Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9P2N7 (KLH13_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 111. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Kelch-like protein 13
Alternative name(s):
BTB and kelch domain-containing protein 2
Gene names
Name:KLHL13
Synonyms:BKLHD2, KIAA1309
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length655 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Substrate-specific adapter of a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex required for mitotic progression and cytokinesis. The BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex mediates the ubiquitination of AURKB and controls the dynamic behavior of AURKB on mitotic chromosomes and thereby coordinates faithful mitotic progression and completion of cytokinesis. Ref.7 Ref.8 Ref.9

Pathway

Protein modification; protein ubiquitination.

Subunit structure

Component of the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, at least composed of CUL3, KLHL9, KLHL13 and RBX1. Interacts with AURKB. Ref.7 Ref.8

Sequence similarities

Contains 1 BACK (BTB/Kelch associated) domain.

Contains 1 BTB (POZ) domain.

Contains 6 Kelch repeats.

Sequence caution

The sequence BAA92547.1 differs from that shown. Reason: Erroneous initiation.

The sequence CAC41335.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9P2N7-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9P2N7-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-42: Missing.
Isoform 3 (identifier: Q9P2N7-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MDHLHRGELVAAILRNR
Isoform 4 (identifier: Q9P2N7-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MLRFISHLYCCSSKEDCSEDDKCILSR
Isoform 5 (identifier: Q9P2N7-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MPLKWKTSSPAIWKFPVPVLKTSRSTPLSPAYI → MMRVQTLREKWAYWRRRQLSLKQADFKDIFKKSTSG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 655655Kelch-like protein 13
PRO_0000119115

Regions

Domain92 – 16170BTB
Domain196 – 297102BACK
Repeat341 – 38949Kelch 1
Repeat390 – 44152Kelch 2
Repeat442 – 48847Kelch 3
Repeat490 – 53546Kelch 4
Repeat537 – 58751Kelch 5
Repeat588 – 63649Kelch 6

Natural variations

Alternative sequence1 – 4242Missing in isoform 2.
VSP_037530
Alternative sequence1 – 3333MPLKW…SPAYI → MDHLHRGELVAAILRNR in isoform 3.
VSP_037531
Alternative sequence1 – 3333MPLKW…SPAYI → MLRFISHLYCCSSKEDCSED DKCILSR in isoform 4.
VSP_037532
Alternative sequence1 – 3333MPLKW…SPAYI → MMRVQTLREKWAYWRRRQLS LKQADFKDIFKKSTSG in isoform 5.
VSP_037533
Natural variant2231F → I Found in a renal cell carcinoma sample; somatic mutation. Ref.10
VAR_064725
Natural variant2611T → S. Ref.11
VAR_069423

Experimental info

Sequence conflict141K → R in BAG54189. Ref.3
Sequence conflict201L → P in BAG54189. Ref.3
Sequence conflict3521Q → R in BAG54189. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 16, 2009. Version 3.
Checksum: 0916420562F0B093

FASTA65573,868
        10         20         30         40         50         60 
MPLKWKTSSP AIWKFPVPVL KTSRSTPLSP AYISLVEEED QHMKLSLGGS EMGLSSHLQS 

        70         80         90        100        110        120 
SKAGPTRIFT SNTHSSVVLQ GFDQLRLEGL LCDVTLMPGD TDDAFPVHRV MMASASDYFK 

       130        140        150        160        170        180 
AMFTGGMKEQ DLMCIKLHGV SKVGLRKIID FIYTAKLSLN MDNLQDTLEA ASFLQILPVL 

       190        200        210        220        230        240 
DFCKVFLISG VTLDNCVEVG RIANTYNLTE VDKYVNSFVL KNFPALLSTG EFLKLPFERL 

       250        260        270        280        290        300 
AFVLSSNSLK HCTELELFKA TCRWLRLEEP RMDFAAKLMK NIRFPLMTPQ ELINYVQTVD 

       310        320        330        340        350        360 
FMRTDNTCVN LLLEASNYQM MPYMQPVMQS DRTAIRSDTT HLVTLGGVLR QQLVVSKELR 

       370        380        390        400        410        420 
MYDEKAHEWK SLAPMDAPRY QHGIAVIGNF LYVVGGQSNY DTKGKTAVDT VFRFDPRYNK 

       430        440        450        460        470        480 
WMQVASLNEK RTFFHLSALK GYLYAVGGRN AAGELPTVEC YNPRTNEWTY VAKMSEPHYG 

       490        500        510        520        530        540 
HAGTVYGGVM YISGGITHDT FQKELMCFDP DTDKWIQKAP MTTVRGLHCM CTVGERLYVI 

       550        560        570        580        590        600 
GGNHFRGTSD YDDVLSCEYY SPILDQWTPI AAMLRGQSDV GVAVFENKIY VVGGYSWNNR 

       610        620        630        640        650 
CMVEIVQKYD PDKDEWHKVF DLPESLGGIR ACTLTVFPPE ETTPSPSRES PLSAP 

« Hide

Isoform 2 [UniParc].

Checksum: DBF234A9F50B1556
Show »

FASTA61369,090
Isoform 3 [UniParc].

Checksum: 6EEA9A2DD4455933
Show »

FASTA63972,141
Isoform 4 [UniParc].

Checksum: 78A8F91FDDA79734
Show »

FASTA64973,322
Isoform 5 [UniParc].

Checksum: F0CA2A42E52E6306
Show »

FASTA65874,630

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[2]Howell G.R., Huckle E., Ross M.T.
Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Testis.
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
Tissue: Brain, Testis and Thalamus.
[4]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[7]"Targeting of protein ubiquitination by BTB-Cullin 3-Roc1 ubiquitin ligases."
Furukawa M., He Y.J., Borchers C., Xiong Y.
Nat. Cell Biol. 5:1001-1007(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION AS AN E3 UBIQUITIN-PROTEIN LIGASE, INTERACTION WITH CUL3.
[8]"A Cul3-based E3 ligase removes Aurora B from mitotic chromosomes, regulating mitotic progression and completion of cytokinesis in human cells."
Sumara I., Quadroni M., Frei C., Olma M.H., Sumara G., Ricci R., Peter M.
Dev. Cell 12:887-900(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, INTERACTION WITH AURKB; CUL3 AND KLHL9.
[9]"The Cul3-KLHL21 E3 ubiquitin ligase targets aurora B to midzone microtubules in anaphase and is required for cytokinesis."
Maerki S., Olma M.H., Staubli T., Steigemann P., Gerlich D.W., Quadroni M., Sumara I., Peter M.
J. Cell Biol. 187:791-800(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION.
[10]"Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma."
Varela I., Tarpey P., Raine K., Huang D., Ong C.K., Stephens P., Davies H., Jones D., Lin M.L., Teague J., Bignell G., Butler A., Cho J., Dalgliesh G.L., Galappaththige D., Greenman C., Hardy C., Jia M. expand/collapse author list , Latimer C., Lau K.W., Marshall J., McLaren S., Menzies A., Mudie L., Stebbings L., Largaespada D.A., Wessels L.F.A., Richard S., Kahnoski R.J., Anema J., Tuveson D.A., Perez-Mancera P.A., Mustonen V., Fischer A., Adams D.J., Rust A., Chan-On W., Subimerb C., Dykema K., Furge K., Campbell P.J., Teh B.T., Stratton M.R., Futreal P.A.
Nature 469:539-542(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT ILE-223.
[11]"Diagnostic exome sequencing in persons with severe intellectual disability."
de Ligt J., Willemsen M.H., van Bon B.W., Kleefstra T., Yntema H.G., Kroes T., Vulto-van Silfhout A.T., Koolen D.A., de Vries P., Gilissen C., del Rosario M., Hoischen A., Scheffer H., de Vries B.B., Brunner H.G., Veltman J.A., Vissers L.E.
N. Engl. J. Med. 367:1921-1929(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: VARIANT SER-261.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB037730 mRNA. Translation: BAA92547.1. Different initiation.
AL591986 mRNA. Translation: CAC41335.1. Different initiation.
AK122724 mRNA. Translation: BAG53690.1.
AK125356 mRNA. Translation: BAG54189.1.
AK296324 mRNA. Translation: BAH12315.1.
AK299257 mRNA. Translation: BAH12978.1.
AK302713 mRNA. Translation: BAH13788.1.
AC006968 Genomic DNA. No translation available.
AC006963 Genomic DNA. Translation: AAF03529.1.
CH471161 Genomic DNA. Translation: EAW89898.1.
CH471161 Genomic DNA. Translation: EAW89900.1.
BC064576 mRNA. Translation: AAH64576.2.
RefSeqNP_001161771.1. NM_001168299.1.
NP_001161772.1. NM_001168300.1.
NP_001161773.1. NM_001168301.1.
NP_001161774.1. NM_001168302.1.
NP_001161775.1. NM_001168303.1.
NP_277030.2. NM_033495.3.
UniGeneHs.348262.

3D structure databases

ProteinModelPortalQ9P2N7.
SMRQ9P2N7. Positions 69-634.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124688. 21 interactions.
IntActQ9P2N7. 13 interactions.

PTM databases

PhosphoSiteQ9P2N7.

Polymorphism databases

DMDM239938883.

Proteomic databases

PaxDbQ9P2N7.
PRIDEQ9P2N7.

Protocols and materials databases

DNASU90293.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000262820; ENSP00000262820; ENSG00000003096. [Q9P2N7-1]
ENST00000371876; ENSP00000360943; ENSG00000003096.
ENST00000371878; ENSP00000360945; ENSG00000003096.
ENST00000371882; ENSP00000360949; ENSG00000003096.
ENST00000447671; ENSP00000412640; ENSG00000003096.
ENST00000469946; ENSP00000419803; ENSG00000003096.
ENST00000539496; ENSP00000443191; ENSG00000003096. [Q9P2N7-5]
ENST00000540167; ENSP00000441029; ENSG00000003096. [Q9P2N7-3]
ENST00000541812; ENSP00000444450; ENSG00000003096. [Q9P2N7-3]
ENST00000545703; ENSP00000440707; ENSG00000003096. [Q9P2N7-2]
GeneID90293.
KEGGhsa:90293.
UCSCuc004eqk.3. human. [Q9P2N7-1]
uc011mto.2. human. [Q9P2N7-4]
uc011mtp.2. human. [Q9P2N7-5]
uc011mtq.2. human. [Q9P2N7-3]

Organism-specific databases

CTD90293.
GeneCardsGC0XM117031.
H-InvDBHIX0056474.
HGNCHGNC:22931. KLHL13.
HPAHPA046039.
MIM300655. gene.
neXtProtNX_Q9P2N7.
PharmGKBPA134959204.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG293088.
HOVERGENHBG106526.
InParanoidQ9P2N7.
KOK10447.
OMAGATRIFT.
OrthoDBEOG7VTDMJ.
PhylomeDBQ9P2N7.
TreeFamTF328485.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.
UniPathwayUPA00143.

Gene expression databases

ArrayExpressQ9P2N7.
BgeeQ9P2N7.
CleanExHS_KLHL13.
GenevestigatorQ9P2N7.

Family and domain databases

Gene3D2.130.10.80. 1 hit.
3.30.710.10. 1 hit.
InterProIPR011705. BACK.
IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR015916. Gal_Oxidase_b-propeller.
IPR017096. Kelch-like_gigaxonin-typ.
IPR006652. Kelch_1.
[Graphical view]
PfamPF07707. BACK. 1 hit.
PF00651. BTB. 1 hit.
PF01344. Kelch_1. 5 hits.
[Graphical view]
PIRSFPIRSF037037. Kelch-like_protein_gigaxonin. 1 hit.
SMARTSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMSSF54695. SSF54695. 1 hit.
PROSITEPS50097. BTB. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSKLHL13. human.
GenomeRNAi90293.
NextBio76640.
PROQ9P2N7.
SOURCESearch...

Entry information

Entry nameKLH13_HUMAN
AccessionPrimary (citable) accession number: Q9P2N7
Secondary accession number(s): B3KV78 expand/collapse secondary AC list , B3KWM7, B7Z3S9, B7Z5P2, B7Z802, D3DWH6, Q6P2E3, Q96QI7, Q9UDN9
Entry history
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: June 16, 2009
Last modified: April 16, 2014
This is version 111 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM