Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kelch-like protein 14

Gene

KLHL14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:G66-31560-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Kelch-like protein 14
Alternative name(s):
Protein interactor of Torsin-1A
Short name:
Printor
Short name:
Protein interactor of torsinA
Gene namesi
Name:KLHL14
Synonyms:KIAA1384
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:29266. KLHL14.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi57565.
OpenTargetsiENSG00000197705.
PharmGKBiPA134945930.

Polymorphism and mutation databases

BioMutaiKLHL14.
DMDMi81175180.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001191171 – 628Kelch-like protein 14Add BLAST628

Proteomic databases

MaxQBiQ9P2G3.
PaxDbiQ9P2G3.
PeptideAtlasiQ9P2G3.
PRIDEiQ9P2G3.

PTM databases

iPTMnetiQ9P2G3.
PhosphoSitePlusiQ9P2G3.

Expressioni

Gene expression databases

BgeeiENSG00000197705.
CleanExiHS_KLHL14.
ExpressionAtlasiQ9P2G3. baseline and differential.
GenevisibleiQ9P2G3. HS.

Organism-specific databases

HPAiHPA024777.

Interactioni

Subunit structurei

Interacts with TOR1A, preferentially with the ATP-free form.1 Publication

Protein-protein interaction databases

BioGridi121619. 9 interactors.
IntActiQ9P2G3. 1 interactor.
STRINGi9606.ENSP00000352314.

Structurei

3D structure databases

ProteinModelPortaliQ9P2G3.
SMRiQ9P2G3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini33 – 151BTBPROSITE-ProRule annotationAdd BLAST119
Domaini210 – 279BACKAdd BLAST70
Repeati323 – 372Kelch 1Add BLAST50
Repeati373 – 424Kelch 2Add BLAST52
Repeati425 – 471Kelch 3Add BLAST47
Repeati473 – 518Kelch 4Add BLAST46
Repeati520 – 570Kelch 5Add BLAST51
Repeati572 – 620Kelch 6Add BLAST49

Sequence similaritiesi

Contains 1 BTB (POZ) domain.PROSITE-ProRule annotation
Contains 6 Kelch repeats.Curated

Keywords - Domaini

Kelch repeat, Repeat

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000118825.
HOGENOMiHOG000231583.
HOVERGENiHBG102469.
InParanoidiQ9P2G3.
KOiK10451.
OMAiDFMRSDP.
OrthoDBiEOG091G03FP.
PhylomeDBiQ9P2G3.
TreeFamiTF328485.

Family and domain databases

Gene3Di2.120.10.80. 1 hit.
InterProiIPR011705. BACK.
IPR000210. BTB/POZ_dom.
IPR015915. Kelch-typ_b-propeller.
IPR006652. Kelch_1.
IPR030584. KLHL14.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PANTHERiPTHR24412:SF60. PTHR24412:SF60. 2 hits.
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 2 hits.
PF01344. Kelch_1. 4 hits.
[Graphical view]
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 2 hits.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P2G3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRSGDRTST FDPSHSDNLL HGLNLLWRKQ LFCDVTLTAQ GQQFHCHKAV
60 70 80 90 100
LASCSQYFRS LFSSHPPLGG GVGGQDGLGA PKDQQQPPQQ QPSQQQQPPP
110 120 130 140 150
QEEPGTPSSS PDDKLLTSPR AINNLVLQGC SSIGLRLVLE YLYTANVTLS
160 170 180 190 200
LDTVEEVLSV SKILHIPQVT KLCVQFLNDQ ISVQNYKQVC KIAALHGLEE
210 220 230 240 250
TKKLANKYLV EDVLLLNFEE MRALLDSLPP PVESELALFQ MSVLWLEHDR
260 270 280 290 300
ETRMQYAPDL MKRLRFALIP APELVERVQS VDFMRTDPVC QKLLLDAMNY
310 320 330 340 350
HLMPFRQHCR QSLASRIRSN KKMLLLVGGL PPGPDRLPSN LVQYYDDEKK
360 370 380 390 400
TWKILTIMPY NSAHHCVVEV ENFLFVLGGE DQWNPNGKHS TNFVSRYDPR
410 420 430 440 450
FNSWIQLPPM QERRASFYAC RLDKHLYVIG GRNETGYLSS VECYNLETNE
460 470 480 490 500
WRYVSSLPQP LAAHAGAVHN GKIYISGGVH NGEYVPWLYC YDPVMDVWAR
510 520 530 540 550
KQDMNTKRAI HTLAVMNDRL YAIGGNHLKG FSHLDVMLVE CYDPKGDQWN
560 570 580 590 600
ILQTPILEGR SGPGCAVLDD SIYLVGGYSW SMGAYKSSTI CYCPEKGTWT
610 620
ELEGDVAEPL AGPACVTVIL PSCVPYNK
Length:628
Mass (Da):70,714
Last modified:November 8, 2005 - v2
Checksum:iCF642DAA16F8A718
GO
Isoform 2 (identifier: Q9P2G3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-388: MPYNSAHHCVVEVENFLFVLGGEDQWNPNGK → TGPHPISGKQESASSPEFRRRKTREFSNNTM
     389-628: Missing.

Note: No experimental confirmation available.
Show »
Length:388
Mass (Da):43,792
Checksum:i60A7411D7360FDA7
GO

Sequence cautioni

The sequence BAA92622 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAG58061 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041342358 – 388MPYNS…NPNGK → TGPHPISGKQESASSPEFRR RKTREFSNNTM in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_041343389 – 628Missing in isoform 2. 1 PublicationAdd BLAST240

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037805 mRNA. Translation: BAA92622.1. Different initiation.
AC025887 Genomic DNA. No translation available.
CH471088 Genomic DNA. Translation: EAX01296.1.
CH471088 Genomic DNA. Translation: EAX01295.1.
BC021267 mRNA. Translation: AAH21267.1.
AK294996 mRNA. Translation: BAG58061.1. Different initiation.
CCDSiCCDS32813.1. [Q9P2G3-1]
RefSeqiNP_065856.1. NM_020805.2. [Q9P2G3-1]
UniGeneiHs.446164.

Genome annotation databases

EnsembliENST00000358095; ENSP00000350808; ENSG00000197705. [Q9P2G3-2]
ENST00000359358; ENSP00000352314; ENSG00000197705. [Q9P2G3-1]
GeneIDi57565.
KEGGihsa:57565.
UCSCiuc002kxm.2. human. [Q9P2G3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB037805 mRNA. Translation: BAA92622.1. Different initiation.
AC025887 Genomic DNA. No translation available.
CH471088 Genomic DNA. Translation: EAX01296.1.
CH471088 Genomic DNA. Translation: EAX01295.1.
BC021267 mRNA. Translation: AAH21267.1.
AK294996 mRNA. Translation: BAG58061.1. Different initiation.
CCDSiCCDS32813.1. [Q9P2G3-1]
RefSeqiNP_065856.1. NM_020805.2. [Q9P2G3-1]
UniGeneiHs.446164.

3D structure databases

ProteinModelPortaliQ9P2G3.
SMRiQ9P2G3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121619. 9 interactors.
IntActiQ9P2G3. 1 interactor.
STRINGi9606.ENSP00000352314.

PTM databases

iPTMnetiQ9P2G3.
PhosphoSitePlusiQ9P2G3.

Polymorphism and mutation databases

BioMutaiKLHL14.
DMDMi81175180.

Proteomic databases

MaxQBiQ9P2G3.
PaxDbiQ9P2G3.
PeptideAtlasiQ9P2G3.
PRIDEiQ9P2G3.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358095; ENSP00000350808; ENSG00000197705. [Q9P2G3-2]
ENST00000359358; ENSP00000352314; ENSG00000197705. [Q9P2G3-1]
GeneIDi57565.
KEGGihsa:57565.
UCSCiuc002kxm.2. human. [Q9P2G3-1]

Organism-specific databases

CTDi57565.
DisGeNETi57565.
GeneCardsiKLHL14.
HGNCiHGNC:29266. KLHL14.
HPAiHPA024777.
MIMi613772. gene.
neXtProtiNX_Q9P2G3.
OpenTargetsiENSG00000197705.
PharmGKBiPA134945930.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4441. Eukaryota.
ENOG410XNX8. LUCA.
GeneTreeiENSGT00760000118825.
HOGENOMiHOG000231583.
HOVERGENiHBG102469.
InParanoidiQ9P2G3.
KOiK10451.
OMAiDFMRSDP.
OrthoDBiEOG091G03FP.
PhylomeDBiQ9P2G3.
TreeFamiTF328485.

Enzyme and pathway databases

BioCyciZFISH:G66-31560-MONOMER.

Miscellaneous databases

GenomeRNAii57565.
PROiQ9P2G3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000197705.
CleanExiHS_KLHL14.
ExpressionAtlasiQ9P2G3. baseline and differential.
GenevisibleiQ9P2G3. HS.

Family and domain databases

Gene3Di2.120.10.80. 1 hit.
InterProiIPR011705. BACK.
IPR000210. BTB/POZ_dom.
IPR015915. Kelch-typ_b-propeller.
IPR006652. Kelch_1.
IPR030584. KLHL14.
IPR011333. SKP1/BTB/POZ.
[Graphical view]
PANTHERiPTHR24412:SF60. PTHR24412:SF60. 2 hits.
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 2 hits.
PF01344. Kelch_1. 4 hits.
[Graphical view]
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 1 hit.
SM00612. Kelch. 6 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 2 hits.
PROSITEiPS50097. BTB. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKLH14_HUMAN
AccessioniPrimary (citable) accession number: Q9P2G3
Secondary accession number(s): A6NNW1, B4DHA0, Q8WU41
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 1, 2001
Last sequence update: November 8, 2005
Last modified: November 2, 2016
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.