Q9QUH6 (SYGP1_RAT) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ras GTPase-activating protein SynGAP Alternative name(s): Neuronal RasGAP Synaptic Ras GTPase-activating protein 1 Short name=Synaptic Ras-GAP 1 p135 SynGAP | ||
| Gene names |
| ||
| Organism | Rattus norvegicus (Rat) [Reference proteome] | ||
| Taxonomic identifier | 10116 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Rattus![]() |
Protein attributes
| Sequence length | 1308 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Major constituent of the PSD essential for postsynaptic signaling. Inhibitory regulator of the Ras-cAMP pathway. Member of the NMDAR signaling complex in excitatory synapses, it may play a role in NMDAR-dependent control of AMPAR potentiation, AMPAR membrane trafficking and synaptic plasticity. Regulates AMPAR-mediated miniature excitatory postsynaptic currents. May be involved in certain forms of brain injury, leading to long-term learning and memory deficits. Ref.5 Ref.6 Ref.9 |
| Subunit structure | Isoforms containing the PDZ-binding domain associate with DLG4 and DLG3 to form the PSD protein complex colocalized with GRIN2B at synapses. Interacts with MPDZ, KLHL17 CAMK2A and CAMK2B. Ref.3 Ref.5 Ref.7 |
| Subcellular location | Membrane; Peripheral membrane protein. Cell junction › synapse. Note: Mostly in excitatory glutamatergic synapses. |
| Tissue specificity | Highly expressed in brain; predominantly in the cortex, hippocampus and olfactory bulb. Present in the postsynaptic density of central excitatory synapses. Ref.8 |
| Domain | The PDZ-binding domain interacts with all three PDZ domains of DGL4. |
| Post-translational modification | Phosphorylated by CaM-kinase II. Dephosphorylated upon NMDA receptor activation or SYNGAP1/MPDZ complex disruption. Phosphorylation by PLK2 promotes its activity. Ref.5 Ref.10 |
| Sequence similarities | Contains 1 C2 domain. Contains 1 PH domain. Contains 1 Ras-GAP domain. |
| Caution | It is uncertain whether Met-1 or Met-16 is the initiator methionine. |
| Sequence caution | The sequence AAC08071.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. | ||||||
| Isoform 1 (identifier: Q9QUH6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9QUH6-2) Also known as: SynGAP-a; The sequence of this isoform differs from the canonical sequence as follows: 1-15: Missing. 1296-1308: RGSFPPWVQQTRV → LLIR | ||||||
| Isoform 3 (identifier: Q9QUH6-3) Also known as: SynGAP-b; The sequence of this isoform differs from the canonical sequence as follows: 1-98: MSRSRASIHR...PVEGRPHGEH → MGLRPPTPTP...RRCSSCCFPG | ||||||
| Isoform 4 (identifier: Q9QUH6-4) Also known as: SynGAP-c; The sequence of this isoform differs from the canonical sequence as follows: 1-173: Missing. 1296-1308: RGSFPPWVQQTRV → VERQLPPLGPTNPRVTLAPPWNGLAPPAPPPPPRLQITENGEFRNTADH | ||||||
| Isoform 5 (identifier: Q9QUH6-5) Also known as: SynGAP-d; SynGAP-beta; The sequence of this isoform differs from the canonical sequence as follows: 1-121: MSRSRASIHR...GGKQYSMEAA → MEYF 1195-1196: Missing. 1265-1308: RLMLVEEELRRDHPAMAEPLPEPKKRLLDAQRGSFPPWVQQTRV → SPSLQADAGGGGAAPGPPRHG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1308 | 1308 | Ras GTPase-activating protein SynGAP | PRO_0000056655 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 150 – 251 | 102 | PH | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 249 – 347 | 99 | C2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 443 – 635 | 193 | Ras-GAP | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1197 – 1308 | 112 | Interaction with MPDZ | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 785 – 815 | 31 | SH3-binding Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 1305 – 1308 | 4 | PDZ-binding Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 379 | 1 | Phosphoserine; by PLK2 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 385 | 1 | Phosphoserine; by PLK2 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 449 | 1 | Phosphoserine; by PLK2 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 466 | 1 | Phosphoserine; by PLK2 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 836 | 1 | Phosphoserine; by PLK2 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 840 | 1 | Phosphoserine; by PLK2 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 842 | 1 | Phosphoserine; by PLK2 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 895 | 1 | Phosphoserine; by PLK2 Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 173 | 173 | Missing in isoform 4. | VSP_007976 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 121 | 121 | MSRSR…SMEAA → MEYF in isoform 