Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9PTJ6 (CTDSL_CHICK) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 67. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
CTD small phosphatase-like protein

Short name=CTDSP-like
EC=3.1.3.16
Alternative name(s):
Nuclear LIM interactor-interacting factor 1
Short name=NLI-interacting factor 1
Small C-terminal domain phosphatase 3
Gene names
Name:NFI1
Synonyms:NIF
OrganismGallus gallus (Chicken) [Reference proteome]
Taxonomic identifier9031 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus

Protein attributes

Sequence length275 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells By similarity.

Catalytic activity

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactor

Binds 1 magnesium ion per monomer By similarity.

Subunit structure

Monomer By similarity. Interacts with LDB1.

Subcellular location

Nucleus By similarity.

Sequence similarities

Contains 1 FCP1 homology domain.

Ontologies

Keywords
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   LigandMagnesium
Metal-binding
   Molecular functionHydrolase
Protein phosphatase
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processdephosphorylation

Inferred from electronic annotation. Source: GOC

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

phosphoprotein phosphatase activity

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]

Note: Additional isoforms seem to exist. A not yet characterized isoform having a longer N-terminus as seen in human and mouse might exist.
Isoform 1 (identifier: Q9PTJ6-1)

Also known as: T1;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9PTJ6-2)

Also known as: T2;

The sequence of this isoform differs from the canonical sequence as follows:
     78-88: Missing.
     275-275: R → SSFKCKLWGGHSCQKCYSRSSCYIGHKGQS
Isoform 3 (identifier: Q9PTJ6-3)

Also known as: T3;

The sequence of this isoform differs from the canonical sequence as follows:
     173-275: YADPVADLLD...YSMLHKLCNR → CVLCLLVCGMQTQ
Isoform 4 (identifier: Q9PTJ6-4)

Also known as: R5;

The sequence of this isoform differs from the canonical sequence as follows:
     78-88: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 275275CTD small phosphatase-like protein
PRO_0000212571

Regions

Domain101 – 259159FCP1 homology

Sites

Active site11114-aspartylphosphate intermediate By similarity
Active site1131Proton donor By similarity
Metal binding1111Magnesium By similarity
Metal binding1131Magnesium; via carbonyl oxygen By similarity
Metal binding2221Magnesium By similarity
Site1671Transition state stabilizer By similarity
Site2051Transition state stabilizer By similarity

Natural variations

Alternative sequence78 – 8811Missing in isoform 2 and isoform 4.
VSP_003564
Alternative sequence173 – 275103YADPV…KLCNR → CVLCLLVCGMQTQ in isoform 3.
VSP_003565
Alternative sequence2751R → SSFKCKLWGGHSCQKCYSRS SCYIGHKGQS in isoform 2.
VSP_003566

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (T1) [UniParc].

Last modified December 13, 2001. Version 2.
Checksum: F68C357769809347

FASTA27531,244
        10         20         30         40         50         60 
MDNPSIITQV TNPKEEEILS CTQDKVSQCN ISLKKQRSRS IFSTLFCCFR DYNVEPPSTN 

        70         80         90        100        110        120 
STSALPPLVE ENGGLQKGDQ MQVMPIPSPP AKYLLPELTA SDYGKKCVVI DLDETLVHSS 

       130        140        150        160        170        180 
FKPISNADFI VPVEIDGTIH QVYVLKRPHV DEFLQRMGEL FECVLFTASL AKYADPVADL 

       190        200        210        220        230        240 
LDRWGVFRAR LFRESCVFHR GNYVKDLSRL GRELSKVIIV DNSPASYIFH PENAVPVQSW 

       250        260        270 
FDDMTDTELL DLIPFFEGLS KEEEVYSMLH KLCNR 

« Hide

Isoform 2 (T2) [UniParc].

Checksum: F698C221C1F19949
Show »

FASTA29333,239
Isoform 3 (T3) [UniParc].

Checksum: B9A7126AD2AD2EA0
Show »

FASTA18520,615
Isoform 4 (R5) [UniParc].

Checksum: 0405951D4CA8ADFC
Show »

FASTA26430,059

References

[1]"NLI/Ldb1/CLIM interacting factor."
Mikhailik A., Dezelee P., Calothy G.
Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
Strain: Brown leghorn.
Tissue: Neuroretina.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF189773 mRNA. Translation: AAF17481.1.
AF189774 mRNA. Translation: AAF17482.1.
AF189775 mRNA. Translation: AAF17483.1.
AF189776 mRNA. Translation: AAF17484.1.
RefSeqNP_001001316.1. NM_001001316.1.
UniGeneGga.4190.

3D structure databases

ProteinModelPortalQ9PTJ6.
SMRQ9PTJ6. Positions 82-263.
ModBaseSearch...
MobiDBSearch...

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENSGALT00000009158; ENSGALP00000009144; ENSGALG00000005710. [Q9PTJ6-1]
GeneID408252.
KEGGgga:408252.

Organism-specific databases

CTD10217.

Phylogenomic databases

eggNOGCOG5190.
GeneTreeENSGT00390000017194.
HOGENOMHOG000236379.
HOVERGENHBG053298.
InParanoidQ9PTJ6.
KOK15731.
OMAHMSIITQ.
OrthoDBEOG71P2C3.
TreeFamTF313556.

Family and domain databases

Gene3D3.40.50.1000. 1 hit.
InterProIPR011948. Dullard_phosphatase.
IPR023214. HAD-like_dom.
IPR004274. NIF.
[Graphical view]
PfamPF03031. NIF. 1 hit.
[Graphical view]
SMARTSM00577. CPDc. 1 hit.
[Graphical view]
SUPFAMSSF56784. SSF56784. 1 hit.
TIGRFAMsTIGR02251. HIF-SF_euk. 1 hit.
PROSITEPS50969. FCP1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

NextBio20818670.
PROQ9PTJ6.

Entry information

Entry nameCTDSL_CHICK
AccessionPrimary (citable) accession number: Q9PTJ6
Secondary accession number(s): Q9PTJ7, Q9PTJ8, Q9PTJ9
Entry history
Integrated into UniProtKB/Swiss-Prot: December 13, 2001
Last sequence update: December 13, 2001
Last modified: March 19, 2014
This is version 67 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Relevant documents

SIMILARITY comments

Index of protein domains and families