SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QUM4

- SLAF1_MOUSE

UniProt

Q9QUM4 - SLAF1_MOUSE

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Signaling lymphocytic activation molecule
Gene
Slamf1, Slam
Organism
Mus musculus (Mouse)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

High-affinity self-ligand important in bidirectional T-cell to B-cell stimulation. SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes of SLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another in which protein-tyrosine phosphatase 2C (PTPN11)-dependent signal transduction operates.

GO - Molecular functioni

  1. protein binding Source: IntAct
  2. receptor activity Source: InterPro

GO - Biological processi

  1. lymphocyte activation Source: InterPro
  2. regulation of catalytic activity Source: MGI
  3. regulation of vesicle fusion Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Names & Taxonomyi

Protein namesi
Recommended name:
Signaling lymphocytic activation molecule
Alternative name(s):
CD_antigen: CD150
Gene namesi
Name:Slamf1
Synonyms:Slam
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeMusMus
ProteomesiUP000000589: Chromosome 1

Organism-specific databases

MGIiMGI:1351314. Slamf1.

Subcellular locationi

Cell membrane; Single-pass type I membrane protein
Note: Present on the surface of B-cells and T-cells.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini25 – 242218Extracellular Reviewed prediction
Add
BLAST
Transmembranei243 – 26523Helical; Reviewed prediction
Add
BLAST
Topological domaini266 – 34378Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. external side of plasma membrane Source: MGI
  2. integral component of membrane Source: UniProtKB-KW
  3. phagocytic vesicle Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2424 Reviewed prediction
Add
BLAST
Chaini25 – 343319Signaling lymphocytic activation molecule
PRO_0000014960Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi54 – 541N-linked (GlcNAc...) Reviewed prediction
Glycosylationi58 – 581N-linked (GlcNAc...) Reviewed prediction
Glycosylationi103 – 1031N-linked (GlcNAc...) Reviewed prediction
Glycosylationi126 – 1261N-linked (GlcNAc...) Reviewed prediction
Glycosylationi151 – 1511N-linked (GlcNAc...) Reviewed prediction
Glycosylationi158 – 1581N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi161 ↔ 232 By similarity
Disulfide bondi167 ↔ 212 By similarity
Glycosylationi192 – 1921N-linked (GlcNAc...) Reviewed prediction
Glycosylationi211 – 2111N-linked (GlcNAc...) Reviewed prediction
Glycosylationi226 – 2261N-linked (GlcNAc...) Reviewed prediction

Post-translational modificationi

Phosphorylated.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9QUM4.
PRIDEiQ9QUM4.

PTM databases

PhosphoSiteiQ9QUM4.

Expressioni

Gene expression databases

ArrayExpressiQ9QUM4.
BgeeiQ9QUM4.
GenevestigatoriQ9QUM4.

Interactioni

Subunit structurei

Interacts with INPP5D/SHIP1 By similarity. Interacts (via cytoplasmic domain) with SH2D1A and SH2D1B. Interacts (upon tyrosine phosphorylation with) PTPN11, but not with SHP-1.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FynP396884EBI-7910086,EBI-524514
Sh2d1aO888902EBI-7910086,EBI-7910438

Protein-protein interaction databases

BioGridi205139. 2 interactions.
IntActiQ9QUM4. 3 interactions.
MINTiMINT-205762.

Structurei

3D structure databases

ProteinModelPortaliQ9QUM4.
SMRiQ9QUM4. Positions 32-141.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini? – 153Ig-like V-type
Domaini145 – 22884Ig-like C2-type
Add
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi286 – 2916SH2-binding Reviewed prediction
Motifi313 – 3186SH2-binding Reviewed prediction
Motifi333 – 3386SH2-binding Reviewed prediction

Domaini

The most membrane-proximal SH2-binding motif interacts with SH2 domain of SH2D1A and does not need to be phosphorylated on tyrosine residues By similarity.

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG40451.
GeneTreeiENSGT00510000048858.
HOGENOMiHOG000125310.
HOVERGENiHBG054224.
InParanoidiQ9QUM4.
KOiK06536.
OMAiLYEQVST.
OrthoDBiEOG7Q8CQJ.
PhylomeDBiQ9QUM4.
TreeFamiTF334964.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR010407. Sig_lymph_act_molc_N.
IPR015631. SLAM_fam_rcpts.
[Graphical view]
PANTHERiPTHR12080. PTHR12080. 1 hit.
PfamiPF06214. SLAM. 1 hit.
[Graphical view]
ProDomiPD090491. Sig_lymph_act_molc_N. 1 hit.
[Graphical view] [Entries sharing at least one domain]
PROSITEiPS50835. IG_LIKE. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform Long (identifier: Q9QUM4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDPKGSLSWR ILLFLSLAFE LSYGTGGGVM DCPVILQKLG QDTWLPLTNE    50
HQINKSVNKS VRILVTMATS PGSKSNKKIV SFDLSKGSYP DHLEDGYHFQ 100
SKNLSLKILG NRRESEGWYL VSVEENVSVQ QFCKQLKLYE QVSPPEIKVL 150
NKTQENENGT CSLLLACTVK KGDHVTYSWS DEAGTHLLSR ANRSHLLHIT 200
LSNQHQDSIY NCTASNPVSS ISRTFNLSSQ ACKQESSSES SPWMQYTLVP 250
LGVVIIFILV FTAIIMMKRQ GKSNHCQPPV EEKSLTIYAQ VQKSGPQEKK 300
LHDALTDQDP CTTIYVAATE PAPESVQEPN PTTVYASVTL PES 343
Length:343
Mass (Da):38,094
Last modified:May 1, 2000 - v1
Checksum:i7980470157E834C4
GO
Isoform Short (identifier: Q9QUM4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-343: PQEKKLHDAL...VYASVTLPES → VRSMPHLAGVSVIFRTGFLIAALHTTMVLQGLLE

Show »
Length:329
Mass (Da):36,590
Checksum:i3F43476A7CD3686F
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei296 – 34348PQEKK…TLPES → VRSMPHLAGVSVIFRTGFLI AALHTTMVLQGLLE in isoform Short.
VSP_002570Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF149791 mRNA. Translation: AAF22231.1.
AF149792 mRNA. Translation: AAF22232.1.
AF164523
, AF164519, AF164520, AF164521, AF164522 Genomic DNA. Translation: AAF13818.1.
AF160990 mRNA. Translation: AAF14535.1.
CCDSiCCDS15502.1. [Q9QUM4-1]
RefSeqiNP_038758.2. NM_013730.4. [Q9QUM4-1]
UniGeneiMm.103648.

Genome annotation databases

EnsembliENSMUST00000015460; ENSMUSP00000015460; ENSMUSG00000015316. [Q9QUM4-1]
GeneIDi27218.
KEGGimmu:27218.
UCSCiuc007dpc.1. mouse. [Q9QUM4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF149791 mRNA. Translation: AAF22231.1 .
AF149792 mRNA. Translation: AAF22232.1 .
AF164523
, AF164519 , AF164520 , AF164521 , AF164522 Genomic DNA. Translation: AAF13818.1 .
AF160990 mRNA. Translation: AAF14535.1 .
CCDSi CCDS15502.1. [Q9QUM4-1 ]
RefSeqi NP_038758.2. NM_013730.4. [Q9QUM4-1 ]
UniGenei Mm.103648.

3D structure databases

ProteinModelPortali Q9QUM4.
SMRi Q9QUM4. Positions 32-141.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 205139. 2 interactions.
IntActi Q9QUM4. 3 interactions.
MINTi MINT-205762.

PTM databases

PhosphoSitei Q9QUM4.

Proteomic databases

PaxDbi Q9QUM4.
PRIDEi Q9QUM4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENSMUST00000015460 ; ENSMUSP00000015460 ; ENSMUSG00000015316 . [Q9QUM4-1 ]
GeneIDi 27218.
KEGGi mmu:27218.
UCSCi uc007dpc.1. mouse. [Q9QUM4-1 ]

Organism-specific databases

CTDi 6504.
MGIi MGI:1351314. Slamf1.

Phylogenomic databases

eggNOGi NOG40451.
GeneTreei ENSGT00510000048858.
HOGENOMi HOG000125310.
HOVERGENi HBG054224.
InParanoidi Q9QUM4.
KOi K06536.
OMAi LYEQVST.
OrthoDBi EOG7Q8CQJ.
PhylomeDBi Q9QUM4.
TreeFami TF334964.

Miscellaneous databases

NextBioi 305116.
PROi Q9QUM4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9QUM4.
Bgeei Q9QUM4.
Genevestigatori Q9QUM4.

Family and domain databases

Gene3Di 2.60.40.10. 1 hit.
InterProi IPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR010407. Sig_lymph_act_molc_N.
IPR015631. SLAM_fam_rcpts.
[Graphical view ]
PANTHERi PTHR12080. PTHR12080. 1 hit.
Pfami PF06214. SLAM. 1 hit.
[Graphical view ]
ProDomi PD090491. Sig_lymph_act_molc_N. 1 hit.
[Graphical view ] [Entries sharing at least one domain ]
PROSITEi PS50835. IG_LIKE. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Molecular and functional characterization of mouse signaling lymphocytic activation molecule (SLAM): differential expression and responsiveness in Th1 and Th2 cells."
    Castro A.G., Hauser T.M., Cocks B.G., Abrams J., Zurawski S., Churakova T., Zonin F., Robinson D., Tangye S.G., Aversa G., Nichols K.E., de Vries J.E., Lanier L.L., O'Garra A.
    J. Immunol. 163:5860-5870(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT).
    Strain: BALB/c.
  2. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM LONG).
  3. "Genomic organization of murine Slam."
    Wu C., Wang N., Sayos J., Terhorst C.
    Submitted (JUN-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM LONG).
  4. "Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells."
    Morra M., Lu J., Poy F., Martin M., Sayos J., Calpe S., Gullo C., Howie D., Rietdijk S., Thompson A., Coyle A.J., Denny C., Yaffe M.B., Engel P., Eck M.J., Terhorst C.
    EMBO J. 20:5840-5852(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SH2D1B.

Entry informationi

Entry nameiSLAF1_MOUSE
AccessioniPrimary (citable) accession number: Q9QUM4
Secondary accession number(s): Q9QXZ3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 1, 2000
Last sequence update: May 1, 2000
Last modified: July 9, 2014
This is version 112 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi