Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

REST corepressor 3

Gene

RCOR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May act as a component of a corepressor complex that represses transcription.Curated

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
REST corepressor 3
Gene namesi
Name:RCOR3
Synonyms:KIAA1343
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:25594. RCOR3.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134917623.

Polymorphism and mutation databases

BioMutaiRCOR3.
DMDMi90103520.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 495495REST corepressor 3PRO_0000226781Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei156 – 1561PhosphoserineCombined sources
Modified residuei171 – 1711PhosphoserineCombined sources
Modified residuei376 – 3761PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9P2K3.
MaxQBiQ9P2K3.
PaxDbiQ9P2K3.
PeptideAtlasiQ9P2K3.
PRIDEiQ9P2K3.

PTM databases

iPTMnetiQ9P2K3.
PhosphoSiteiQ9P2K3.

Expressioni

Gene expression databases

BgeeiENSG00000117625.
CleanExiHS_RCOR3.
ExpressionAtlasiQ9P2K3. baseline and differential.
GenevisibleiQ9P2K3. HS.

Organism-specific databases

HPAiHPA007413.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CCDC102BA1A4H13EBI-743428,EBI-10171570
CDR2Q018503EBI-743428,EBI-1181367
CEP55D3DR373EBI-743428,EBI-10173536
GOLGA2Q083793EBI-743428,EBI-618309
GSE1Q146876EBI-743428,EBI-372619
IKZF3Q9UKT94EBI-743428,EBI-747204
KRT15P190125EBI-743428,EBI-739566
KRT31Q153233EBI-743428,EBI-948001
KRT40Q6A1623EBI-743428,EBI-10171697
LCA5Q86VQ03EBI-743428,EBI-6658186
LUZP4Q9P1273EBI-743428,EBI-10198848
LZTS2Q9BRK43EBI-743428,EBI-741037
MAGEA6P433603EBI-743428,EBI-1045155
MID2Q9UJV3-23EBI-743428,EBI-10172526
MIPOL1Q8TD103EBI-743428,EBI-2548751
NECAB2H3BTW23EBI-743428,EBI-10172876
NINLQ9Y2I64EBI-743428,EBI-719716
PRDM14Q9GZV83EBI-743428,EBI-3957793
TFIP11Q9UBB93EBI-743428,EBI-1105213
TRAF2Q129334EBI-743428,EBI-355744
TRIM27P143733EBI-743428,EBI-719493
TRIM42A1L4B63EBI-743428,EBI-10172216
TRIM54Q9BYV23EBI-743428,EBI-2130429
TSGA10Q9BZW73EBI-743428,EBI-744794
TXLNAP402223EBI-743428,EBI-359793

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120876. 57 interactions.
IntActiQ9P2K3. 38 interactions.
MINTiMINT-1447820.
STRINGi9606.ENSP00000413929.

Structurei

Secondary structure

1
495
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi225 – 2328Combined sources
Beta strandi233 – 2364Combined sources
Helixi237 – 26933Combined sources
Turni270 – 2723Combined sources
Helixi275 – 2773Combined sources
Helixi292 – 30514Combined sources
Helixi309 – 3168Combined sources
Helixi322 – 33110Combined sources
Turni332 – 3365Combined sources
Helixi337 – 3459Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4CZZX-ray3.00B1-495[»]
ProteinModelPortaliQ9P2K3.
SMRiQ9P2K3. Positions 1-133, 215-347.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 8383ELM2PROSITE-ProRule annotationAdd
BLAST
Domaini84 – 13552SANT 1PROSITE-ProRule annotationAdd
BLAST
Domaini285 – 33652SANT 2PROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili237 – 27337Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi385 – 48197Pro-richAdd
BLAST

Sequence similaritiesi

Belongs to the CoREST family.Curated
Contains 1 ELM2 domain.PROSITE-ProRule annotation
Contains 2 SANT domains.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG1194. Eukaryota.
ENOG410XSIS. LUCA.
GeneTreeiENSGT00840000129748.
HOVERGENiHBG079800.
InParanoidiQ9P2K3.
OMAiANRNNQG.
OrthoDBiEOG091G096Y.
PhylomeDBiQ9P2K3.
TreeFamiTF106450.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR000949. ELM2_dom.
IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
[Graphical view]
PfamiPF01448. ELM2. 1 hit.
PF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM01189. ELM2. 1 hit.
SM00717. SANT. 2 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 2 hits.
PROSITEiPS51156. ELM2. 1 hit.
PS51293. SANT. 2 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P2K3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRVGAEYQAR IPEFDPGATK YTDKDNGGML VWSPYHSIPD AKLDEYIAIA
60 70 80 90 100
KEKHGYNVEQ ALGMLFWHKH NIEKSLADLP NFTPFPDEWT VEDKVLFEQA
110 120 130 140 150
FSFHGKSFHR IQQMLPDKTI ASLVKYYYSW KKTRSRTSLM DRQARKLANR
160 170 180 190 200
HNQGDSDDDV EETHPMDGND SDYDPKKEAK KEGNTEQPVQ TSKIGLGRRE
210 220 230 240 250
YQSLQHRHHS QRSKCRPPKG MYLTQEDVVA VSCSPNAANT ILRQLDMELI
260 270 280 290 300
SLKRQVQNAK QVNSALKQKM EGGIEEFKPP ESNQKINARW TTEEQLLAVQ
310 320 330 340 350
GVRKYGKDFQ AIADVIGNKT VGQVKNFFVN YRRRFNLEEV LQEWEAEQGT
360 370 380 390 400
QASNGDASTL GEETKSASNV PSGKSTDEEE EAQTPQAPRT LGPSPPAPSS
410 420 430 440 450
TPTPTAPIAT LNQPPPLLRP TLPAAPALHR QPPPLQQQAR FIQPRPTLNQ
460 470 480 490
PPPPLIRPAN SMPPRLNPRP VLSTVGGQQP PSLIGIQTDS QSSLH
Length:495
Mass (Da):55,581
Last modified:March 7, 2006 - v2
Checksum:i2673C9DDD3C176E4
GO
Isoform 2 (identifier: Q9P2K3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM
     302-378: VRKYGKDFQA...NVPSGKSTDE → TDPTGSSDTG...SASTTSYSPC
     379-495: Missing.

Note: No experimental confirmation available.
Show »
Length:436
Mass (Da):47,760
Checksum:i8EC674C01C49B30E
GO
Isoform 3 (identifier: Q9P2K3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM

Note: No experimental confirmation available.
Show »
Length:553
Mass (Da):61,214
Checksum:i9856B52333905254
GO
Isoform 4 (identifier: Q9P2K3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM
     382-391: AQTPQAPRTL → VCLCMEFELI
     392-495: Missing.

Note: No experimental confirmation available.
Show »
Length:449
Mass (Da):50,377
Checksum:i18C1B0E2688DD81A
GO

Sequence cautioni

The sequence BAA92581 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti42 – 421K → R.1 Publication
Corresponds to variant rs17856928 [ dbSNP | Ensembl ].
VAR_025517

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MPGMMEKGPELLGKNRSANG SAKSPAGGGGSGASSTNGGL HYSEPESGCSSDDEHDVGM in isoform 2, isoform 3 and isoform 4. 2 PublicationsVSP_017460
Alternative sequencei302 – 37877VRKYG…KSTDE → TDPTGSSDTGSITSCPIIHS NTNSPYCHSEPASTTSSSNT ACCPGSSPAASSTPAAGSVH PAPANFKSASTTSYSPC in isoform 2. 1 PublicationVSP_017461Add
BLAST
Alternative sequencei379 – 495117Missing in isoform 2. 1 PublicationVSP_017462Add
BLAST
Alternative sequencei382 – 39110AQTPQAPRTL → VCLCMEFELI in isoform 4. 1 PublicationVSP_041465
Alternative sequencei392 – 495104Missing in isoform 4. 1 PublicationVSP_041466Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037764 mRNA. Translation: BAA92581.1. Different initiation.
AK131312 mRNA. Translation: BAG54764.1.
AK302664 mRNA. Translation: BAG63899.1.
AK001738 mRNA. Translation: BAA91872.1.
AL590101, AL611964 Genomic DNA. Translation: CAH72432.1.
AL590101, AL611964 Genomic DNA. Translation: CAH72433.1.
AL611964, AL590101 Genomic DNA. Translation: CAH73871.1.
AL611964, AL590101 Genomic DNA. Translation: CAH73872.1.
BC031608 mRNA. Translation: AAH31608.1.
CCDSiCCDS31016.1. [Q9P2K3-1]
CCDS44312.1. [Q9P2K3-3]
CCDS44313.1. [Q9P2K3-2]
CCDS44314.1. [Q9P2K3-4]
RefSeqiNP_001129695.1. NM_001136223.1. [Q9P2K3-3]
NP_001129696.2. NM_001136224.2. [Q9P2K3-2]
NP_001129697.1. NM_001136225.1. [Q9P2K3-4]
NP_060724.1. NM_018254.3. [Q9P2K3-1]
UniGeneiHs.356399.
Hs.716709.

Genome annotation databases

EnsembliENST00000367005; ENSP00000355972; ENSG00000117625. [Q9P2K3-1]
ENST00000367006; ENSP00000355973; ENSG00000117625. [Q9P2K3-2]
ENST00000419091; ENSP00000413929; ENSG00000117625. [Q9P2K3-3]
ENST00000452621; ENSP00000398558; ENSG00000117625. [Q9P2K3-4]
GeneIDi55758.
KEGGihsa:55758.
UCSCiuc001hie.4. human. [Q9P2K3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037764 mRNA. Translation: BAA92581.1. Different initiation.
AK131312 mRNA. Translation: BAG54764.1.
AK302664 mRNA. Translation: BAG63899.1.
AK001738 mRNA. Translation: BAA91872.1.
AL590101, AL611964 Genomic DNA. Translation: CAH72432.1.
AL590101, AL611964 Genomic DNA. Translation: CAH72433.1.
AL611964, AL590101 Genomic DNA. Translation: CAH73871.1.
AL611964, AL590101 Genomic DNA. Translation: CAH73872.1.
BC031608 mRNA. Translation: AAH31608.1.
CCDSiCCDS31016.1. [Q9P2K3-1]
CCDS44312.1. [Q9P2K3-3]
CCDS44313.1. [Q9P2K3-2]
CCDS44314.1. [Q9P2K3-4]
RefSeqiNP_001129695.1. NM_001136223.1. [Q9P2K3-3]
NP_001129696.2. NM_001136224.2. [Q9P2K3-2]
NP_001129697.1. NM_001136225.1. [Q9P2K3-4]
NP_060724.1. NM_018254.3. [Q9P2K3-1]
UniGeneiHs.356399.
Hs.716709.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4CZZX-ray3.00B1-495[»]
ProteinModelPortaliQ9P2K3.
SMRiQ9P2K3. Positions 1-133, 215-347.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120876. 57 interactions.
IntActiQ9P2K3. 38 interactions.
MINTiMINT-1447820.
STRINGi9606.ENSP00000413929.

PTM databases

iPTMnetiQ9P2K3.
PhosphoSiteiQ9P2K3.

Polymorphism and mutation databases

BioMutaiRCOR3.
DMDMi90103520.

Proteomic databases

EPDiQ9P2K3.
MaxQBiQ9P2K3.
PaxDbiQ9P2K3.
PeptideAtlasiQ9P2K3.
PRIDEiQ9P2K3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000367005; ENSP00000355972; ENSG00000117625. [Q9P2K3-1]
ENST00000367006; ENSP00000355973; ENSG00000117625. [Q9P2K3-2]
ENST00000419091; ENSP00000413929; ENSG00000117625. [Q9P2K3-3]
ENST00000452621; ENSP00000398558; ENSG00000117625. [Q9P2K3-4]
GeneIDi55758.
KEGGihsa:55758.
UCSCiuc001hie.4. human. [Q9P2K3-1]

Organism-specific databases

CTDi55758.
GeneCardsiRCOR3.
HGNCiHGNC:25594. RCOR3.
HPAiHPA007413.
neXtProtiNX_Q9P2K3.
PharmGKBiPA134917623.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1194. Eukaryota.
ENOG410XSIS. LUCA.
GeneTreeiENSGT00840000129748.
HOVERGENiHBG079800.
InParanoidiQ9P2K3.
OMAiANRNNQG.
OrthoDBiEOG091G096Y.
PhylomeDBiQ9P2K3.
TreeFamiTF106450.

Miscellaneous databases

ChiTaRSiRCOR3. human.
GenomeRNAii55758.
PROiQ9P2K3.

Gene expression databases

BgeeiENSG00000117625.
CleanExiHS_RCOR3.
ExpressionAtlasiQ9P2K3. baseline and differential.
GenevisibleiQ9P2K3. HS.

Family and domain databases

Gene3Di1.10.10.60. 1 hit.
InterProiIPR000949. ELM2_dom.
IPR009057. Homeodomain-like.
IPR001005. SANT/Myb.
IPR017884. SANT_dom.
[Graphical view]
PfamiPF01448. ELM2. 1 hit.
PF00249. Myb_DNA-binding. 2 hits.
[Graphical view]
SMARTiSM01189. ELM2. 1 hit.
SM00717. SANT. 2 hits.
[Graphical view]
SUPFAMiSSF46689. SSF46689. 2 hits.
PROSITEiPS51156. ELM2. 1 hit.
PS51293. SANT. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRCOR3_HUMAN
AccessioniPrimary (citable) accession number: Q9P2K3
Secondary accession number(s): B3KYA2
, B4DYY7, Q5VT47, Q7L9I5, Q8N5U3, Q9NV83
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 7, 2006
Last modified: September 7, 2016
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.