Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9QUH6

- SYGP1_RAT

UniProt

Q9QUH6 - SYGP1_RAT

Protein

Ras/Rap GTPase-activating protein SynGAP

Gene

Syngap1

Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 2 (26 Jun 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Major constituent of the PSD essential for postsynaptic signaling. Inhibitory regulator of the Ras-cAMP pathway. Member of the NMDAR signaling complex in excitatory synapses, it may play a role in NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking and synaptic plasticity. Regulates AMPAR-mediated miniature excitatory postsynaptic currents. Exhibits dual GTPase-activating specificity for Ras and Rap. May be involved in certain forms of brain injury, leading to long-term learning and memory deficits.4 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. protein kinase binding Source: UniProtKB
    3. Ras GTPase activator activity Source: RGD

    GO - Biological processi

    1. negative regulation of Ras protein signal transduction Source: UniProtKB
    2. positive regulation of Ras GTPase activity Source: RefGenome
    3. regulation of synaptic plasticity Source: UniProtKB
    4. signal transduction Source: InterPro

    Keywords - Molecular functioni

    GTPase activation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ras/Rap GTPase-activating protein SynGAP
    Alternative name(s):
    Neuronal RasGAP
    Synaptic Ras GTPase-activating protein 1
    Short name:
    Synaptic Ras-GAP 1
    p135 SynGAP
    Gene namesi
    Name:Syngap1
    OrganismiRattus norvegicus (Rat)
    Taxonomic identifieri10116 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
    ProteomesiUP000002494: Unplaced

    Organism-specific databases

    RGDi621090. Syngap1.

    Subcellular locationi

    Membrane; Peripheral membrane protein. Cell junctionsynapse
    Note: Mostly in excitatory glutamatergic synapses.

    GO - Cellular componenti

    1. cell junction Source: UniProtKB-KW
    2. cytoplasm Source: RefGenome
    3. intrinsic component of the cytoplasmic side of the plasma membrane Source: RefGenome
    4. postsynaptic density Source: RGD

    Keywords - Cellular componenti

    Cell junction, Membrane, Synapse

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi385 – 3851S → A: Affects stimulation by PLK2. 1 Publication
    Mutagenesisi449 – 4491S → A: Affects stimulation by PLK2. 1 Publication
    Mutagenesisi485 – 4851R → K: Decreases RapGAP activity by 100-fold. 1 Publication
    Mutagenesisi485 – 4851R → P: Abolishes RapGAP activity. 1 Publication
    Mutagenesisi487 – 4871N → T: Decreases RapGAP activity by 20-fold. 1 Publication
    Mutagenesisi840 – 8401S → A: Blocks the gel mobility shift induced by PLK2 and affects stimulation by PLK2. 1 Publication
    Mutagenesisi842 – 8421S → A: Blocks the gel mobility shift induced by PLK2. 1 Publication

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 13081308Ras/Rap GTPase-activating protein SynGAPPRO_0000056655Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei34 – 341PhosphotyrosineBy similarity
    Modified residuei39 – 391PhosphotyrosineBy similarity
    Modified residuei379 – 3791Phosphoserine; by PLK22 Publications
    Modified residuei385 – 3851Phosphoserine; by PLK22 Publications
    Modified residuei449 – 4491Phosphoserine; by PLK22 Publications
    Modified residuei466 – 4661Phosphoserine; by PLK22 Publications
    Modified residuei836 – 8361Phosphoserine; by PLK22 Publications
    Modified residuei840 – 8401Phosphoserine; by PLK22 Publications
    Modified residuei842 – 8421Phosphoserine; by PLK22 Publications
    Modified residuei895 – 8951Phosphoserine; by PLK22 Publications
    Modified residuei1204 – 12041PhosphoserineBy similarity

    Post-translational modificationi

    Phosphorylated by CaM-kinase II. Dephosphorylated upon NMDA receptor activation or SYNGAP1/MPDZ complex disruption. Phosphorylation by PLK2 promotes its activity.2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    PaxDbiQ9QUH6.
    PRIDEiQ9QUH6.

    PTM databases

    PhosphoSiteiQ9QUH6.

    Expressioni

    Tissue specificityi

    Highly expressed in brain; predominantly in the cortex, hippocampus and olfactory bulb. Present in the postsynaptic density of central excitatory synapses.1 Publication

    Gene expression databases

    GenevestigatoriQ9QUH6.

    Interactioni

    Subunit structurei

    Isoforms containing the PDZ-binding domain associate with DLG4 and DLG3 to form the PSD protein complex colocalized with GRIN2B at synapses. Interacts with MPDZ, KLHL17 CAMK2A and CAMK2B.3 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    Dlg4P310163EBI-2310349,EBI-375655
    Klhl17Q8K4302EBI-2310349,EBI-7713653
    Pdzk1Q9JJ406EBI-2310349,EBI-7713572

    Protein-protein interaction databases

    IntActiQ9QUH6. 6 interactions.
    MINTiMINT-1778299.

    Structurei

    Secondary structure

    1
    1308
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi257 – 2626
    Beta strandi403 – 4086
    Helixi414 – 4174
    Helixi418 – 4258
    Helixi428 – 43811
    Helixi441 – 45717
    Helixi463 – 47513
    Beta strandi477 – 4815
    Beta strandi486 – 4883
    Helixi489 – 50113
    Helixi503 – 51917
    Turni528 – 5303
    Turni533 – 5353
    Helixi536 – 55520
    Helixi556 – 5605
    Helixi563 – 57816
    Helixi582 – 59312
    Turni594 – 5974
    Helixi598 – 6036
    Turni605 – 6095
    Helixi617 – 63418
    Turni642 – 6454
    Helixi647 – 6493
    Helixi650 – 66617
    Helixi685 – 69915
    Helixi700 – 7023
    Helixi705 – 7106
    Turni711 – 7133
    Helixi714 – 72411

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3BXJX-ray3.00A/B252-734[»]
    ProteinModelPortaliQ9QUH6.
    SMRiQ9QUH6. Positions 401-734.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9QUH6.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini150 – 251102PHPROSITE-ProRule annotationAdd
    BLAST
    Domaini249 – 34799C2Add
    BLAST
    Domaini443 – 635193Ras-GAPPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1197 – 1308112Interaction with MPDZAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi785 – 81531SH3-bindingSequence AnalysisAdd
    BLAST
    Motifi1305 – 13084PDZ-bindingSequence Analysis

    Domaini

    The PDZ-binding domain interacts with all three PDZ domains of DGL4.1 Publication
    The C2 domain is required for RapGAP activity.1 Publication

    Sequence similaritiesi

    Contains 1 C2 domain.Curated
    Contains 1 PH domain.PROSITE-ProRule annotation
    Contains 1 Ras-GAP domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH3-binding

    Phylogenomic databases

    eggNOGiNOG245428.
    HOVERGENiHBG006492.
    InParanoidiQ9QUH6.
    PhylomeDBiQ9QUH6.

    Family and domain databases

    Gene3Di1.10.506.10. 1 hit.
    2.20.170.10. 1 hit.
    2.30.29.30. 2 hits.
    2.60.40.150. 1 hit.
    InterProiIPR000008. C2_dom.
    IPR021887. DUF3498.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001936. RasGAP.
    IPR023152. RasGAP_CS.
    IPR008936. Rho_GTPase_activation_prot.
    IPR023315. SynGAP_C2_N.
    [Graphical view]
    PfamiPF00168. C2. 1 hit.
    PF12004. DUF3498. 1 hit.
    PF00616. RasGAP. 1 hit.
    [Graphical view]
    SMARTiSM00239. C2. 1 hit.
    SM00233. PH. 1 hit.
    SM00323. RasGAP. 1 hit.
    [Graphical view]
    SUPFAMiSSF48350. SSF48350. 1 hit.
    SSF49562. SSF49562. 1 hit.
    PROSITEiPS50003. PH_DOMAIN. 1 hit.
    PS00509. RAS_GTPASE_ACTIV_1. 1 hit.
    PS50018. RAS_GTPASE_ACTIV_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q9QUH6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSRSRASIHR GSIPAMSYAP FRDVRGPPMH RTQYVHSPYD RPGWNPRFCI     50
    ISGNQLLMLD EDEIHPLLIR DRRSESSRNK LLRRTVSVPV EGRPHGEHEY 100
    HLGRSRRKSV PGGKQYSMEA APAAPFRPSQ GFLSRRLKSS IKRTKSQPKL 150
    DRTSSFRQIL PRFRSADHDR ARLMQSFKES HSHESLLSPS SAAEALELNL 200
    DEDSIIKPVH SSILGQEFCF EVTTSSGTKC FACRSAAERD KWIENLQRAV 250
    KPNKDNSRRV DNVLKLWIIE ARELPPKKRY YCELCLDDML YARTTSKPRS 300
    ASGDTVFWGE HFEFNNLPAV RALRLHLYRD SDKKRKKDKA GYVGLVTVPV 350
    ATLAGRHFTE QWYPVTLPTG SGGSGGMGSG GGGGSGGGSG GKGKGGCPAV 400
    RLKARYQTMS ILPMELYKEF AEYVTNHYRM LCAVLEPALN VKGKEEVASA 450
    LVHILQSTGK AKDFLSDMAM SEVDRFMERE HLIFRENTLA TKAIEEYMRL 500
    IGQKYLKDAI GEFIRALYES EENCEVDPIK CTASSLAEHQ ANLRMCCELA 550
    LCKVVNSHCV FPRELKEVFA SWRLRCAERG REDIADRLIS ASLFLRFLCP 600
    AIMSPSLFGL MQEYPDEQTS RTLTLIAKVI QNLANFSKFT SKEDFLGFMN 650
    EFLELEWGSM QQFLYEISNL DTLTNSSSFE GYIDLGRELS TLHALLWEVL 700
    PQLSKEALLK LGPLPRLLSD ISTALRNPNI QRQPSRQSER ARSQPMVLRG 750
    PSAEMQGYMM RDLNSSIDLQ SFMARGLNSS MDMARLPSPT KEKPPPPPPG 800
    GGKDLFYVSR PPLARSSPAY CTSSSDITEP EQKMLSVNKS VSMLDLQGDG 850
    PGGRLNSSSV SNLAAVGDLL HSSQASLTAA LGLRPAPAGR LSQGSGSSIT 900
    AAGMRLSQMG VTTDGVPAQQ LRIPLSFQNP LFHMAADGPG PPAGHGGSSG 950
    HGPPSSHHHH HHHHHHRGGE PPGDTFAPFH GYSKSEDLST GVPKPPAASI 1000
    LHSHSYSDEF GPSGTDFTRR QLSLQDNLQH MLSPPQITIG PQRPAPSGPG 1050
    GGSGGGSGGG GGGQPPPLQR GKSQQLTVSA AQKPRPSSGN LLQSPEPSYG 1100
    PARPRQQSLS KEGSIGGSGG SGGGGGGGLK PSITKQHSQT PSTLNPTMPA 1150
    SERTVAWVSN MPHLSADIES AHIEREEYKL KEYSKSMDES RLDRVKEYEE 1200
    EIHSLKERLH MSNRKLEEYE RRLLSQEEQT SKILMQYQAR LEQSEKRLRQ 1250
    QQVEKDSQIK SIIGRLMLVE EELRRDHPAM AEPLPEPKKR LLDAQRGSFP 1300
    PWVQQTRV 1308
    Length:1,308
    Mass (Da):144,722
    Last modified:June 26, 2007 - v2
    Checksum:iCA2536782C8C4DCB
    GO
    Isoform 2 (identifier: Q9QUH6-2) [UniParc]FASTAAdd to Basket

    Also known as: SynGAP-a

    The sequence of this isoform differs from the canonical sequence as follows:
         1-15: Missing.
         1296-1308: RGSFPPWVQQTRV → LLIR

    Show »
    Length:1,284
    Mass (Da):142,070
    Checksum:iFA9F3DC3D874C0C8
    GO
    Isoform 3 (identifier: Q9QUH6-3) [UniParc]FASTAAdd to Basket

    Also known as: SynGAP-b

    The sequence of this isoform differs from the canonical sequence as follows:
         1-98: MSRSRASIHR...PVEGRPHGEH → MGLRPPTPTP...RRCSSCCFPG

    Show »
    Length:1,249
    Mass (Da):137,359
    Checksum:iDC549FCF1624BD8A
    GO
    Isoform 4 (identifier: Q9QUH6-4) [UniParc]FASTAAdd to Basket

    Also known as: SynGAP-c

    The sequence of this isoform differs from the canonical sequence as follows:
         1-173: Missing.
         1296-1308: RGSFPPWVQQTRV → VERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

    Show »
    Length:1,171
    Mass (Da):128,489
    Checksum:iA4C6BF477EEF6A61
    GO
    Isoform 5 (identifier: Q9QUH6-5) [UniParc]FASTAAdd to Basket

    Also known as: SynGAP-d, SynGAP-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1-121: MSRSRASIHR...GGKQYSMEAA → MEYF
         1195-1196: Missing.
         1265-1308: RLMLVEEELRRDHPAMAEPLPEPKKRLLDAQRGSFPPWVQQTRV → SPSLQADAGGGGAAPGPPRHG

    Show »
    Length:1,166
    Mass (Da):127,745
    Checksum:i5804EE4163AE4950
    GO

    Sequence cautioni

    The sequence AAC08071.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti308 – 3092WG → GY AA sequence (PubMed:9620694)Curated
    Sequence conflicti316 – 3161N → M AA sequence (PubMed:9620694)Curated
    Sequence conflicti427 – 4293HYR → GQK AA sequence (PubMed:9620694)Curated
    Sequence conflicti937 – 9393DGP → ADG AA sequence (PubMed:9620694)Curated
    Sequence conflicti1002 – 10021H → G AA sequence (PubMed:9620694)Curated
    Sequence conflicti1088 – 10881S → Q AA sequence (PubMed:9620694)Curated
    Sequence conflicti1277 – 12771H → L AA sequence (PubMed:9620694)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 173173Missing in isoform 4. 1 PublicationVSP_007976Add
    BLAST
    Alternative sequencei1 – 121121MSRSR…SMEAA → MEYF in isoform 5. 2 PublicationsVSP_007975Add
    BLAST
    Alternative sequencei1 – 9898MSRSR…PHGEH → MGLRPPTPTPSGGSGSGSLP PPSHRQPLRRRCSSCCFPG in isoform 3. 2 PublicationsVSP_007974Add
    BLAST
    Alternative sequencei1 – 1515Missing in isoform 2. 1 PublicationVSP_026378Add
    BLAST
    Alternative sequencei1195 – 11962Missing in isoform 5. 2 PublicationsVSP_007977
    Alternative sequencei1265 – 130844RLMLV…QQTRV → SPSLQADAGGGGAAPGPPRH G in isoform 5. 2 PublicationsVSP_007978Add
    BLAST
    Alternative sequencei1296 – 130813RGSFP…QQTRV → LLIR in isoform 2. 1 PublicationVSP_007979Add
    BLAST
    Alternative sequencei1296 – 130813RGSFP…QQTRV → VERQLPPLGPTNPRVTLAPP WNGLAPPAPPPPPRLQITEN GEFRNTADH in isoform 4. 1 PublicationVSP_007980Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF048976 mRNA. Translation: AAC08071.1. Different initiation.
    AF053938 mRNA. Translation: AAC23491.1.
    AF055883 mRNA. Translation: AAC23492.1.
    AF058789 mRNA. Translation: AAC63510.2.
    AF058790 mRNA. Translation: AAC63511.1.
    AF050183 mRNA. Translation: AAC40082.2.
    AB016962 mRNA. Translation: BAA74972.1.
    PIRiT13958.
    T14259.
    T14270.
    UniGeneiRn.9908.

    Genome annotation databases

    UCSCiRGD:621090. rat. [Q9QUH6-1]

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF048976 mRNA. Translation: AAC08071.1 . Different initiation.
    AF053938 mRNA. Translation: AAC23491.1 .
    AF055883 mRNA. Translation: AAC23492.1 .
    AF058789 mRNA. Translation: AAC63510.2 .
    AF058790 mRNA. Translation: AAC63511.1 .
    AF050183 mRNA. Translation: AAC40082.2 .
    AB016962 mRNA. Translation: BAA74972.1 .
    PIRi T13958.
    T14259.
    T14270.
    UniGenei Rn.9908.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3BXJ X-ray 3.00 A/B 252-734 [» ]
    ProteinModelPortali Q9QUH6.
    SMRi Q9QUH6. Positions 401-734.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q9QUH6. 6 interactions.
    MINTi MINT-1778299.

    Chemistry

    ChEMBLi CHEMBL2176804.

    PTM databases

    PhosphoSitei Q9QUH6.

    Proteomic databases

    PaxDbi Q9QUH6.
    PRIDEi Q9QUH6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    UCSCi RGD:621090. rat. [Q9QUH6-1 ]

    Organism-specific databases

    RGDi 621090. Syngap1.

    Phylogenomic databases

    eggNOGi NOG245428.
    HOVERGENi HBG006492.
    InParanoidi Q9QUH6.
    PhylomeDBi Q9QUH6.

    Miscellaneous databases

    EvolutionaryTracei Q9QUH6.
    PROi Q9QUH6.

    Gene expression databases

    Genevestigatori Q9QUH6.

    Family and domain databases

    Gene3Di 1.10.506.10. 1 hit.
    2.20.170.10. 1 hit.
    2.30.29.30. 2 hits.
    2.60.40.150. 1 hit.
    InterProi IPR000008. C2_dom.
    IPR021887. DUF3498.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR001936. RasGAP.
    IPR023152. RasGAP_CS.
    IPR008936. Rho_GTPase_activation_prot.
    IPR023315. SynGAP_C2_N.
    [Graphical view ]
    Pfami PF00168. C2. 1 hit.
    PF12004. DUF3498. 1 hit.
    PF00616. RasGAP. 1 hit.
    [Graphical view ]
    SMARTi SM00239. C2. 1 hit.
    SM00233. PH. 1 hit.
    SM00323. RasGAP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48350. SSF48350. 1 hit.
    SSF49562. SSF49562. 1 hit.
    PROSITEi PS50003. PH_DOMAIN. 1 hit.
    PS00509. RAS_GTPASE_ACTIV_1. 1 hit.
    PS50018. RAS_GTPASE_ACTIV_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A synaptic Ras-GTPase activating protein (p135 SynGAP) inhibited by CaM kinase II."
      Chen H.-J., Rojas-Soto M., Oguni A., Kennedy M.B.
      Neuron 20:895-904(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 16-276 (ISOFORM 3), NUCLEOTIDE SEQUENCE [MRNA] OF 1264-1290 (ISOFORM 5), PROTEIN SEQUENCE OF 32-47; 242-248; 259-272; 300-321; 325-329; 340-354; 419-429; 588-596; 804-815; 923-940; 968-1002; 1086-1102 AND 1276-1286.
      Strain: Sprague-Dawley.
    2. Erratum
      Oh J.S., Chen H.-J., Rojas-Soto M., Oguni A., Kennedy M.B.
      Neuron 33:151-151(2002)
    3. "SynGAP: a synaptic RasGAP that associates with the PSD-95/SAP90 protein family."
      Kim J.H., Liao D., Lau L.-F., Huganir R.L.
      Neuron 20:683-691(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), INTERACTION WITH DLG3 AND DLG4.
      Tissue: Hippocampus.
    4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
      Strain: Sprague-Dawley.
    5. "SynGAP-MUPP1-CaMKII synaptic complexes regulate p38 MAP kinase activity and NMDA receptor-dependent synaptic AMPA receptor potentiation."
      Krapivinsky G., Medina I., Krapivinsky L., Gapon S., Clapham D.E.
      Neuron 43:563-574(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MPDZ; DLG4; CAMK2A AND CAMK2B, PHOSPHORYLATION, FUNCTION.
    6. "Impaired SynGAP expression and long-term spatial learning and memory in hippocampal CA1 area from rats previously exposed to perinatal hypoxia-induced insults: beneficial effects of A68930."
      Yang S.-N., Huang C.-B., Yang C.-H., Lai M.-C., Chen W.-F., Wang C.-L., Wu C.-L., Huang L.-T.
      Neurosci. Lett. 371:73-78(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    7. "Interactions between CAP70 and actinfilin are important for integrity of actin cytoskeleton structures in neurons."
      Chen Y., Li M.
      Neuropharmacology 49:1026-1041(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KLHL17.
    8. "Relative and absolute quantification of postsynaptic density proteome isolated from rat forebrain and cerebellum."
      Cheng D., Hoogenraad C.C., Rush J., Ramm E., Schlager M.A., Duong D.M., Xu P., Wijayawardana S.R., Hanfelt J., Nakagawa T., Sheng M., Peng J.
      Mol. Cell. Proteomics 5:1158-1170(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    9. "SynGAP regulates synaptic strength and mitogen-activated protein kinases in cultured neurons."
      Rumbaugh G., Adams J.P., Kim J.H., Huganir R.L.
      Proc. Natl. Acad. Sci. U.S.A. 103:4344-4351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    10. "Requirement for Plk2 in orchestrated ras and rap signaling, homeostatic structural plasticity, and memory."
      Lee K.J., Lee Y., Rozeboom A., Lee J.Y., Udagawa N., Hoe H.S., Pak D.T.
      Neuron 69:957-973(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION AT SER-379; SER-385; SER-449; SER-466; SER-836; SER-840; SER-842 AND SER-895, MUTAGENESIS OF SER-385; SER-449; SER-840 AND SER-842.
    11. "The C2 domain of SynGAP is essential for stimulation of the Rap GTPase reaction."
      Pena V., Hothorn M., Eberth A., Kaschau N., Parret A., Gremer L., Bonneau F., Ahmadian M.R., Scheffzek K.
      EMBO Rep. 9:350-355(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 252-734, FUNCTION, DOMAIN C2, MUTAGENESIS OF ARG-485 AND ASN-487.

    Entry informationi

    Entry nameiSYGP1_RAT
    AccessioniPrimary (citable) accession number: Q9QUH6
    Secondary accession number(s): O88449
    , Q9ESK6, Q9ET81, Q9QX02, Q9QX06, Q9QX12
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 15, 2003
    Last sequence update: June 26, 2007
    Last modified: October 1, 2014
    This is version 115 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Caution

    It is uncertain whether Met-1 or Met-16 is the initiator methionine.Curated

    Keywords - Technical termi

    3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3