5. | VSP_007975 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 98 | 98 | MSRSR…PHGEH → MGLRPPTPTPSGGSGSGSLP PPSHRQPLRRRCSSCCFPG in isoform 3. | VSP_007974 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 15 | 15 | Missing in isoform 2. | VSP_026378 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1195 – 1196 | 2 | Missing in isoform 5. | VSP_007977 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1265 – 1308 | 44 | RLMLV…QQTRV → SPSLQADAGGGGAAPGPPRH G in isoform 5. | VSP_007978 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1296 – 1308 | 13 | RGSFP…QQTRV → LLIR in isoform 2. | VSP_007979 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1296 – 1308 | 13 | RGSFP…QQTRV → VERQLPPLGPTNPRVTLAPP WNGLAPPAPPPPPRLQITEN GEFRNTADH in isoform 4. | VSP_007980 | |||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 385 | 1 | S → A: Affects stimulation by PLK2. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 449 | 1 | S → A: Affects stimulation by PLK2. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 840 | 1 | S → A: Blocks the gel mobility shift induced by PLK2 and affects stimulation by PLK2. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 842 | 1 | S → A: Blocks the gel mobility shift induced by PLK2. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 308 – 309 | 2 | WG → GY AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 316 | 1 | N → M AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 427 – 429 | 3 | HYR → GQK AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 937 – 939 | 3 | DGP → ADG AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1002 | 1 | H → G AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1088 | 1 | S → Q AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1277 | 1 | H → L AA sequence Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 257 – 262 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 403 – 408 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 414 – 417 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 418 – 425 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 428 – 438 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 441 – 457 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 463 – 475 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 477 – 481 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 486 – 488 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 489 – 501 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 503 – 519 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 528 – 530 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 533 – 535 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 536 – 555 | 20 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 556 – 560 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 563 – 578 | 16 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 582 – 593 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 594 – 597 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 598 – 603 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 605 – 609 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 617 – 634 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 642 – 645 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 647 – 649 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 650 – 666 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 685 – 699 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 700 – 702 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 705 – 710 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 711 – 713 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 714 – 724 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "A synaptic Ras-GTPase activating protein (p135 SynGAP) inhibited by CaM kinase II." Chen H.-J., Rojas-Soto M., Oguni A., Kennedy M.B. Neuron 20:895-904(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [MRNA] OF 16-276 (ISOFORM 3), NUCLEOTIDE SEQUENCE [MRNA] OF 1264-1290 (ISOFORM 5), PROTEIN SEQUENCE OF 32-47; 242-248; 259-272; 300-321; 325-329; 340-354; 419-429; 588-596; 804-815; 923-940; 968-1002; 1086-1102 AND 1276-1286. Strain: Sprague-Dawley. |
| [2] | Erratum Oh J.S., Chen H.-J., Rojas-Soto M., Oguni A., Kennedy M.B. Neuron 33:151-151(2002) |
| [3] | "SynGAP: a synaptic RasGAP that associates with the PSD-95/SAP90 protein family." Kim J.H., Liao D., Lau L.-F., Huganir R.L. Neuron 20:683-691(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), INTERACTION WITH DLG3 AND DLG4. Tissue: Hippocampus. |
