Q9QUM4 (SLAF1_MOUSE) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Signaling lymphocytic activation molecule Alternative name(s): CD_antigen=CD150 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) [Reference proteome] | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus › Mus![]() |
Protein attributes
| Sequence length | 343 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | High-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates. |
| Subunit structure | Interacts with INPP5D/SHIP1 By similarity. Interacts (via cytoplasmic domain) with SH2D1A. Interacts (upon tyrosine phosphorylation with) PTPN11, but not with SHP-1. |
| Subcellular location | Cell membrane; Single-pass type I membrane protein. Note: Present on the surface of B-cells and T-cells. |
| Domain | The most membrane-proximal SH2-binding motif interacts with SH2 domain of SH2D1A and does not need to be phosphorylated on tyrosine residues By similarity. |
| Post-translational modification | Phosphorylated. |
| Sequence similarities | Contains 1 Ig-like C2-type (immunoglobulin-like) domain. Contains 1 Ig-like V-type (immunoglobulin-like) domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Immunoglobulin domain Repeat Signal Transmembrane Transmembrane helix |
| Molecular function | Receptor |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | lymphocyte activation Inferred from electronic annotation. Source: InterPro |
| Cellular_component | external side of plasma membrane Inferred from direct assay PubMed 18971422PubMed 20660734. Source: MGI integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: Q9QUM4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: Q9QUM4-2) The sequence of this isoform differs from the canonical sequence as follows: 296-343: PQEKKLHDAL...VYASVTLPES → VRSMPHLAGVSVIFRTGFLIAALHTTMVLQGLLE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 24 | 24 | Potential | ||||||||
| Chain | 25 – 343 | 319 | Signaling lymphocytic activation molecule | PRO_0000014960 | |||||||
Regions | |||||||||||
| Topological domain | 25 – 242 | 218 | Extracellular Potential | ||||||||
| Transmembrane | 243 – 265 | 23 | Helical; Potential | ||||||||
| Topological domain | 266 – 343 | 78 | Cytoplasmic Potential | ||||||||
| Domain | 145 – 228 | 84 | Ig-like C2-type | ||||||||
| Domain | ? – 153 | Ig-like V-type | |||||||||
| Motif | 286 – 291 | 6 | SH2-binding Potential | ||||||||
| Motif | 313 – 318 | 6 | SH2-binding Potential | ||||||||
| Motif | 333 – 338 | 6 | SH2-binding Potential | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 54 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 58 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 103 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 126 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 151 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 158 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 192 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 211 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 226 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 161 ↔ 232 | By similarity | |||||||||
| Disulfide bond | 167 ↔ 212 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 296 – 343 | 48 | PQEKK…TLPES → VRSMPHLAGVSVIFRTGFLI AALHTTMVLQGLLE in isoform Short. | VSP_002570 | |||||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Molecular and functional characterization of mouse signaling lymphocytic activation molecule (SLAM): differential expression and responsiveness in Th1 and Th2 cells." Castro A.G., Hauser T.M., Cocks B.G., Abrams J., Zurawski S., Churakova T., Zonin F., Robinson D., Tangye S.G., Aversa G., Nichols K.E., de Vries J.E., Lanier L.L., O'Garra A. J. Immunol. 163:5860-5870(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT). Strain: BALB/c. |
| [2] | "The cell surface receptor SLAM controls T cell and macrophage functions." Wang N., Satoskar A., Faubion W., Howie D., Okamoto S., Feske S., Gullo C., Clarke K., Sosa M.R., Sharpe A.H., Terhorst C. J. Exp. Med. 199:1255-1264(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM LONG). |
| [3] | "Genomic organization of murine Slam." Wu C., Wang N., Sayos J., Terhorst C. Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF149791 mRNA. Translation: AAF22231.1. AF149792 mRNA. Translation: AAF22232.1. AF164523 AF164522 Genomic DNA. Translation: AAF13818.1.AF160990 mRNA. Translation: AAF14535.1. |
| IPI | IPI00131832. IPI00227162. |
| RefSeq | NP_038758.2. NM_013730.4. |
| UniGene | Mm.103648. |
3D structure databases | |
| ProteinModelPortal | Q9QUM4. |
| SMR | Q9QUM4. Positions 32-141, 162-228. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-205762. |
PTM databases | |
| PhosphoSite | Q9QUM4. |
Proteomic databases | |
| PaxDb | Q9QUM4. |
| PRIDE | Q9QUM4. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSMUST00000015460; ENSMUSP00000015460; ENSMUSG00000015316. |
| GeneID | 27218. |
| KEGG | mmu:27218. |
Organism-specific databases | |
| CTD | 6504. |
| MGI | MGI:1351314. Slamf1. |
Phylogenomic databases | |
| eggNOG | NOG40451. |
| GeneTree | ENSGT00510000048858. |
| HOGENOM | HOG000125310. |
| HOVERGEN | HBG054224. |
| InParanoid | Q9QUM4. |
| KO | K06536. |
| OMA | LYEQVST. |
| OrthoDB | EOG4CJVHV. |
Gene expression databases | |
| ArrayExpress | Q9QUM4. |
| Bgee | Q9QUM4. |
| Genevestigator | Q9QUM4. |
| GermOnline | ENSMUSG00000015316. Mus musculus. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 1 hit. |
| InterPro | IPR007110. Ig-like_dom. IPR013783. Ig-like_fold. IPR010407. Sig_lymph_act_molc_N. IPR015631. SLAM_fam_rcpts. [Graphical view] |
| PANTHER | PTHR12080. PTHR12080. 1 hit. |
| Pfam | PF06214. SLAM. 1 hit. [Graphical view] |
| ProDom | PD090491. Sig_lymph_act_molc_N. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| PROSITE | PS50835. IG_LIKE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 305116. |
| SOURCE | Search... |
Entry information
| Entry name | SLAF1_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q9QUM4 Secondary accession number(s): Q9QXZ3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
