SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9QUH6

- SYGP1_RAT

UniProt

Q9QUH6 - SYGP1_RAT

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Ras/Rap GTPase-activating protein SynGAP

Gene
Syngap1
Organism
Rattus norvegicus (Rat)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Major constituent of the PSD essential for postsynaptic signaling. Inhibitory regulator of the Ras-cAMP pathway. Member of the NMDAR signaling complex in excitatory synapses, it may play a role in NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking and synaptic plasticity. Regulates AMPAR-mediated miniature excitatory postsynaptic currents. Exhibits dual GTPase-activating specificity for Ras and Rap. May be involved in certain forms of brain injury, leading to long-term learning and memory deficits.4 Publications

GO - Molecular functioni

  1. protein binding Source: UniProtKB
  2. protein kinase binding Source: UniProtKB
  3. Ras GTPase activator activity Source: RGD

GO - Biological processi

  1. negative regulation of Ras protein signal transduction Source: UniProtKB
  2. positive regulation of Ras GTPase activity Source: RefGenome
  3. regulation of synaptic plasticity Source: UniProtKB
  4. signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Names & Taxonomyi

Protein namesi
Recommended name:
Ras/Rap GTPase-activating protein SynGAP
Alternative name(s):
Neuronal RasGAP
Synaptic Ras GTPase-activating protein 1
Short name:
Synaptic Ras-GAP 1
p135 SynGAP
Gene namesi
Name:Syngap1
OrganismiRattus norvegicus (Rat)
Taxonomic identifieri10116 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaSciurognathiMuroideaMuridaeMurinaeRattus
ProteomesiUP000002494: Unplaced

Organism-specific databases

RGDi621090. Syngap1.

Subcellular locationi

Membrane; Peripheral membrane protein. Cell junctionsynapse
Note: Mostly in excitatory glutamatergic synapses.

GO - Cellular componenti

  1. cell junction Source: UniProtKB-KW
  2. cytoplasm Source: RefGenome
  3. intrinsic component of the cytoplasmic side of the plasma membrane Source: RefGenome
  4. postsynaptic density Source: RGD
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Membrane, Synapse

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi385 – 3851S → A: Affects stimulation by PLK2. 1 Publication
Mutagenesisi449 – 4491S → A: Affects stimulation by PLK2. 1 Publication
Mutagenesisi485 – 4851R → K: Decreases RapGAP activity by 100-fold. 1 Publication
Mutagenesisi485 – 4851R → P: Abolishes RapGAP activity. 1 Publication
Mutagenesisi487 – 4871N → T: Decreases RapGAP activity by 20-fold. 1 Publication
Mutagenesisi840 – 8401S → A: Blocks the gel mobility shift induced by PLK2 and affects stimulation by PLK2. 1 Publication
Mutagenesisi842 – 8421S → A: Blocks the gel mobility shift induced by PLK2. 1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13081308Ras/Rap GTPase-activating protein SynGAPPRO_0000056655Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei34 – 341Phosphotyrosine By similarity
Modified residuei39 – 391Phosphotyrosine By similarity
Modified residuei379 – 3791Phosphoserine; by PLK21 Publication
Modified residuei385 – 3851Phosphoserine; by PLK21 Publication
Modified residuei449 – 4491Phosphoserine; by PLK21 Publication
Modified residuei466 – 4661Phosphoserine; by PLK21 Publication
Modified residuei836 – 8361Phosphoserine; by PLK21 Publication
Modified residuei840 – 8401Phosphoserine; by PLK21 Publication
Modified residuei842 – 8421Phosphoserine; by PLK21 Publication
Modified residuei895 – 8951Phosphoserine; by PLK21 Publication
Modified residuei1204 – 12041Phosphoserine By similarity

Post-translational modificationi

Phosphorylated by CaM-kinase II. Dephosphorylated upon NMDA receptor activation or SYNGAP1/MPDZ complex disruption. Phosphorylation by PLK2 promotes its activity.2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9QUH6.
PRIDEiQ9QUH6.

PTM databases

PhosphoSiteiQ9QUH6.

Expressioni

Tissue specificityi

Highly expressed in brain; predominantly in the cortex, hippocampus and olfactory bulb. Present in the postsynaptic density of central excitatory synapses.1 Publication

Gene expression databases

GenevestigatoriQ9QUH6.

Interactioni

Subunit structurei

Isoforms containing the PDZ-binding domain associate with DLG4 and DLG3 to form the PSD protein complex colocalized with GRIN2B at synapses. Interacts with MPDZ, KLHL17 CAMK2A and CAMK2B.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
Dlg4P310163EBI-2310349,EBI-375655
Klhl17Q8K4302EBI-2310349,EBI-7713653
Pdzk1Q9JJ406EBI-2310349,EBI-7713572

Protein-protein interaction databases

IntActiQ9QUH6. 6 interactions.
MINTiMINT-1778299.

Structurei

Secondary structure

1
1308
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi257 – 2626
Beta strandi403 – 4086
Helixi414 – 4174
Helixi418 – 4258
Helixi428 – 43811
Helixi441 – 45717
Helixi463 – 47513
Beta strandi477 – 4815
Beta strandi486 – 4883
Helixi489 – 50113
Helixi503 – 51917
Turni528 – 5303
Turni533 – 5353
Helixi536 – 55520
Helixi556 – 5605
Helixi563 – 57816
Helixi582 – 59312
Turni594 – 5974
Helixi598 – 6036
Turni605 – 6095
Helixi617 – 63418
Turni642 – 6454
Helixi647 – 6493
Helixi650 – 66617
Helixi685 – 69915
Helixi700 – 7023
Helixi705 – 7106
Turni711 – 7133
Helixi714 – 72411

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3BXJX-ray3.00A/B252-734[»]
ProteinModelPortaliQ9QUH6.
SMRiQ9QUH6. Positions 401-734.

Miscellaneous databases

EvolutionaryTraceiQ9QUH6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini150 – 251102PHAdd
BLAST
Domaini249 – 34799C2Add
BLAST
Domaini443 – 635193Ras-GAPAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1197 – 1308112Interaction with MPDZAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi785 – 81531SH3-binding Reviewed predictionAdd
BLAST
Motifi1305 – 13084PDZ-binding Reviewed prediction

Domaini

The PDZ-binding domain interacts with all three PDZ domains of DGL4.1 Publication
The C2 domain is required for RapGAP activity.1 Publication

Sequence similaritiesi

Contains 1 C2 domain.
Contains 1 PH domain.
Contains 1 Ras-GAP domain.

Keywords - Domaini

SH3-binding

Phylogenomic databases

eggNOGiNOG245428.
HOVERGENiHBG006492.
InParanoidiQ9QUH6.
PhylomeDBiQ9QUH6.

Family and domain databases

Gene3Di1.10.506.10. 1 hit.
2.20.170.10. 1 hit.
2.30.29.30. 2 hits.
2.60.40.150. 1 hit.
InterProiIPR000008. C2_dom.
IPR021887. DUF3498.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001936. RasGAP.
IPR023152. RasGAP_CS.
IPR008936. Rho_GTPase_activation_prot.
IPR023315. SynGAP_C2_N.
[Graphical view]
PfamiPF00168. C2. 1 hit.
PF12004. DUF3498. 1 hit.
PF00616. RasGAP. 1 hit.
[Graphical view]
SMARTiSM00239. C2. 1 hit.
SM00233. PH. 1 hit.
SM00323. RasGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF49562. SSF49562. 1 hit.
PROSITEiPS50003. PH_DOMAIN. 1 hit.
PS00509. RAS_GTPASE_ACTIV_1. 1 hit.
PS50018. RAS_GTPASE_ACTIV_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q9QUH6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MSRSRASIHR GSIPAMSYAP FRDVRGPPMH RTQYVHSPYD RPGWNPRFCI     50
ISGNQLLMLD EDEIHPLLIR DRRSESSRNK LLRRTVSVPV EGRPHGEHEY 100
HLGRSRRKSV PGGKQYSMEA APAAPFRPSQ GFLSRRLKSS IKRTKSQPKL 150
DRTSSFRQIL PRFRSADHDR ARLMQSFKES HSHESLLSPS SAAEALELNL 200
DEDSIIKPVH SSILGQEFCF EVTTSSGTKC FACRSAAERD KWIENLQRAV 250
KPNKDNSRRV DNVLKLWIIE ARELPPKKRY YCELCLDDML YARTTSKPRS 300
ASGDTVFWGE HFEFNNLPAV RALRLHLYRD SDKKRKKDKA GYVGLVTVPV 350
ATLAGRHFTE QWYPVTLPTG SGGSGGMGSG GGGGSGGGSG GKGKGGCPAV 400
RLKARYQTMS ILPMELYKEF AEYVTNHYRM LCAVLEPALN VKGKEEVASA 450
LVHILQSTGK AKDFLSDMAM SEVDRFMERE HLIFRENTLA TKAIEEYMRL 500
IGQKYLKDAI GEFIRALYES EENCEVDPIK CTASSLAEHQ ANLRMCCELA 550
LCKVVNSHCV FPRELKEVFA SWRLRCAERG REDIADRLIS ASLFLRFLCP 600
AIMSPSLFGL MQEYPDEQTS RTLTLIAKVI QNLANFSKFT SKEDFLGFMN 650
EFLELEWGSM QQFLYEISNL DTLTNSSSFE GYIDLGRELS TLHALLWEVL 700
PQLSKEALLK LGPLPRLLSD ISTALRNPNI QRQPSRQSER ARSQPMVLRG 750
PSAEMQGYMM RDLNSSIDLQ SFMARGLNSS MDMARLPSPT KEKPPPPPPG 800
GGKDLFYVSR PPLARSSPAY CTSSSDITEP EQKMLSVNKS VSMLDLQGDG 850
PGGRLNSSSV SNLAAVGDLL HSSQASLTAA LGLRPAPAGR LSQGSGSSIT 900
AAGMRLSQMG VTTDGVPAQQ LRIPLSFQNP LFHMAADGPG PPAGHGGSSG 950
HGPPSSHHHH HHHHHHRGGE PPGDTFAPFH GYSKSEDLST GVPKPPAASI 1000
LHSHSYSDEF GPSGTDFTRR QLSLQDNLQH MLSPPQITIG PQRPAPSGPG 1050
GGSGGGSGGG GGGQPPPLQR GKSQQLTVSA AQKPRPSSGN LLQSPEPSYG 1100
PARPRQQSLS KEGSIGGSGG SGGGGGGGLK PSITKQHSQT PSTLNPTMPA 1150
SERTVAWVSN MPHLSADIES AHIEREEYKL KEYSKSMDES RLDRVKEYEE 1200
EIHSLKERLH MSNRKLEEYE RRLLSQEEQT SKILMQYQAR LEQSEKRLRQ 1250
QQVEKDSQIK SIIGRLMLVE EELRRDHPAM AEPLPEPKKR LLDAQRGSFP 1300
PWVQQTRV 1308
Length:1,308
Mass (Da):144,722
Last modified:June 26, 2007 - v2
Checksum:iCA2536782C8C4DCB
GO
Isoform 2 (identifier: Q9QUH6-2) [UniParc]FASTAAdd to Basket

Also known as: SynGAP-a

The sequence of this isoform differs from the canonical sequence as follows:
     1-15: Missing.
     1296-1308: RGSFPPWVQQTRV → LLIR

Show »
Length:1,284
Mass (Da):142,070
Checksum:iFA9F3DC3D874C0C8
GO
Isoform 3 (identifier: Q9QUH6-3) [UniParc]FASTAAdd to Basket

Also known as: SynGAP-b

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: MSRSRASIHR...PVEGRPHGEH → MGLRPPTPTP...RRCSSCCFPG

Show »
Length:1,249
Mass (Da):137,359
Checksum:iDC549FCF1624BD8A
GO
Isoform 4 (identifier: Q9QUH6-4) [UniParc]FASTAAdd to Basket

Also known as: SynGAP-c

The sequence of this isoform differs from the canonical sequence as follows:
     1-173: Missing.
     1296-1308: RGSFPPWVQQTRV → VERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH

Show »
Length:1,171
Mass (Da):128,489
Checksum:iA4C6BF477EEF6A61
GO
Isoform 5 (identifier: Q9QUH6-5) [UniParc]FASTAAdd to Basket

Also known as: SynGAP-d, SynGAP-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-121: MSRSRASIHR...GGKQYSMEAA → MEYF
     1195-1196: Missing.
     1265-1308: RLMLVEEELRRDHPAMAEPLPEPKKRLLDAQRGSFPPWVQQTRV → SPSLQADAGGGGAAPGPPRHG

Show »
Length:1,166
Mass (Da):127,745
Checksum:i5804EE4163AE4950
GO

Sequence cautioni

The sequence AAC08071.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 173173Missing in isoform 4. VSP_007976Add
BLAST
Alternative sequencei1 – 121121MSRSR…SMEAA → MEYF in isoform 5. VSP_007975Add
BLAST
Alternative sequencei1 – 9898MSRSR…PHGEH → MGLRPPTPTPSGGSGSGSLP PPSHRQPLRRRCSSCCFPG in isoform 3. VSP_007974Add
BLAST
Alternative sequencei1 – 1515Missing in isoform 2. VSP_026378Add
BLAST
Alternative sequencei1195 – 11962Missing in isoform 5. VSP_007977
Alternative sequencei1265 – 130844RLMLV…QQTRV → SPSLQADAGGGGAAPGPPRH G in isoform 5. VSP_007978Add
BLAST
Alternative sequencei1296 – 130813RGSFP…QQTRV → LLIR in isoform 2. VSP_007979Add
BLAST
Alternative sequencei1296 – 130813RGSFP…QQTRV → VERQLPPLGPTNPRVTLAPP WNGLAPPAPPPPPRLQITEN GEFRNTADH in isoform 4. VSP_007980Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti308 – 3092WG → GY AA sequence 1 Publication
Sequence conflicti316 – 3161N → M AA sequence 1 Publication
Sequence conflicti427 – 4293HYR → GQK AA sequence 1 Publication
Sequence conflicti937 – 9393DGP → ADG AA sequence 1 Publication
Sequence conflicti1002 – 10021H → G AA sequence 1 Publication
Sequence conflicti1088 – 10881S → Q AA sequence 1 Publication
Sequence conflicti1277 – 12771H → L AA sequence 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF048976 mRNA. Translation: AAC08071.1. Different initiation.
AF053938 mRNA. Translation: AAC23491.1.
AF055883 mRNA. Translation: AAC23492.1.
AF058789 mRNA. Translation: AAC63510.2.
AF058790 mRNA. Translation: AAC63511.1.
AF050183 mRNA. Translation: AAC40082.2.
AB016962 mRNA. Translation: BAA74972.1.
PIRiT13958.
T14259.
T14270.
UniGeneiRn.9908.

Genome annotation databases

UCSCiRGD:621090. rat. [Q9QUH6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF048976 mRNA. Translation: AAC08071.1 . Different initiation.
AF053938 mRNA. Translation: AAC23491.1 .
AF055883 mRNA. Translation: AAC23492.1 .
AF058789 mRNA. Translation: AAC63510.2 .
AF058790 mRNA. Translation: AAC63511.1 .
AF050183 mRNA. Translation: AAC40082.2 .
AB016962 mRNA. Translation: BAA74972.1 .
PIRi T13958.
T14259.
T14270.
UniGenei Rn.9908.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3BXJ X-ray 3.00 A/B 252-734 [» ]
ProteinModelPortali Q9QUH6.
SMRi Q9QUH6. Positions 401-734.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q9QUH6. 6 interactions.
MINTi MINT-1778299.

Chemistry

ChEMBLi CHEMBL2176804.

PTM databases

PhosphoSitei Q9QUH6.

Proteomic databases

PaxDbi Q9QUH6.
PRIDEi Q9QUH6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

UCSCi RGD:621090. rat. [Q9QUH6-1 ]

Organism-specific databases

RGDi 621090. Syngap1.

Phylogenomic databases

eggNOGi NOG245428.
HOVERGENi HBG006492.
InParanoidi Q9QUH6.
PhylomeDBi Q9QUH6.

Miscellaneous databases

EvolutionaryTracei Q9QUH6.
PROi Q9QUH6.

Gene expression databases

Genevestigatori Q9QUH6.

Family and domain databases

Gene3Di 1.10.506.10. 1 hit.
2.20.170.10. 1 hit.
2.30.29.30. 2 hits.
2.60.40.150. 1 hit.
InterProi IPR000008. C2_dom.
IPR021887. DUF3498.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR001936. RasGAP.
IPR023152. RasGAP_CS.
IPR008936. Rho_GTPase_activation_prot.
IPR023315. SynGAP_C2_N.
[Graphical view ]
Pfami PF00168. C2. 1 hit.
PF12004. DUF3498. 1 hit.
PF00616. RasGAP. 1 hit.
[Graphical view ]
SMARTi SM00239. C2. 1 hit.
SM00233. PH. 1 hit.
SM00323. RasGAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
SSF49562. SSF49562. 1 hit.
PROSITEi PS50003. PH_DOMAIN. 1 hit.
PS00509. RAS_GTPASE_ACTIV_1. 1 hit.
PS50018. RAS_GTPASE_ACTIV_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "A synaptic Ras-GTPase activating protein (p135 SynGAP) inhibited by CaM kinase II."
    Chen H.-J., Rojas-Soto M., Oguni A., Kennedy M.B.
    Neuron 20:895-904(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 16-276 (ISOFORM 3), NUCLEOTIDE SEQUENCE [MRNA] OF 1264-1290 (ISOFORM 5), PROTEIN SEQUENCE OF 32-47; 242-248; 259-272; 300-321; 325-329; 340-354; 419-429; 588-596; 804-815; 923-940; 968-1002; 1086-1102 AND 1276-1286.
    Strain: Sprague-Dawley.
  2. Erratum
    Oh J.S., Chen H.-J., Rojas-Soto M., Oguni A., Kennedy M.B.
    Neuron 33:151-151(2002)
  3. "SynGAP: a synaptic RasGAP that associates with the PSD-95/SAP90 protein family."
    Kim J.H., Liao D., Lau L.-F., Huganir R.L.
    Neuron 20:683-691(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), INTERACTION WITH DLG3 AND DLG4.
    Tissue: Hippocampus.
  4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
    Strain: Sprague-Dawley.
  5. "SynGAP-MUPP1-CaMKII synaptic complexes regulate p38 MAP kinase activity and NMDA receptor-dependent synaptic AMPA receptor potentiation."
    Krapivinsky G., Medina I., Krapivinsky L., Gapon S., Clapham D.E.
    Neuron 43:563-574(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MPDZ; DLG4; CAMK2A AND CAMK2B, PHOSPHORYLATION, FUNCTION.
  6. "Impaired SynGAP expression and long-term spatial learning and memory in hippocampal CA1 area from rats previously exposed to perinatal hypoxia-induced insults: beneficial effects of A68930."
    Yang S.-N., Huang C.-B., Yang C.-H., Lai M.-C., Chen W.-F., Wang C.-L., Wu C.-L., Huang L.-T.
    Neurosci. Lett. 371:73-78(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  7. "Interactions between CAP70 and actinfilin are important for integrity of actin cytoskeleton structures in neurons."
    Chen Y., Li M.
    Neuropharmacology 49:1026-1041(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KLHL17.
  8. "Relative and absolute quantification of postsynaptic density proteome isolated from rat forebrain and cerebellum."
    Cheng D., Hoogenraad C.C., Rush J., Ramm E., Schlager M.A., Duong D.M., Xu P., Wijayawardana S.R., Hanfelt J., Nakagawa T., Sheng M., Peng J.
    Mol. Cell. Proteomics 5:1158-1170(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  9. "SynGAP regulates synaptic strength and mitogen-activated protein kinases in cultured neurons."
    Rumbaugh G., Adams J.P., Kim J.H., Huganir R.L.
    Proc. Natl. Acad. Sci. U.S.A. 103:4344-4351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  10. "Requirement for Plk2 in orchestrated ras and rap signaling, homeostatic structural plasticity, and memory."
    Lee K.J., Lee Y., Rozeboom A., Lee J.Y., Udagawa N., Hoe H.S., Pak D.T.
    Neuron 69:957-973(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION AT SER-379; SER-385; SER-449; SER-466; SER-836; SER-840; SER-842 AND SER-895, MUTAGENESIS OF SER-385; SER-449; SER-840 AND SER-842.
  11. "The C2 domain of SynGAP is essential for stimulation of the Rap GTPase reaction."
    Pena V., Hothorn M., Eberth A., Kaschau N., Parret A., Gremer L., Bonneau F., Ahmadian M.R., Scheffzek K.
    EMBO Rep. 9:350-355(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) OF 252-734, FUNCTION, DOMAIN C2, MUTAGENESIS OF ARG-485 AND ASN-487.

Entry informationi

Entry nameiSYGP1_RAT
AccessioniPrimary (citable) accession number: Q9QUH6
Secondary accession number(s): O88449
, Q9ESK6, Q9ET81, Q9QX02, Q9QX06, Q9QX12
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 15, 2003
Last sequence update: June 26, 2007
Last modified: September 3, 2014
This is version 114 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Caution

It is uncertain whether Met-1 or Met-16 is the initiator methionine.

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi