Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

REST corepressor 3

Gene

RCOR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May act as a component of a corepressor complex that represses transcription.Curated

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRepressor
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
REST corepressor 3
Gene namesi
Name:RCOR3
Synonyms:KIAA1343
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000117625.13
HGNCiHGNC:25594 RCOR3
neXtProtiNX_Q9P2K3

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi55758
OpenTargetsiENSG00000117625
PharmGKBiPA134917623

Polymorphism and mutation databases

BioMutaiRCOR3
DMDMi90103520

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002267811 – 495REST corepressor 3Add BLAST495

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki20Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei156PhosphoserineCombined sources1
Modified residuei171PhosphoserineCombined sources1
Cross-linki193Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki285Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei376PhosphothreonineCombined sources1
Modified residuei445Asymmetric dimethylarginineCombined sources1
Modified residuei457Asymmetric dimethylarginineCombined sources1

Keywords - PTMi

Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9P2K3
MaxQBiQ9P2K3
PaxDbiQ9P2K3
PeptideAtlasiQ9P2K3
PRIDEiQ9P2K3

PTM databases

iPTMnetiQ9P2K3
PhosphoSitePlusiQ9P2K3

Expressioni

Gene expression databases

BgeeiENSG00000117625
CleanExiHS_RCOR3
ExpressionAtlasiQ9P2K3 baseline and differential
GenevisibleiQ9P2K3 HS

Organism-specific databases

HPAiHPA007413

Interactioni

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi120876, 64 interactors
CORUMiQ9P2K3
IntActiQ9P2K3, 74 interactors
MINTiQ9P2K3
STRINGi9606.ENSP00000413929

Structurei

Secondary structure

1495
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi225 – 232Combined sources8
Beta strandi233 – 236Combined sources4
Helixi237 – 269Combined sources33
Turni270 – 272Combined sources3
Helixi275 – 277Combined sources3
Helixi292 – 305Combined sources14
Helixi309 – 316Combined sources8
Helixi322 – 331Combined sources10
Turni332 – 336Combined sources5
Helixi337 – 345Combined sources9

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4CZZX-ray3.00B1-495[»]
ProteinModelPortaliQ9P2K3
SMRiQ9P2K3
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 83ELM2PROSITE-ProRule annotationAdd BLAST83
Domaini84 – 135SANT 1PROSITE-ProRule annotationAdd BLAST52
Domaini285 – 336SANT 2PROSITE-ProRule annotationAdd BLAST52

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili237 – 273Sequence analysisAdd BLAST37

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi385 – 481Pro-richAdd BLAST97

Sequence similaritiesi

Belongs to the CoREST family.Curated

Keywords - Domaini

Coiled coil, Repeat

Phylogenomic databases

eggNOGiKOG1194 Eukaryota
ENOG410XSIS LUCA
GeneTreeiENSGT00840000129748
HOVERGENiHBG079800
InParanoidiQ9P2K3
OMAiANRNNQG
OrthoDBiEOG091G096Y
PhylomeDBiQ9P2K3
TreeFamiTF106450

Family and domain databases

CDDicd00167 SANT, 1 hit
InterProiView protein in InterPro
IPR000949 ELM2_dom
IPR009057 Homeobox-like_sf
IPR001005 SANT/Myb
IPR017884 SANT_dom
PfamiView protein in Pfam
PF01448 ELM2, 1 hit
PF00249 Myb_DNA-binding, 2 hits
SMARTiView protein in SMART
SM01189 ELM2, 1 hit
SM00717 SANT, 2 hits
SUPFAMiSSF46689 SSF46689, 2 hits
PROSITEiView protein in PROSITE
PS51156 ELM2, 1 hit
PS51293 SANT, 2 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P2K3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRVGAEYQAR IPEFDPGATK YTDKDNGGML VWSPYHSIPD AKLDEYIAIA
60 70 80 90 100
KEKHGYNVEQ ALGMLFWHKH NIEKSLADLP NFTPFPDEWT VEDKVLFEQA
110 120 130 140 150
FSFHGKSFHR IQQMLPDKTI ASLVKYYYSW KKTRSRTSLM DRQARKLANR
160 170 180 190 200
HNQGDSDDDV EETHPMDGND SDYDPKKEAK KEGNTEQPVQ TSKIGLGRRE
210 220 230 240 250
YQSLQHRHHS QRSKCRPPKG MYLTQEDVVA VSCSPNAANT ILRQLDMELI
260 270 280 290 300
SLKRQVQNAK QVNSALKQKM EGGIEEFKPP ESNQKINARW TTEEQLLAVQ
310 320 330 340 350
GVRKYGKDFQ AIADVIGNKT VGQVKNFFVN YRRRFNLEEV LQEWEAEQGT
360 370 380 390 400
QASNGDASTL GEETKSASNV PSGKSTDEEE EAQTPQAPRT LGPSPPAPSS
410 420 430 440 450
TPTPTAPIAT LNQPPPLLRP TLPAAPALHR QPPPLQQQAR FIQPRPTLNQ
460 470 480 490
PPPPLIRPAN SMPPRLNPRP VLSTVGGQQP PSLIGIQTDS QSSLH
Length:495
Mass (Da):55,581
Last modified:March 7, 2006 - v2
Checksum:i2673C9DDD3C176E4
GO
Isoform 2 (identifier: Q9P2K3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM
     302-378: VRKYGKDFQA...NVPSGKSTDE → TDPTGSSDTG...SASTTSYSPC
     379-495: Missing.

Note: No experimental confirmation available.
Show »
Length:436
Mass (Da):47,760
Checksum:i8EC674C01C49B30E
GO
Isoform 3 (identifier: Q9P2K3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM

Note: No experimental confirmation available.
Show »
Length:553
Mass (Da):61,214
Checksum:i9856B52333905254
GO
Isoform 4 (identifier: Q9P2K3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPGMMEKGPELLGKNRSANGSAKSPAGGGGSGASSTNGGLHYSEPESGCSSDDEHDVGM
     382-391: AQTPQAPRTL → VCLCMEFELI
     392-495: Missing.

Note: No experimental confirmation available.
Show »
Length:449
Mass (Da):50,377
Checksum:i18C1B0E2688DD81A
GO

Sequence cautioni

The sequence BAA92581 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02551742K → R1 PublicationCorresponds to variant dbSNP:rs17856928Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0174601M → MPGMMEKGPELLGKNRSANG SAKSPAGGGGSGASSTNGGL HYSEPESGCSSDDEHDVGM in isoform 2, isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_017461302 – 378VRKYG…KSTDE → TDPTGSSDTGSITSCPIIHS NTNSPYCHSEPASTTSSSNT ACCPGSSPAASSTPAAGSVH PAPANFKSASTTSYSPC in isoform 2. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_017462379 – 495Missing in isoform 2. 1 PublicationAdd BLAST117
Alternative sequenceiVSP_041465382 – 391AQTPQAPRTL → VCLCMEFELI in isoform 4. 1 Publication10
Alternative sequenceiVSP_041466392 – 495Missing in isoform 4. 1 PublicationAdd BLAST104

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037764 mRNA Translation: BAA92581.1 Different initiation.
AK131312 mRNA Translation: BAG54764.1
AK302664 mRNA Translation: BAG63899.1
AK001738 mRNA Translation: BAA91872.1
AL590101 Genomic DNA No translation available.
AL611964 Genomic DNA No translation available.
BC031608 mRNA Translation: AAH31608.1
CCDSiCCDS31016.1 [Q9P2K3-1]
CCDS44312.1 [Q9P2K3-3]
CCDS44313.1 [Q9P2K3-2]
CCDS44314.1 [Q9P2K3-4]
RefSeqiNP_001129695.1, NM_001136223.1 [Q9P2K3-3]
NP_001129696.2, NM_001136224.2 [Q9P2K3-2]
NP_001129697.1, NM_001136225.1 [Q9P2K3-4]
NP_060724.1, NM_018254.3 [Q9P2K3-1]
UniGeneiHs.356399
Hs.716709

Genome annotation databases

EnsembliENST00000367005; ENSP00000355972; ENSG00000117625 [Q9P2K3-1]
ENST00000367006; ENSP00000355973; ENSG00000117625 [Q9P2K3-2]
ENST00000419091; ENSP00000413929; ENSG00000117625 [Q9P2K3-3]
ENST00000452621; ENSP00000398558; ENSG00000117625 [Q9P2K3-4]
GeneIDi55758
KEGGihsa:55758
UCSCiuc001hie.4 human [Q9P2K3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiRCOR3_HUMAN
AccessioniPrimary (citable) accession number: Q9P2K3
Secondary accession number(s): B3KYA2
, B4DYY7, Q5VT47, Q7L9I5, Q8N5U3, Q9NV83
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 7, 2006
Last modified: May 23, 2018
This is version 145 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health