| [4] | "Characterization of a novel synGAP isoform, synGAP-beta." Li W., Okano A., Tian Q.B., Nakayama K., Furihata T., Nawa H., Suzuki T. J. Biol. Chem. 276:21417-21424(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5). Strain: Sprague-Dawley. |
| [5] | "SynGAP-MUPP1-CaMKII synaptic complexes regulate p38 MAP kinase activity and NMDA receptor-dependent synaptic AMPA receptor potentiation." Krapivinsky G., Medina I., Krapivinsky L., Gapon S., Clapham D.E. Neuron 43:563-574(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MPDZ; DLG4; CAMK2A AND CAMK2B, PHOSPHORYLATION, FUNCTION. |
| [6] | "Impaired SynGAP expression and long-term spatial learning and memory in hippocampal CA1 area from rats previously exposed to perinatal hypoxia-induced insults: beneficial effects of A68930." Yang S.-N., Huang C.-B., Yang C.-H., Lai M.-C., Chen W.-F., Wang C.-L., Wu C.-L., Huang L.-T. Neurosci. Lett. 371:73-78(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "Interactions between CAP70 and actinfilin are important for integrity of actin cytoskeleton structures in neurons." Chen Y., Li M. Neuropharmacology 49:1026-1041(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KLHL17. |
| [8] | "Relative and absolute quantification of postsynaptic density proteome isolated from rat forebrain and cerebellum." Cheng D., Hoogenraad C.C., Rush J., Ramm E., Schlager M.A., Duong D.M., Xu P., Wijayawardana S.R., Hanfelt J., Nakagawa T., Sheng M., Peng J. Mol. Cell. Proteomics 5:1158-1170(2006) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [9] | "SynGAP regulates synaptic strength and mitogen-activated protein kinases in cultured neurons." Rumbaugh G., Adams J.P., Kim J.H., Huganir R.L. Proc. Natl. Acad. Sci. U.S.A. 103:4344-4351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [10] | "Requirement for Plk2 in orchestrated ras and rap signaling, homeostatic structural plasticity, and memory." Lee K.J., Lee Y., Rozeboom A., Lee J.Y., Udagawa N., Hoe H.S., Pak D.T. Neuron 69:957-973(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION AT SER-379; SER-385; SER-449; SER-466; SER-836; SER-840; SER-842 AND SER-895, MUTAGENESIS OF SER-385; SER-449; SER-840 AND SER-842. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF048976 mRNA. Translation: AAC08071.1. Different initiation. AF053938 mRNA. Translation: AAC23491.1. AF055883 mRNA. Translation: AAC23492.1. AF058789 mRNA. Translation: AAC63510.2. AF058790 mRNA. Translation: AAC63511.1. AF050183 mRNA. Translation: AAC40082.2. AB016962 mRNA. Translation: BAA74972.1. | ||||||||||||
| IPI | IPI00212566. IPI00339023. IPI00339026. IPI00339027. IPI00391507. | ||||||||||||
| PIR | T13958. T14259. T14270. | ||||||||||||
| UniGene | Rn.9908. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9QUH6. | ||||||||||||
| SMR | Q9QUH6. Positions 401-734. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9QUH6. 1 interaction. | ||||||||||||
| MINT | MINT-1778299. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9QUH6. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9QUH6. | ||||||||||||
| PRIDE | Q9QUH6. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| UCSC | RGD:621090. rat. | ||||||||||||
Organism-specific databases | |||||||||||||
| RGD | 621090. Syngap1. | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG245428. | ||||||||||||
| HOVERGEN | HBG006492. | ||||||||||||
| InParanoid | Q9QUH6. | ||||||||||||
| OrthoDB | EOG49ZXNH. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9QUH6. | ||||||||||||
| Genevestigator | Q9QUH6. | ||||||||||||
| GermOnline | ENSRNOG00000000483. Rattus norvegicus. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.506.10. 1 hit. 2.20.170.10. 1 hit. 2.30.29.30. 2 hits. | ||||||||||||
| InterPro | IPR000008. C2_Ca-dep. IPR008973. C2_Ca/lipid-bd_dom_CaLB. IPR021887. DUF3498. IPR011993. PH_like_dom. IPR001849. Pleckstrin_homology. IPR001936. RasGAP. IPR023152. RasGAP_CS. IPR008936. Rho_GTPase_activation_prot. IPR023315. SynGAP_C2_N. [Graphical view] | ||||||||||||
| Pfam | PF00168. C2. 1 hit. PF12004. DUF3498. 1 hit. PF00616. RasGAP. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00239. C2. 1 hit. SM00233. PH. 1 hit. SM00323. RasGAP. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF49562. C2_CaLB. 1 hit. SSF48350. Rho_GAP. 1 hit. | ||||||||||||
| PROSITE | PS50004. C2. False negative. PS50003. PH_DOMAIN. 1 hit. PS00509. RAS_GTPASE_ACTIV_1. 1 hit. PS50018. RAS_GTPASE_ACTIV_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9QUH6. | ||||||||||||
Entry information
| Entry name | SYGP1_RAT | ||||||||
| Accession | Primary (citable) accession number: Q9QUH6 Secondary accession number(s): O88449 Q9QX12 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
