Q9PTJ6 (CTDSL_CHICK) Reviewed, UniProtKB/Swiss-Prot
Last modified
March 6, 2013.
Version 61.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: CTD small phosphatase-like protein Short name=CTDSP-like EC=3.1.3.16 Alternative name(s): Nuclear LIM interactor-interacting factor 1 Short name=NLI-interacting factor 1 Small C-terminal domain phosphatase 3 | ||||
| Gene names |
| ||||
| Organism | Gallus gallus (Chicken) [Reference proteome] | ||||
| Taxonomic identifier | 9031 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Archosauria › Dinosauria › Saurischia › Theropoda › Coelurosauria › Aves › Neognathae › Galliformes › Phasianidae › Phasianinae › Gallus![]() |
Protein attributes
| Sequence length | 275 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells By similarity. |
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Cofactor | Binds 1 magnesium ion per monomer By similarity. |
| Subunit structure | Monomer By similarity. Interacts with LDB1. |
| Subcellular location | Nucleus By similarity. |
| Sequence similarities | Contains 1 FCP1 homology domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | Magnesium Metal-binding |
| Molecular function | Hydrolase Protein phosphatase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | dephosphorylation Inferred from electronic annotation. Source: GOC |
| Cellular_component | nucleus Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW phosphoprotein phosphatase activityInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms seem to exist. A not yet characterized isoform having a longer N-terminus as seen in human and mouse might exist. | ||||||
| Isoform 1 (identifier: Q9PTJ6-1) Also known as: T1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9PTJ6-2) Also known as: T2; The sequence of this isoform differs from the canonical sequence as follows: 78-88: Missing. 275-275: R → SSFKCKLWGGHSCQKCYSRSSCYIGHKGQS | ||||||
| Isoform 3 (identifier: Q9PTJ6-3) Also known as: T3; The sequence of this isoform differs from the canonical sequence as follows: 173-275: YADPVADLLD...YSMLHKLCNR → CVLCLLVCGMQTQ | ||||||
| Isoform 4 (identifier: Q9PTJ6-4) Also known as: R5; The sequence of this isoform differs from the canonical sequence as follows: 78-88: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 275 | 275 | CTD small phosphatase-like protein | PRO_0000212571 | |||||
Regions | |||||||||
| Domain | 101 – 259 | 159 | FCP1 homology | ||||||
Sites | |||||||||
| Active site | 111 | 1 | 4-aspartylphosphate intermediate By similarity | ||||||
| Active site | 113 | 1 | Proton donor By similarity | ||||||
| Metal binding | 111 | 1 | Magnesium By similarity | ||||||
| Metal binding | 113 | 1 | Magnesium; via carbonyl oxygen By similarity | ||||||
| Metal binding | 222 | 1 | Magnesium By similarity | ||||||
| Site | 167 | 1 | Transition state stabilizer By similarity | ||||||
| Site | 205 | 1 | Transition state stabilizer By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 78 – 88 | 11 | Missing in isoform 2 and isoform 4. | VSP_003564 | |||||
| Alternative sequence | 173 – 275 | 103 | YADPV…KLCNR → CVLCLLVCGMQTQ in isoform 3. | VSP_003565 | |||||
| Alternative sequence | 275 | 1 | R → SSFKCKLWGGHSCQKCYSRS SCYIGHKGQS in isoform 2. | VSP_003566 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "NLI/Ldb1/CLIM interacting factor." Mikhailik A., Dezelee P., Calothy G. Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4). Strain: Brown leghorn. Tissue: Neuroretina. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF189773 mRNA. Translation: AAF17481.1. AF189774 mRNA. Translation: AAF17482.1. AF189775 mRNA. Translation: AAF17483.1. AF189776 mRNA. Translation: AAF17484.1. |
| IPI | IPI00581375. IPI00585014. IPI00590439. IPI00603791. |
| RefSeq | NP_001001316.1. NM_001001316.1. |
| UniGene | Gga.4190. |
3D structure databases | |
| ProteinModelPortal | Q9PTJ6. |
| SMR | Q9PTJ6. Positions 82-263. |
| ModBase | Search... |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENSGALT00000009158; ENSGALP00000009144; ENSGALG00000005710. |
| GeneID | 408252. |
| KEGG | gga:408252. |
Organism-specific databases | |
| CTD | 10217. |
Phylogenomic databases | |
| eggNOG | COG5190. |
| GeneTree | ENSGT00390000017194. |
| HOGENOM | HOG000236379. |
| HOVERGEN | HBG053298. |
| InParanoid | Q9PTJ6. |
| KO | K15731. |
| OMA | MQVIPIP. |
| OrthoDB | EOG43FGXJ. |
Family and domain databases | |
| Gene3D | 3.40.50.1000. 1 hit. |
| InterPro | IPR011948. Dullard_phosphatase. IPR023214. HAD-like_dom. IPR004274. NIF. [Graphical view] |
| Pfam | PF03031. NIF. 1 hit. [Graphical view] |
| SMART | SM00577. CPDc. 1 hit. [Graphical view] |
| SUPFAM | SSF56784. HAD-like_dom. 1 hit. |
| TIGRFAMs | TIGR02251. HIF-SF_euk. 1 hit. |
| PROSITE | PS50969. FCP1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 20818670. |
Entry information
| Entry name | CTDSL_CHICK | ||||||||
| Accession | Primary (citable) accession number: Q9PTJ6 Secondary accession number(s): Q9PTJ7, Q9PTJ8, Q9PTJ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
Relevant documents
| SIMILARITY comments Index of protein domains and families |

Clusters with
