SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P2F6

- RHG20_HUMAN

UniProt

Q9P2F6 - RHG20_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Rho GTPase-activating protein 20
Gene
ARHGAP20, KIAA1391
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state By similarity.

GO - Molecular functioni

  1. GTPase activator activity Source: UniProtKB-KW
Complete GO annotation...

GO - Biological processi

  1. regulation of small GTPase mediated signal transduction Source: Reactome
  2. small GTPase mediated signal transduction Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

GTPase activation

Enzyme and pathway databases

ReactomeiREACT_11051. Rho GTPase cycle.

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 20
Alternative name(s):
Rho-type GTPase-activating protein 20
Gene namesi
Synonyms:KIAA1391
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:18357. ARHGAP20.

Subcellular locationi

GO - Cellular componenti

  1. cytosol Source: Reactome
Complete GO annotation...

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving ARHGAP20 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL). Translocation t(X;11)(q21;q23) with BRWD3 does not result in fusion transcripts but disrupts both genes.

Keywords - Diseasei

Tumor suppressor

Organism-specific databases

PharmGKBiPA134963885.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11911191Rho GTPase-activating protein 20
PRO_0000283086Add
BLAST

Proteomic databases

PaxDbiQ9P2F6.
PRIDEiQ9P2F6.

PTM databases

PhosphoSiteiQ9P2F6.

Expressioni

Tissue specificityi

Expressed predominantly in the brain. Lower expression is found in lymph nodes.1 Publication

Developmental stagei

Low expression is found in fetal liver.1 Publication

Gene expression databases

BgeeiQ9P2F6.
CleanExiHS_ARHGAP20.
GenevestigatoriQ9P2F6.

Organism-specific databases

HPAiHPA038458.

Interactioni

Protein-protein interaction databases

BioGridi121622. 2 interactions.
IntActiQ9P2F6. 1 interaction.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi367 – 3704
Helixi372 – 3743
Helixi378 – 39013
Helixi391 – 3933
Turni395 – 3995
Helixi404 – 41512
Helixi427 – 43913
Turni442 – 4476
Helixi448 – 4503
Helixi451 – 4566
Helixi457 – 4593
Beta strandi460 – 4623
Helixi463 – 47412
Helixi479 – 49618
Helixi499 – 5024
Helixi506 – 51712
Helixi526 – 55025

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3MSXX-ray1.65B351-551[»]
ProteinModelPortaliQ9P2F6.
SMRiQ9P2F6. Positions 360-551.

Miscellaneous databases

EvolutionaryTraceiQ9P2F6.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini78 – 180103PH
Add
BLAST
Domaini194 – 295102Ras-associating
Add
BLAST
Domaini365 – 551187Rho-GAP
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi934 – 97340Ser-rich
Add
BLAST

Sequence similaritiesi

Contains 1 PH domain.
Contains 1 Rho-GAP domain.

Phylogenomic databases

eggNOGiNOG271519.
HOVERGENiHBG061748.
InParanoidiQ9P2F6.
OMAiINQSLVM.
OrthoDBiEOG7NCV2Q.
PhylomeDBiQ9P2F6.
TreeFamiTF331062.

Family and domain databases

Gene3Di1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProiIPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR000159. Ras-assoc.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view]
PfamiPF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view]
SUPFAMiSSF48350. SSF48350. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEiPS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P2F6-1) [UniParc]FASTAAdd to Basket

Also known as: 1ad

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEAMSPQQET LGGQPGRSSS LTGVSRLAGG SCTKKKMKTL AERRRSAPSL     50
ILDKALQKRP TTRDSPSASV DTCTFLSSLV CSNRTLLIDG RAELKRGLQR 100
QERHLFLFND LFVVAKIKYN NNFKIKNKIK LTDMWTASCV DEVGEGNTNA 150
MKSFVLGWPT VNFVATFSSP EQKDKWLSLL QRYINLEKEK DYPKSIPLKI 200
FAKDIGNCAY SKTITVMNSD TANEVINMSL PMLGITGSER DYQLWVNSGK 250
EEAPYPLIGH EYPYGIKMSH LRDSALLTPG SKDSTTPFNL QEPFLMEQLP 300
REMQCQFILK PSRLAAAQQL SDSGHKTFKR RRSIINWAFW RGSSTHLDNL 350
PSSPTSPMPG QLFGISLPNI CENDNLPKPV LDMLFFLNQK GPLTKGIFRQ 400
SANVKSCREL KEKLNSGVEV HLDCESIFVI ASVLKDFLRN IPGSIFSSDL 450
YDHWVSVMDQ GNDEEKINTV QRLLDQLPRA NVVLLRYLFG VLHNIEQHSS 500
SNQMTAFNLA VCVAPSILWP PASSSPELEN EFTKKVSLLI QFLIENCLRI 550
FGEEITSLFR EVSVRCDTRE NASDISCFQL NDSSYDSLEN ELNEDVDAPC 600
SDLVKKLGQG SRSMDSVLTL SDYDLDQPEV EGLLTLSDFD LAHSKDEDVQ 650
MKRPLESKPV NILVYTKIPL RDHARAPSAM CTPSYLSTAA ANAAKSLRRH 700
RRCSEPSIDY LDSKLSYLRE FYQKKLRKSS CDAILSQKDE DYLKQNQPLQ 750
EEGKTCFKQS LVTGTDVSKK NATTQNTKKK SLSGSEGNHV KLFPKSKPVA 800
ISVASYSPMS SQDHSKNQPF DVNTSGYSPP HTADALKGPR THRRCSEPNI 850
EDQNRKLTYL RGIYSKKQHK TSCEAGLLHG EEDYLKRHKS LQMEGQKLIN 900
QSLVMGIEVG KSSATNQNTE KVLPPRLNLC PRTSYSSLSS PGTSPSGSSV 950
SSQDSAFSQI SEHSVFTPTE TSSPIDCTFQ AQRKREDLSP DFSNASHVSG 1000
MPGPSSGQAC SRPAYTKKDT MEWHSQMHSV TLHPSTWLRN GVASLKNWSL 1050
KKKAKAARPE EEKIASPKGP LEPPPHASGV PEANSLQEEQ KDLPLRAAEG 1100
LSPVQSAQRC SSSPFQDSER HCSSPFSLVE SRLKLCMKSH EEIEPGSQSS 1150
SGSLPWERAS ASSWTLEDAT SPDSGPTVVC DIEDRYLTKD I 1191
Length:1,191
Mass (Da):132,608
Last modified:April 3, 2007 - v2
Checksum:i1837B9DF0655AF41
GO
Isoform 2 (identifier: Q9P2F6-2) [UniParc]FASTAAdd to Basket

Also known as: 1be

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCTK → MTFWIIIN

Show »
Length:1,165
Mass (Da):130,235
Checksum:iDFAA6B800B24583C
GO
Isoform 3 (identifier: Q9P2F6-3) [UniParc]FASTAAdd to Basket

Also known as: 1c

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCT → MSARERQPAL

Show »
Length:1,168
Mass (Da):130,485
Checksum:i4A148F7B05DA3586
GO
Isoform 4 (identifier: Q9P2F6-4) [UniParc]FASTAAdd to Basket

Also known as: 1e, 1d

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: Missing.

Show »
Length:1,155
Mass (Da):128,960
Checksum:iEA4FF49422FE282E
GO

Sequence cautioni

The sequence AAH39340.1 differs from that shown. Reason: Probable cloning artifact.
The sequence BAF84979.1 differs from that shown. Reason: Probable cloning artifact.
The sequence AAH39340.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAA92629.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAF84979.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti522 – 5221A → T.
Corresponds to variant rs7936020 [ dbSNP | Ensembl ].
VAR_031489
Natural varianti632 – 6321G → D.1 Publication
Corresponds to variant rs17853925 [ dbSNP | Ensembl ].
VAR_031490

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636Missing in isoform 4.
VSP_024296Add
BLAST
Alternative sequencei1 – 3434MEAMS…GSCTK → MTFWIIIN in isoform 2.
VSP_024294Add
BLAST
Alternative sequencei1 – 3333MEAMS…GGSCT → MSARERQPAL in isoform 3.
VSP_024295Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY496263 mRNA. Translation: AAS45466.1.
AY496264 mRNA. Translation: AAS45467.1.
AY496265 mRNA. Translation: AAS45468.1.
AY496266 mRNA. Translation: AAS45469.1.
AY496267 mRNA. Translation: AAS45470.1.
AB037812 mRNA. Translation: BAA92629.1. Different initiation.
EF444953 Genomic DNA. Translation: ACA05945.1.
EF444953 Genomic DNA. Translation: ACA05946.1.
CH471065 Genomic DNA. Translation: EAW67134.1.
AK292290 mRNA. Translation: BAF84979.1. Sequence problems.
BC039340 mRNA. Translation: AAH39340.1. Sequence problems.
CCDSiCCDS31673.1. [Q9P2F6-1]
CCDS58175.1. [Q9P2F6-4]
CCDS58176.1. [Q9P2F6-2]
CCDS58177.1. [Q9P2F6-3]
PIRiC59436.
RefSeqiNP_001245344.1. NM_001258415.1. [Q9P2F6-3]
NP_001245345.1. NM_001258416.1. [Q9P2F6-2]
NP_001245346.1. NM_001258417.1. [Q9P2F6-4]
NP_001245347.1. NM_001258418.1. [Q9P2F6-4]
NP_065860.2. NM_020809.3. [Q9P2F6-1]
XP_006718956.1. XM_006718893.1. [Q9P2F6-1]
UniGeneiHs.6136.

Genome annotation databases

EnsembliENST00000260283; ENSP00000260283; ENSG00000137727. [Q9P2F6-1]
ENST00000357139; ENSP00000349660; ENSG00000137727. [Q9P2F6-2]
ENST00000524756; ENSP00000432076; ENSG00000137727. [Q9P2F6-3]
ENST00000527598; ENSP00000431399; ENSG00000137727. [Q9P2F6-4]
ENST00000528829; ENSP00000436319; ENSG00000137727. [Q9P2F6-4]
ENST00000529591; ENSP00000437905; ENSG00000137727.
ENST00000533353; ENSP00000436522; ENSG00000137727. [Q9P2F6-2]
GeneIDi57569.
KEGGihsa:57569.
UCSCiuc001pky.2. human. [Q9P2F6-3]
uc001pkz.2. human. [Q9P2F6-1]
uc001pla.2. human. [Q9P2F6-2]

Polymorphism databases

DMDMi143458429.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY496263 mRNA. Translation: AAS45466.1 .
AY496264 mRNA. Translation: AAS45467.1 .
AY496265 mRNA. Translation: AAS45468.1 .
AY496266 mRNA. Translation: AAS45469.1 .
AY496267 mRNA. Translation: AAS45470.1 .
AB037812 mRNA. Translation: BAA92629.1 . Different initiation.
EF444953 Genomic DNA. Translation: ACA05945.1 .
EF444953 Genomic DNA. Translation: ACA05946.1 .
CH471065 Genomic DNA. Translation: EAW67134.1 .
AK292290 mRNA. Translation: BAF84979.1 . Sequence problems.
BC039340 mRNA. Translation: AAH39340.1 . Sequence problems.
CCDSi CCDS31673.1. [Q9P2F6-1 ]
CCDS58175.1. [Q9P2F6-4 ]
CCDS58176.1. [Q9P2F6-2 ]
CCDS58177.1. [Q9P2F6-3 ]
PIRi C59436.
RefSeqi NP_001245344.1. NM_001258415.1. [Q9P2F6-3 ]
NP_001245345.1. NM_001258416.1. [Q9P2F6-2 ]
NP_001245346.1. NM_001258417.1. [Q9P2F6-4 ]
NP_001245347.1. NM_001258418.1. [Q9P2F6-4 ]
NP_065860.2. NM_020809.3. [Q9P2F6-1 ]
XP_006718956.1. XM_006718893.1. [Q9P2F6-1 ]
UniGenei Hs.6136.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3MSX X-ray 1.65 B 351-551 [» ]
ProteinModelPortali Q9P2F6.
SMRi Q9P2F6. Positions 360-551.
ModBasei Search...

Protein-protein interaction databases

BioGridi 121622. 2 interactions.
IntActi Q9P2F6. 1 interaction.

PTM databases

PhosphoSitei Q9P2F6.

Polymorphism databases

DMDMi 143458429.

Proteomic databases

PaxDbi Q9P2F6.
PRIDEi Q9P2F6.

Protocols and materials databases

DNASUi 57569.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000260283 ; ENSP00000260283 ; ENSG00000137727 . [Q9P2F6-1 ]
ENST00000357139 ; ENSP00000349660 ; ENSG00000137727 . [Q9P2F6-2 ]
ENST00000524756 ; ENSP00000432076 ; ENSG00000137727 . [Q9P2F6-3 ]
ENST00000527598 ; ENSP00000431399 ; ENSG00000137727 . [Q9P2F6-4 ]
ENST00000528829 ; ENSP00000436319 ; ENSG00000137727 . [Q9P2F6-4 ]
ENST00000529591 ; ENSP00000437905 ; ENSG00000137727 .
ENST00000533353 ; ENSP00000436522 ; ENSG00000137727 . [Q9P2F6-2 ]
GeneIDi 57569.
KEGGi hsa:57569.
UCSCi uc001pky.2. human. [Q9P2F6-3 ]
uc001pkz.2. human. [Q9P2F6-1 ]
uc001pla.2. human. [Q9P2F6-2 ]

Organism-specific databases

CTDi 57569.
GeneCardsi GC11M110447.
H-InvDBi HIX0010100.
HGNCi HGNC:18357. ARHGAP20.
HPAi HPA038458.
MIMi 609568. gene.
neXtProti NX_Q9P2F6.
PharmGKBi PA134963885.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG271519.
HOVERGENi HBG061748.
InParanoidi Q9P2F6.
OMAi INQSLVM.
OrthoDBi EOG7NCV2Q.
PhylomeDBi Q9P2F6.
TreeFami TF331062.

Enzyme and pathway databases

Reactomei REACT_11051. Rho GTPase cycle.

Miscellaneous databases

EvolutionaryTracei Q9P2F6.
GenomeRNAii 57569.
NextBioi 64086.
PROi Q9P2F6.
SOURCEi Search...

Gene expression databases

Bgeei Q9P2F6.
CleanExi HS_ARHGAP20.
Genevestigatori Q9P2F6.

Family and domain databases

Gene3Di 1.10.555.10. 1 hit.
2.30.29.30. 1 hit.
InterProi IPR001849. PH_domain.
IPR011993. PH_like_dom.
IPR000159. Ras-assoc.
IPR008936. Rho_GTPase_activation_prot.
IPR000198. RhoGAP_dom.
IPR029071. Ubiquitin-rel_dom.
[Graphical view ]
Pfami PF00788. RA. 1 hit.
PF00620. RhoGAP. 1 hit.
[Graphical view ]
SMARTi SM00233. PH. 1 hit.
SM00324. RhoGAP. 1 hit.
[Graphical view ]
SUPFAMi SSF48350. SSF48350. 1 hit.
SSF54236. SSF54236. 1 hit.
PROSITEi PS50200. RA. 1 hit.
PS50238. RHOGAP. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Translocation t(X;11)(q13;q23) in B-cell chronic lymphocytic leukemia disrupts two novel genes."
    Kalla C., Nentwich H., Schlotter M., Mertens D., Wildenberger K., Doehner H., Stilgenbauer S., Lichter P.
    Genes Chromosomes Cancer 42:128-143(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, CHROMOSOMAL TRANSLOCATION WITH BRWD3.
  2. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Brain.
  3. NHLBI resequencing and genotyping service (RS&G)
    Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 436-1185 (ISOFORMS 1/2/3/4).
    Tissue: Testis.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 436-1185 (ISOFORMS 1/2/3/4), VARIANT ASP-632.
    Tissue: Testis.
  7. "Identification and characterization of human KIAA1391 and mouse Kiaa1391 genes encoding novel RhoGAP family proteins with RA domain and ANXL repeats."
    Katoh M., Katoh M.
    Int. J. Oncol. 23:1471-1476(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.

Entry informationi

Entry nameiRHG20_HUMAN
AccessioniPrimary (citable) accession number: Q9P2F6
Secondary accession number(s): A8K8C5
, B0YIW7, B0YIW8, Q6RJU1, Q6RJU2, Q6RJU3, Q6RJU5, Q8IXS1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: April 3, 2007
Last modified: September 3, 2014
This is version 102 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

The translocation involving this gene was originally published as t(X;11)(q13;23) (1 Publication), but BRWD3 is localized to Xq21 and not to Xq13.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi