SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9PTJ6

- CTDSL_CHICK

UniProt

Q9PTJ6 - CTDSL_CHICK

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
CTD small phosphatase-like protein
Gene
NFI1, NIF
Organism
Gallus gallus (Chicken)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

Preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residue repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A. Negatively regulates RNA polymerase II transcription, possibly by controlling the transition from initiation/capping to processive transcript elongation. Recruited by REST to neuronal genes that contain RE-1 elements, leading to neuronal gene silencing in non-neuronal cells By similarity.

Catalytic activityi

[a protein]-serine/threonine phosphate + H2O = [a protein]-serine/threonine + phosphate.

Cofactori

Binds 1 magnesium ion per monomer By similarity.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei111 – 11114-aspartylphosphate intermediate By similarity
Metal bindingi111 – 1111Magnesium By similarity
Active sitei113 – 1131Proton donor By similarity
Metal bindingi113 – 1131Magnesium; via carbonyl oxygen By similarity
Sitei167 – 1671Transition state stabilizer By similarity
Sitei205 – 2051Transition state stabilizer By similarity
Metal bindingi222 – 2221Magnesium By similarity

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. phosphoprotein phosphatase activity Source: UniProtKB-KW
Complete GO annotation...

GO - Biological processi

    Complete GO annotation...

    Keywords - Molecular functioni

    Hydrolase, Protein phosphatase

    Keywords - Ligandi

    Magnesium, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    CTD small phosphatase-like protein (EC:3.1.3.16)
    Short name:
    CTDSP-like
    Alternative name(s):
    Nuclear LIM interactor-interacting factor 1
    Short name:
    NLI-interacting factor 1
    Small C-terminal domain phosphatase 3
    Gene namesi
    Name:NFI1
    Synonyms:NIF
    OrganismiGallus gallus (Chicken)
    Taxonomic identifieri9031 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiTestudines + Archosauria groupArchosauriaDinosauriaSaurischiaTheropodaCoelurosauriaAvesNeognathaeGalliformesPhasianidaePhasianinaeGallus
    ProteomesiUP000000539: Chromosome 2

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell
    Complete GO annotation...

    Keywords - Cellular componenti

    Nucleus

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 275275CTD small phosphatase-like protein
    PRO_0000212571Add
    BLAST

    Interactioni

    Subunit structurei

    Monomer By similarity. Interacts with LDB1.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9PTJ6.
    SMRiQ9PTJ6. Positions 82-263.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini101 – 259159FCP1 homology
    Add
    BLAST

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG5190.
    GeneTreeiENSGT00390000017194.
    HOGENOMiHOG000236379.
    HOVERGENiHBG053298.
    InParanoidiQ9PTJ6.
    KOiK15731.
    OMAiHMSIITQ.
    OrthoDBiEOG71P2C3.
    PhylomeDBiQ9PTJ6.
    TreeFamiTF313556.

    Family and domain databases

    Gene3Di3.40.50.1000. 1 hit.
    InterProiIPR011948. Dullard_phosphatase.
    IPR023214. HAD-like_dom.
    IPR004274. NIF.
    [Graphical view]
    PfamiPF03031. NIF. 1 hit.
    [Graphical view]
    SMARTiSM00577. CPDc. 1 hit.
    [Graphical view]
    SUPFAMiSSF56784. SSF56784. 1 hit.
    TIGRFAMsiTIGR02251. HIF-SF_euk. 1 hit.
    PROSITEiPS50969. FCP1. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist. A not yet characterized isoform having a longer N-terminus as seen in human and mouse might exist.

    Isoform 1 (identifier: Q9PTJ6-1) [UniParc]FASTAAdd to Basket

    Also known as: T1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDNPSIITQV TNPKEEEILS CTQDKVSQCN ISLKKQRSRS IFSTLFCCFR    50
    DYNVEPPSTN STSALPPLVE ENGGLQKGDQ MQVMPIPSPP AKYLLPELTA 100
    SDYGKKCVVI DLDETLVHSS FKPISNADFI VPVEIDGTIH QVYVLKRPHV 150
    DEFLQRMGEL FECVLFTASL AKYADPVADL LDRWGVFRAR LFRESCVFHR 200
    GNYVKDLSRL GRELSKVIIV DNSPASYIFH PENAVPVQSW FDDMTDTELL 250
    DLIPFFEGLS KEEEVYSMLH KLCNR 275
    Length:275
    Mass (Da):31,244
    Last modified:December 13, 2001 - v2
    Checksum:iF68C357769809347
    GO
    Isoform 2 (identifier: Q9PTJ6-2) [UniParc]FASTAAdd to Basket

    Also known as: T2

    The sequence of this isoform differs from the canonical sequence as follows:
         78-88: Missing.
         275-275: R → SSFKCKLWGGHSCQKCYSRSSCYIGHKGQS

    Show »
    Length:293
    Mass (Da):33,239
    Checksum:iF698C221C1F19949
    GO
    Isoform 3 (identifier: Q9PTJ6-3) [UniParc]FASTAAdd to Basket

    Also known as: T3

    The sequence of this isoform differs from the canonical sequence as follows:
         173-275: YADPVADLLD...YSMLHKLCNR → CVLCLLVCGMQTQ

    Show »
    Length:185
    Mass (Da):20,615
    Checksum:iB9A7126AD2AD2EA0
    GO
    Isoform 4 (identifier: Q9PTJ6-4) [UniParc]FASTAAdd to Basket

    Also known as: R5

    The sequence of this isoform differs from the canonical sequence as follows:
         78-88: Missing.

    Show »
    Length:264
    Mass (Da):30,059
    Checksum:i0405951D4CA8ADFC
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei78 – 8811Missing in isoform 2 and isoform 4.
    VSP_003564Add
    BLAST
    Alternative sequencei173 – 275103YADPV…KLCNR → CVLCLLVCGMQTQ in isoform 3.
    VSP_003565Add
    BLAST
    Alternative sequencei275 – 2751R → SSFKCKLWGGHSCQKCYSRS SCYIGHKGQS in isoform 2.
    VSP_003566

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF189773 mRNA. Translation: AAF17481.1.
    AF189774 mRNA. Translation: AAF17482.1.
    AF189775 mRNA. Translation: AAF17483.1.
    AF189776 mRNA. Translation: AAF17484.1.
    RefSeqiNP_001001316.1. NM_001001316.1. [Q9PTJ6-1]
    UniGeneiGga.4190.

    Genome annotation databases

    EnsembliENSGALT00000009158; ENSGALP00000009144; ENSGALG00000005710. [Q9PTJ6-1]
    GeneIDi408252.
    KEGGigga:408252.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF189773 mRNA. Translation: AAF17481.1 .
    AF189774 mRNA. Translation: AAF17482.1 .
    AF189775 mRNA. Translation: AAF17483.1 .
    AF189776 mRNA. Translation: AAF17484.1 .
    RefSeqi NP_001001316.1. NM_001001316.1. [Q9PTJ6-1 ]
    UniGenei Gga.4190.

    3D structure databases

    ProteinModelPortali Q9PTJ6.
    SMRi Q9PTJ6. Positions 82-263.
    ModBasei Search...

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENSGALT00000009158 ; ENSGALP00000009144 ; ENSGALG00000005710 . [Q9PTJ6-1 ]
    GeneIDi 408252.
    KEGGi gga:408252.

    Organism-specific databases

    CTDi 10217.

    Phylogenomic databases

    eggNOGi COG5190.
    GeneTreei ENSGT00390000017194.
    HOGENOMi HOG000236379.
    HOVERGENi HBG053298.
    InParanoidi Q9PTJ6.
    KOi K15731.
    OMAi HMSIITQ.
    OrthoDBi EOG71P2C3.
    PhylomeDBi Q9PTJ6.
    TreeFami TF313556.

    Miscellaneous databases

    NextBioi 20818670.
    PROi Q9PTJ6.

    Family and domain databases

    Gene3Di 3.40.50.1000. 1 hit.
    InterProi IPR011948. Dullard_phosphatase.
    IPR023214. HAD-like_dom.
    IPR004274. NIF.
    [Graphical view ]
    Pfami PF03031. NIF. 1 hit.
    [Graphical view ]
    SMARTi SM00577. CPDc. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56784. SSF56784. 1 hit.
    TIGRFAMsi TIGR02251. HIF-SF_euk. 1 hit.
    PROSITEi PS50969. FCP1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "NLI/Ldb1/CLIM interacting factor."
      Mikhailik A., Dezelee P., Calothy G.
      Submitted (SEP-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4).
      Strain: Brown leghorn.
      Tissue: Neuroretina.

    Entry informationi

    Entry nameiCTDSL_CHICK
    AccessioniPrimary (citable) accession number: Q9PTJ6
    Secondary accession number(s): Q9PTJ7, Q9PTJ8, Q9PTJ9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 13, 2001
    Last sequence update: December 13, 2001
    Last modified: June 11, 2014
    This is version 70 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3

    Similar proteinsi