. 1 hit.
[Graphical view]
PIRSFPIRSF000956. PLC-beta. 1 hit.
PRINTSPR00390. PHPHLIPASEC.
SMARTSM00239. C2. 1 hit.
SM00148. PLCXc. 1 hit.
SM00149. PLCYc. 1 hit.
[Graphical view]
SUPFAMSSF49562. SSF49562. 1 hit.
SSF51695. SSF51695. 2 hits.
PROSITEPS50004. C2. 1 hit.
PS50007. PIPLC_X_DOMAIN. 1 hit.
PS50008. PIPLC_Y_DOMAIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio605179.
PROQ9QW07.

Entry information

Entry namePLCB4_RAT
AccessionPrimary (citable) accession number: Q9QW07
Secondary accession number(s): O88356, Q9Z0G6
Entry history
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: January 11, 2001
Last modified: April 16, 2014
This is version 121 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families