Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9QUM4 (SLAF1_MOUSE) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 109. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Signaling lymphocytic activation molecule
Alternative name(s):
CD_antigen=CD150
Gene names
Name:Slamf1
Synonyms:Slam
OrganismMus musculus (Mouse) [Reference proteome]
Taxonomic identifier10090 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus

Protein attributes

Sequence length343 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

High-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.

Subunit structure

Interacts with INPP5D/SHIP1 By similarity. Interacts (via cytoplasmic domain) with SH2D1A and SH2D1B. Interacts (upon tyrosine phosphorylation with) PTPN11, but not with SHP-1. Ref.4

Subcellular location

Cell membrane; Single-pass type I membrane protein. Note: Present on the surface of B-cells and T-cells.

Domain

The most membrane-proximal SH2-binding motif interacts with SH2 domain of SH2D1A and does not need to be phosphorylated on tyrosine residues By similarity.

Post-translational modification

Phosphorylated.

Sequence similarities

Contains 1 Ig-like C2-type (immunoglobulin-like) domain.

Contains 1 Ig-like V-type (immunoglobulin-like) domain.

Binary interactions

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform Long (identifier: Q9QUM4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Short (identifier: Q9QUM4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     296-343: PQEKKLHDAL...VYASVTLPES → VRSMPHLAGVSVIFRTGFLIAALHTTMVLQGLLE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2424 Potential
Chain25 – 343319Signaling lymphocytic activation molecule
PRO_0000014960

Regions

Topological domain25 – 242218Extracellular Potential
Transmembrane243 – 26523Helical; Potential
Topological domain266 – 34378Cytoplasmic Potential
Domain145 – 22884Ig-like C2-type
Domain? – 153Ig-like V-type
Motif286 – 2916SH2-binding Potential
Motif313 – 3186SH2-binding Potential
Motif333 – 3386SH2-binding Potential

Amino acid modifications

Glycosylation541N-linked (GlcNAc...) Potential
Glycosylation581N-linked (GlcNAc...) Potential
Glycosylation1031N-linked (GlcNAc...) Potential
Glycosylation1261N-linked (GlcNAc...) Potential
Glycosylation1511N-linked (GlcNAc...) Potential
Glycosylation1581N-linked (GlcNAc...) Potential
Glycosylation1921N-linked (GlcNAc...) Potential
Glycosylation2111N-linked (GlcNAc...) Potential
Glycosylation2261N-linked (GlcNAc...) Potential
Disulfide bond161 ↔ 232 By similarity
Disulfide bond167 ↔ 212 By similarity

Natural variations

Alternative sequence296 – 34348PQEKK…TLPES → VRSMPHLAGVSVIFRTGFLI AALHTTMVLQGLLE in isoform Short.
VSP_002570

Sequences

Sequence LengthMass (Da)Tools
Isoform Long [UniParc].

Last modified May 1, 2000. Version 1.
Checksum: 7980470157E834C4

FASTA34338,094
        10         20         30         40         50         60 
MDPKGSLSWR ILLFLSLAFE LSYGTGGGVM DCPVILQKLG QDTWLPLTNE HQINKSVNKS 

        70         80         90        100        110        120 
VRILVTMATS PGSKSNKKIV SFDLSKGSYP DHLEDGYHFQ SKNLSLKILG NRRESEGWYL 

       130        140        150        160        170        180 
VSVEENVSVQ QFCKQLKLYE QVSPPEIKVL NKTQENENGT CSLLLACTVK KGDHVTYSWS 

       190        200        210        220        230        240 
DEAGTHLLSR ANRSHLLHIT LSNQHQDSIY NCTASNPVSS ISRTFNLSSQ ACKQESSSES 

       250        260        270        280        290        300 
SPWMQYTLVP LGVVIIFILV FTAIIMMKRQ GKSNHCQPPV EEKSLTIYAQ VQKSGPQEKK 

       310        320        330        340 
LHDALTDQDP CTTIYVAATE PAPESVQEPN PTTVYASVTL PES 

« Hide

Isoform Short [UniParc].

Checksum: 3F43476A7CD3686F
Show »

FASTA32936,590

References

[1]"Molecular and functional characterization of mouse signaling lymphocytic activation molecule (SLAM): differential expression and responsiveness in Th1 and Th2 cells."
Castro A.G., Hauser T.M., Cocks B.G., Abrams J., Zurawski S., Churakova T., Zonin F., Robinson D., Tangye S.G., Aversa G., Nichols K.E., de Vries J.E., Lanier L.L., O'Garra A.
J. Immunol. 163:5860-5870(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
Strain: BALB/c.
[2]"The cell surface receptor SLAM controls T cell and macrophage functions."
Wang N., Satoskar A., Faubion W., Howie D., Okamoto S., Feske S., Gullo C., Clarke K., Sosa M.R., Sharpe A.H., Terhorst C.
J. Exp. Med. 199:1255-1264(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM LONG).
[3]"Genomic organization of murine Slam."
Wu C., Wang N., Sayos J., Terhorst C.
Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
[4]"Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells."
Morra M., Lu J., Poy F., Martin M., Sayos J., Calpe S., Gullo C., Howie D., Rietdijk S., Thompson A., Coyle A.J., Denny C., Yaffe M.B., Engel P., Eck M.J., Terhorst C.
EMBO J. 20:5840-5852(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH SH2D1B.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF149791 mRNA. Translation: AAF22231.1.
AF149792 mRNA. Translation: AAF22232.1.
AF164523 expand/collapse EMBL AC list , AF164519, AF164520, AF164521, AF164522 Genomic DNA. Translation: AAF13818.1.
AF160990 mRNA. Translation: AAF14535.1.
RefSeqNP_038758.2. NM_013730.4.
UniGeneMm.103648.

3D structure databases

ProteinModelPortalQ9QUM4.
SMRQ9QUM4. Positions 31-228.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid205139. 2 interactions.
IntActQ9QUM4. 3 interactions.
MINTMINT-205762.

PTM databases

PhosphoSiteQ9QUM4.

Proteomic databases

PaxDbQ9QUM4.
PRIDEQ9QUM4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSMUST00000015460; ENSMUSP00000015460; ENSMUSG00000015316. [Q9QUM4-1]
GeneID27218.
KEGGmmu:27218.
UCSCuc007dpc.1. mouse. [Q9QUM4-1]

Organism-specific databases

CTD6504.
MGIMGI:1351314. Slamf1.

Phylogenomic databases

eggNOGNOG40451.
GeneTreeENSGT00510000048858.
HOGENOMHOG000125310.
HOVERGENHBG054224.
InParanoidQ9QUM4.
KOK06536.
OMALYEQVST.
OrthoDBEOG7Q8CQJ.
PhylomeDBQ9QUM4.
TreeFamTF334964.

Gene expression databases

ArrayExpressQ9QUM4.
BgeeQ9QUM4.
GenevestigatorQ9QUM4.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
InterProIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR010407. Sig_lymph_act_molc_N.
IPR015631. SLAM_fam_rcpts.
[Graphical view]
PANTHERPTHR12080. PTHR12080. 1 hit.
PfamPF06214. SLAM. 1 hit.
[Graphical view]
ProDomPD090491. Sig_lymph_act_molc_N. 1 hit.
[Graphical view] [Entries sharing at least one domain]
PROSITEPS50835. IG_LIKE. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio305116.
PROQ9QUM4.
SOURCESearch...

Entry information

Entry nameSLAF1_MOUSE
AccessionPrimary (citable) accession number: Q9QUM4
Secondary accession number(s): Q9QXZ3
Entry history
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: April 16, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families

MGD cross-references

Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot