Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QUM4

- SLAF1_MOUSE

UniProt

Q9QUM4 - SLAF1_MOUSE

Protein

Signaling lymphocytic activation molecule

Gene

Slamf1

Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 1 (01 May 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    High-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.

    GO - Molecular functioni

    1. protein binding Source: IntAct
    2. receptor activity Source: InterPro

    GO - Biological processi

    1. lymphocyte activation Source: InterPro
    2. regulation of catalytic activity Source: MGI
    3. regulation of vesicle fusion Source: MGI

    Keywords - Molecular functioni

    Receptor

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Signaling lymphocytic activation molecule
    Alternative name(s):
    CD_antigen: CD150
    Gene namesi
    Name:Slamf1
    Synonyms:Slam
    OrganismiMus musculus (Mouse)
    Taxonomic identifieri10090 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
    ProteomesiUP000000589: Chromosome 1

    Organism-specific databases

    MGIiMGI:1351314. Slamf1.

    Subcellular locationi

    Cell membrane; Single-pass type I membrane protein
    Note: Present on the surface of B-cells and T-cells.

    GO - Cellular componenti

    1. external side of plasma membrane Source: MGI
    2. integral component of membrane Source: UniProtKB-KW
    3. phagocytic vesicle Source: MGI

    Keywords - Cellular componenti

    Cell membrane, Membrane

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2424Sequence AnalysisAdd
    BLAST
    Chaini25 – 343319Signaling lymphocytic activation moleculePRO_0000014960Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi54 – 541N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi58 – 581N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi103 – 1031N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi126 – 1261N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi151 – 1511N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi158 – 1581N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi161 ↔ 232PROSITE-ProRule annotation
    Disulfide bondi167 ↔ 212PROSITE-ProRule annotation
    Glycosylationi192 – 1921N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi211 – 2111N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi226 – 2261N-linked (GlcNAc...)Sequence Analysis

    Post-translational modificationi

    Phosphorylated.

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ9QUM4.
    PRIDEiQ9QUM4.

    PTM databases

    PhosphoSiteiQ9QUM4.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9QUM4.
    BgeeiQ9QUM4.
    GenevestigatoriQ9QUM4.

    Interactioni

    Subunit structurei

    Interacts with INPP5D/SHIP1 By similarity. Interacts (via cytoplasmic domain) with SH2D1A and SH2D1B. Interacts (upon tyrosine phosphorylation with) PTPN11, but not with SHP-1.By similarity1 Publication

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    FynP396884EBI-7910086,EBI-524514
    Sh2d1aO888902EBI-7910086,EBI-7910438

    Protein-protein interaction databases

    BioGridi205139. 2 interactions.
    IntActiQ9QUM4. 3 interactions.
    MINTiMINT-205762.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9QUM4.
    SMRiQ9QUM4. Positions 32-141.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini25 – 242218ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini266 – 34378CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei243 – 26523HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini? – 153Ig-like V-type
    Domaini145 – 22884Ig-like C2-typeAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi286 – 2916SH2-bindingSequence Analysis
    Motifi313 – 3186SH2-bindingSequence Analysis
    Motifi333 – 3386SH2-bindingSequence Analysis

    Domaini

    The most membrane-proximal SH2-binding motif interacts with SH2 domain of SH2D1A and does not need to be phosphorylated on tyrosine residues.By similarity

    Sequence similaritiesi

    Keywords - Domaini

    Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG40451.
    GeneTreeiENSGT00510000048858.
    HOGENOMiHOG000125310.
    HOVERGENiHBG054224.
    InParanoidiQ9QUM4.
    KOiK06536.
    OMAiLYEQVST.
    OrthoDBiEOG7Q8CQJ.
    PhylomeDBiQ9QUM4.
    TreeFamiTF334964.

    Family and domain databases

    Gene3Di2.60.40.10. 1 hit.
    InterProiIPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR010407. Sig_lymph_act_molc_N.
    IPR015631. SLAM_fam_rcpts.
    [Graphical view]
    PANTHERiPTHR12080. PTHR12080. 1 hit.
    PfamiPF06214. SLAM. 1 hit.
    [Graphical view]
    ProDomiPD090491. Sig_lymph_act_molc_N. 1 hit.
    [Graphical view] [Entries sharing at least one domain]
    PROSITEiPS50835. IG_LIKE. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform Long (identifier: Q9QUM4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDPKGSLSWR ILLFLSLAFE LSYGTGGGVM DCPVILQKLG QDTWLPLTNE    50
    HQINKSVNKS VRILVTMATS PGSKSNKKIV SFDLSKGSYP DHLEDGYHFQ 100
    SKNLSLKILG NRRESEGWYL VSVEENVSVQ QFCKQLKLYE QVSPPEIKVL 150
    NKTQENENGT CSLLLACTVK KGDHVTYSWS DEAGTHLLSR ANRSHLLHIT 200
    LSNQHQDSIY NCTASNPVSS ISRTFNLSSQ ACKQESSSES SPWMQYTLVP 250
    LGVVIIFILV FTAIIMMKRQ GKSNHCQPPV EEKSLTIYAQ VQKSGPQEKK 300
    LHDALTDQDP CTTIYVAATE PAPESVQEPN PTTVYASVTL PES 343
    Length:343
    Mass (Da):38,094
    Last modified:May 1, 2000 - v1
    Checksum:i7980470157E834C4
    GO
    Isoform Short (identifier: Q9QUM4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         296-343: PQEKKLHDAL...VYASVTLPES → VRSMPHLAGVSVIFRTGFLIAALHTTMVLQGLLE

    Show »
    Length:329
    Mass (Da):36,590
    Checksum:i3F43476A7CD3686F
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei296 – 34348PQEKK…TLPES → VRSMPHLAGVSVIFRTGFLI AALHTTMVLQGLLE in isoform Short. 1 PublicationVSP_002570Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF149791 mRNA. Translation: AAF22231.1.
    AF149792 mRNA. Translation: AAF22232.1.
    AF164523
    , AF164519, AF164520, AF164521, AF164522 Genomic DNA. Translation: AAF13818.1.
    AF160990 mRNA. Translation: AAF14535.1.
    CCDSiCCDS15502.1. [Q9QUM4-1]
    RefSeqiNP_038758.2. NM_013730.4. [Q9QUM4-1]
    UniGeneiMm.103648.

    Genome annotation databases

    EnsembliENSMUST00000015460; ENSMUSP00000015460; ENSMUSG00000015316. [Q9QUM4-1]
    GeneIDi27218.
    KEGGimmu:27218.
    UCSCiuc007dpc.1. mouse. [Q9QUM4-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF149791 mRNA. Translation: AAF22231.1 .
    AF149792 mRNA. Translation: AAF22232.1 .
    AF164523
    , AF164519 , AF164520 , AF164521 , AF164522 Genomic DNA. Translation: AAF13818.1 .
    AF160990 mRNA. Translation: AAF14535.1 .
    CCDSi CCDS15502.1. [Q9QUM4-1 ]
    RefSeqi NP_038758.2. NM_013730.4. [Q9QUM4-1 ]
    UniGenei Mm.103648.

    3D structure databases

    ProteinModelPortali Q9QUM4.
    SMRi Q9QUM4. Positions 32-141.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 205139. 2 interactions.
    IntActi Q9QUM4. 3 interactions.
    MINTi MINT-205762.

    PTM databases

    PhosphoSitei Q9QUM4.

    Proteomic databases

    PaxDbi Q9QUM4.
    PRIDEi Q9QUM4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSMUST00000015460 ; ENSMUSP00000015460 ; ENSMUSG00000015316 . [Q9QUM4-1 ]
    GeneIDi 27218.
    KEGGi mmu:27218.
    UCSCi uc007dpc.1. mouse. [Q9QUM4-1 ]

    Organism-specific databases

    CTDi 6504.
    MGIi MGI:1351314. Slamf1.

    Phylogenomic databases

    eggNOGi NOG40451.
    GeneTreei ENSGT00510000048858.
    HOGENOMi HOG000125310.
    HOVERGENi HBG054224.
    InParanoidi Q9QUM4.
    KOi K06536.
    OMAi LYEQVST.
    OrthoDBi EOG7Q8CQJ.
    PhylomeDBi Q9QUM4.
    TreeFami TF334964.

    Miscellaneous databases

    NextBioi 305116.
    PROi Q9QUM4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9QUM4.
    Bgeei Q9QUM4.
    Genevestigatori Q9QUM4.

    Family and domain databases

    Gene3Di 2.60.40.10. 1 hit.
    InterProi IPR007110. Ig-like_dom.
    IPR013783. Ig-like_fold.
    IPR010407. Sig_lymph_act_molc_N.
    IPR015631. SLAM_fam_rcpts.
    [Graphical view ]
    PANTHERi PTHR12080. PTHR12080. 1 hit.
    Pfami PF06214. SLAM. 1 hit.
    [Graphical view ]
    ProDomi PD090491. Sig_lymph_act_molc_N. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    PROSITEi PS50835. IG_LIKE. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular and functional characterization of mouse signaling lymphocytic activation molecule (SLAM): differential expression and responsiveness in Th1 and Th2 cells."
      Castro A.G., Hauser T.M., Cocks B.G., Abrams J., Zurawski S., Churakova T., Zonin F., Robinson D., Tangye S.G., Aversa G., Nichols K.E., de Vries J.E., Lanier L.L., O'Garra A.
      J. Immunol. 163:5860-5870(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
      Strain: BALB/c.
    2. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM LONG).
    3. "Genomic organization of murine Slam."
      Wu C., Wang N., Sayos J., Terhorst C.
      Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
    4. "Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells."
      Morra M., Lu J., Poy F., Martin M., Sayos J., Calpe S., Gullo C., Howie D., Rietdijk S., Thompson A., Coyle A.J., Denny C., Yaffe M.B., Engel P., Eck M.J., Terhorst C.
      EMBO J. 20:5840-5852(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SH2D1B.

    Entry informationi

    Entry nameiSLAF1_MOUSE
    AccessioniPrimary (citable) accession number: Q9QUM4
    Secondary accession number(s): Q9QXZ3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 1, 2000
    Last sequence update: May 1, 2000
    Last modified: October 1, 2014
    This is version 113 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. MGD cross-references
      Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3