Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P2F6

- RHG20_HUMAN

UniProt

Q9P2F6 - RHG20_HUMAN

Protein

Rho GTPase-activating protein 20

Gene

ARHGAP20

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 103 (01 Oct 2014)
      Sequence version 2 (03 Apr 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.By similarity

    GO - Molecular functioni

    1. GTPase activator activity Source: UniProtKB-KW

    GO - Biological processi

    1. regulation of small GTPase mediated signal transduction Source: Reactome
    2. small GTPase mediated signal transduction Source: Reactome

    Keywords - Molecular functioni

    GTPase activation

    Enzyme and pathway databases

    ReactomeiREACT_11051. Rho GTPase cycle.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Rho GTPase-activating protein 20
    Alternative name(s):
    Rho-type GTPase-activating protein 20
    Gene namesi
    Name:ARHGAP20
    Synonyms:KIAA1391
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:18357. ARHGAP20.

    Subcellular locationi

    GO - Cellular componenti

    1. cytosol Source: Reactome

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving ARHGAP20 may be a cause of B-cell chronic lymphocytic leukemia (B-CLL). Translocation t(X;11)(q21;q23) with BRWD3 does not result in fusion transcripts but disrupts both genes.

    Keywords - Diseasei

    Tumor suppressor

    Organism-specific databases

    PharmGKBiPA134963885.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11911191Rho GTPase-activating protein 20PRO_0000283086Add
    BLAST

    Proteomic databases

    PaxDbiQ9P2F6.
    PRIDEiQ9P2F6.

    PTM databases

    PhosphoSiteiQ9P2F6.

    Expressioni

    Tissue specificityi

    Expressed predominantly in the brain. Lower expression is found in lymph nodes.1 Publication

    Developmental stagei

    Low expression is found in fetal liver.1 Publication

    Gene expression databases

    BgeeiQ9P2F6.
    CleanExiHS_ARHGAP20.
    GenevestigatoriQ9P2F6.

    Organism-specific databases

    HPAiHPA038458.

    Interactioni

    Protein-protein interaction databases

    BioGridi121622. 2 interactions.
    IntActiQ9P2F6. 1 interaction.

    Structurei

    Secondary structure

    1
    1191
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi367 – 3704
    Helixi372 – 3743
    Helixi378 – 39013
    Helixi391 – 3933
    Turni395 – 3995
    Helixi404 – 41512
    Helixi427 – 43913
    Turni442 – 4476
    Helixi448 – 4503
    Helixi451 – 4566
    Helixi457 – 4593
    Beta strandi460 – 4623
    Helixi463 – 47412
    Helixi479 – 49618
    Helixi499 – 5024
    Helixi506 – 51712
    Helixi526 – 55025

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3MSXX-ray1.65B351-551[»]
    ProteinModelPortaliQ9P2F6.
    SMRiQ9P2F6. Positions 360-551.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9P2F6.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini78 – 180103PHAdd
    BLAST
    Domaini194 – 295102Ras-associatingPROSITE-ProRule annotationAdd
    BLAST
    Domaini365 – 551187Rho-GAPPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi934 – 97340Ser-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 PH domain.Curated
    Contains 1 Ras-associating domain.PROSITE-ProRule annotation
    Contains 1 Rho-GAP domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG271519.
    HOVERGENiHBG061748.
    InParanoidiQ9P2F6.
    OMAiINQSLVM.
    OrthoDBiEOG7NCV2Q.
    PhylomeDBiQ9P2F6.
    TreeFamiTF331062.

    Family and domain databases

    Gene3Di1.10.555.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProiIPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR000159. Ras-assoc.
    IPR008936. Rho_GTPase_activation_prot.
    IPR000198. RhoGAP_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view]
    PfamiPF00788. RA. 1 hit.
    PF00620. RhoGAP. 1 hit.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    SM00324. RhoGAP. 1 hit.
    [Graphical view]
    SUPFAMiSSF48350. SSF48350. 1 hit.
    SSF54236. SSF54236. 1 hit.
    PROSITEiPS50200. RA. 1 hit.
    PS50238. RHOGAP. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P2F6-1) [UniParc]FASTAAdd to Basket

    Also known as: 1ad

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEAMSPQQET LGGQPGRSSS LTGVSRLAGG SCTKKKMKTL AERRRSAPSL     50
    ILDKALQKRP TTRDSPSASV DTCTFLSSLV CSNRTLLIDG RAELKRGLQR 100
    QERHLFLFND LFVVAKIKYN NNFKIKNKIK LTDMWTASCV DEVGEGNTNA 150
    MKSFVLGWPT VNFVATFSSP EQKDKWLSLL QRYINLEKEK DYPKSIPLKI 200
    FAKDIGNCAY SKTITVMNSD TANEVINMSL PMLGITGSER DYQLWVNSGK 250
    EEAPYPLIGH EYPYGIKMSH LRDSALLTPG SKDSTTPFNL QEPFLMEQLP 300
    REMQCQFILK PSRLAAAQQL SDSGHKTFKR RRSIINWAFW RGSSTHLDNL 350
    PSSPTSPMPG QLFGISLPNI CENDNLPKPV LDMLFFLNQK GPLTKGIFRQ 400
    SANVKSCREL KEKLNSGVEV HLDCESIFVI ASVLKDFLRN IPGSIFSSDL 450
    YDHWVSVMDQ GNDEEKINTV QRLLDQLPRA NVVLLRYLFG VLHNIEQHSS 500
    SNQMTAFNLA VCVAPSILWP PASSSPELEN EFTKKVSLLI QFLIENCLRI 550
    FGEEITSLFR EVSVRCDTRE NASDISCFQL NDSSYDSLEN ELNEDVDAPC 600
    SDLVKKLGQG SRSMDSVLTL SDYDLDQPEV EGLLTLSDFD LAHSKDEDVQ 650
    MKRPLESKPV NILVYTKIPL RDHARAPSAM CTPSYLSTAA ANAAKSLRRH 700
    RRCSEPSIDY LDSKLSYLRE FYQKKLRKSS CDAILSQKDE DYLKQNQPLQ 750
    EEGKTCFKQS LVTGTDVSKK NATTQNTKKK SLSGSEGNHV KLFPKSKPVA 800
    ISVASYSPMS SQDHSKNQPF DVNTSGYSPP HTADALKGPR THRRCSEPNI 850
    EDQNRKLTYL RGIYSKKQHK TSCEAGLLHG EEDYLKRHKS LQMEGQKLIN 900
    QSLVMGIEVG KSSATNQNTE KVLPPRLNLC PRTSYSSLSS PGTSPSGSSV 950
    SSQDSAFSQI SEHSVFTPTE TSSPIDCTFQ AQRKREDLSP DFSNASHVSG 1000
    MPGPSSGQAC SRPAYTKKDT MEWHSQMHSV TLHPSTWLRN GVASLKNWSL 1050
    KKKAKAARPE EEKIASPKGP LEPPPHASGV PEANSLQEEQ KDLPLRAAEG 1100
    LSPVQSAQRC SSSPFQDSER HCSSPFSLVE SRLKLCMKSH EEIEPGSQSS 1150
    SGSLPWERAS ASSWTLEDAT SPDSGPTVVC DIEDRYLTKD I 1191
    Length:1,191
    Mass (Da):132,608
    Last modified:April 3, 2007 - v2
    Checksum:i1837B9DF0655AF41
    GO
    Isoform 2 (identifier: Q9P2F6-2) [UniParc]FASTAAdd to Basket

    Also known as: 1be

    The sequence of this isoform differs from the canonical sequence as follows:
         1-34: MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCTK → MTFWIIIN

    Show »
    Length:1,165
    Mass (Da):130,235
    Checksum:iDFAA6B800B24583C
    GO
    Isoform 3 (identifier: Q9P2F6-3) [UniParc]FASTAAdd to Basket

    Also known as: 1c

    The sequence of this isoform differs from the canonical sequence as follows:
         1-33: MEAMSPQQETLGGQPGRSSSLTGVSRLAGGSCT → MSARERQPAL

    Show »
    Length:1,168
    Mass (Da):130,485
    Checksum:i4A148F7B05DA3586
    GO
    Isoform 4 (identifier: Q9P2F6-4) [UniParc]FASTAAdd to Basket

    Also known as: 1e, 1d

    The sequence of this isoform differs from the canonical sequence as follows:
         1-36: Missing.

    Show »
    Length:1,155
    Mass (Da):128,960
    Checksum:iEA4FF49422FE282E
    GO

    Sequence cautioni

    The sequence AAH39340.1 differs from that shown. Reason: Probable cloning artifact.
    The sequence BAF84979.1 differs from that shown. Reason: Probable cloning artifact.
    The sequence AAH39340.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAA92629.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAF84979.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti522 – 5221A → T.
    Corresponds to variant rs7936020 [ dbSNP | Ensembl ].
    VAR_031489
    Natural varianti632 – 6321G → D.1 Publication
    Corresponds to variant rs17853925 [ dbSNP | Ensembl ].
    VAR_031490

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3636Missing in isoform 4. 1 PublicationVSP_024296Add
    BLAST
    Alternative sequencei1 – 3434MEAMS…GSCTK → MTFWIIIN in isoform 2. 1 PublicationVSP_024294Add
    BLAST
    Alternative sequencei1 – 3333MEAMS…GGSCT → MSARERQPAL in isoform 3. 1 PublicationVSP_024295Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY496263 mRNA. Translation: AAS45466.1.
    AY496264 mRNA. Translation: AAS45467.1.
    AY496265 mRNA. Translation: AAS45468.1.
    AY496266 mRNA. Translation: AAS45469.1.
    AY496267 mRNA. Translation: AAS45470.1.
    AB037812 mRNA. Translation: BAA92629.1. Different initiation.
    EF444953 Genomic DNA. Translation: ACA05945.1.
    EF444953 Genomic DNA. Translation: ACA05946.1.
    CH471065 Genomic DNA. Translation: EAW67134.1.
    AK292290 mRNA. Translation: BAF84979.1. Sequence problems.
    BC039340 mRNA. Translation: AAH39340.1. Sequence problems.
    CCDSiCCDS31673.1. [Q9P2F6-1]
    CCDS58175.1. [Q9P2F6-4]
    CCDS58176.1. [Q9P2F6-2]
    CCDS58177.1. [Q9P2F6-3]
    PIRiC59436.
    RefSeqiNP_001245344.1. NM_001258415.1. [Q9P2F6-3]
    NP_001245345.1. NM_001258416.1. [Q9P2F6-2]
    NP_001245346.1. NM_001258417.1. [Q9P2F6-4]
    NP_001245347.1. NM_001258418.1. [Q9P2F6-4]
    NP_065860.2. NM_020809.3. [Q9P2F6-1]
    XP_006718956.1. XM_006718893.1. [Q9P2F6-1]
    UniGeneiHs.6136.

    Genome annotation databases

    EnsembliENST00000260283; ENSP00000260283; ENSG00000137727. [Q9P2F6-1]
    ENST00000524756; ENSP00000432076; ENSG00000137727. [Q9P2F6-3]
    ENST00000527598; ENSP00000431399; ENSG00000137727. [Q9P2F6-4]
    ENST00000528829; ENSP00000436319; ENSG00000137727. [Q9P2F6-4]
    ENST00000529591; ENSP00000437905; ENSG00000137727.
    ENST00000533353; ENSP00000436522; ENSG00000137727. [Q9P2F6-2]
    GeneIDi57569.
    KEGGihsa:57569.
    UCSCiuc001pky.2. human. [Q9P2F6-3]
    uc001pkz.2. human. [Q9P2F6-1]
    uc001pla.2. human. [Q9P2F6-2]

    Polymorphism databases

    DMDMi143458429.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY496263 mRNA. Translation: AAS45466.1 .
    AY496264 mRNA. Translation: AAS45467.1 .
    AY496265 mRNA. Translation: AAS45468.1 .
    AY496266 mRNA. Translation: AAS45469.1 .
    AY496267 mRNA. Translation: AAS45470.1 .
    AB037812 mRNA. Translation: BAA92629.1 . Different initiation.
    EF444953 Genomic DNA. Translation: ACA05945.1 .
    EF444953 Genomic DNA. Translation: ACA05946.1 .
    CH471065 Genomic DNA. Translation: EAW67134.1 .
    AK292290 mRNA. Translation: BAF84979.1 . Sequence problems.
    BC039340 mRNA. Translation: AAH39340.1 . Sequence problems.
    CCDSi CCDS31673.1. [Q9P2F6-1 ]
    CCDS58175.1. [Q9P2F6-4 ]
    CCDS58176.1. [Q9P2F6-2 ]
    CCDS58177.1. [Q9P2F6-3 ]
    PIRi C59436.
    RefSeqi NP_001245344.1. NM_001258415.1. [Q9P2F6-3 ]
    NP_001245345.1. NM_001258416.1. [Q9P2F6-2 ]
    NP_001245346.1. NM_001258417.1. [Q9P2F6-4 ]
    NP_001245347.1. NM_001258418.1. [Q9P2F6-4 ]
    NP_065860.2. NM_020809.3. [Q9P2F6-1 ]
    XP_006718956.1. XM_006718893.1. [Q9P2F6-1 ]
    UniGenei Hs.6136.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3MSX X-ray 1.65 B 351-551 [» ]
    ProteinModelPortali Q9P2F6.
    SMRi Q9P2F6. Positions 360-551.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121622. 2 interactions.
    IntActi Q9P2F6. 1 interaction.

    PTM databases

    PhosphoSitei Q9P2F6.

    Polymorphism databases

    DMDMi 143458429.

    Proteomic databases

    PaxDbi Q9P2F6.
    PRIDEi Q9P2F6.

    Protocols and materials databases

    DNASUi 57569.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000260283 ; ENSP00000260283 ; ENSG00000137727 . [Q9P2F6-1 ]
    ENST00000524756 ; ENSP00000432076 ; ENSG00000137727 . [Q9P2F6-3 ]
    ENST00000527598 ; ENSP00000431399 ; ENSG00000137727 . [Q9P2F6-4 ]
    ENST00000528829 ; ENSP00000436319 ; ENSG00000137727 . [Q9P2F6-4 ]
    ENST00000529591 ; ENSP00000437905 ; ENSG00000137727 .
    ENST00000533353 ; ENSP00000436522 ; ENSG00000137727 . [Q9P2F6-2 ]
    GeneIDi 57569.
    KEGGi hsa:57569.
    UCSCi uc001pky.2. human. [Q9P2F6-3 ]
    uc001pkz.2. human. [Q9P2F6-1 ]
    uc001pla.2. human. [Q9P2F6-2 ]

    Organism-specific databases

    CTDi 57569.
    GeneCardsi GC11M110447.
    H-InvDB HIX0010100.
    HGNCi HGNC:18357. ARHGAP20.
    HPAi HPA038458.
    MIMi 609568. gene.
    neXtProti NX_Q9P2F6.
    PharmGKBi PA134963885.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG271519.
    HOVERGENi HBG061748.
    InParanoidi Q9P2F6.
    OMAi INQSLVM.
    OrthoDBi EOG7NCV2Q.
    PhylomeDBi Q9P2F6.
    TreeFami TF331062.

    Enzyme and pathway databases

    Reactomei REACT_11051. Rho GTPase cycle.

    Miscellaneous databases

    EvolutionaryTracei Q9P2F6.
    GenomeRNAii 57569.
    NextBioi 64086.
    PROi Q9P2F6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9P2F6.
    CleanExi HS_ARHGAP20.
    Genevestigatori Q9P2F6.

    Family and domain databases

    Gene3Di 1.10.555.10. 1 hit.
    2.30.29.30. 1 hit.
    InterProi IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    IPR000159. Ras-assoc.
    IPR008936. Rho_GTPase_activation_prot.
    IPR000198. RhoGAP_dom.
    IPR029071. Ubiquitin-rel_dom.
    [Graphical view ]
    Pfami PF00788. RA. 1 hit.
    PF00620. RhoGAP. 1 hit.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    SM00324. RhoGAP. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48350. SSF48350. 1 hit.
    SSF54236. SSF54236. 1 hit.
    PROSITEi PS50200. RA. 1 hit.
    PS50238. RHOGAP. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Translocation t(X;11)(q13;q23) in B-cell chronic lymphocytic leukemia disrupts two novel genes."
      Kalla C., Nentwich H., Schlotter M., Mertens D., Wildenberger K., Doehner H., Stilgenbauer S., Lichter P.
      Genes Chromosomes Cancer 42:128-143(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, CHROMOSOMAL TRANSLOCATION WITH BRWD3.
    2. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Tissue: Brain.
    3. NHLBI resequencing and genotyping service (RS&G)
      Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 436-1185 (ISOFORMS 1/2/3/4).
      Tissue: Testis.
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 436-1185 (ISOFORMS 1/2/3/4), VARIANT ASP-632.
      Tissue: Testis.
    7. "Identification and characterization of human KIAA1391 and mouse Kiaa1391 genes encoding novel RhoGAP family proteins with RA domain and ANXL repeats."
      Katoh M., Katoh M.
      Int. J. Oncol. 23:1471-1476(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.

    Entry informationi

    Entry nameiRHG20_HUMAN
    AccessioniPrimary (citable) accession number: Q9P2F6
    Secondary accession number(s): A8K8C5
    , B0YIW7, B0YIW8, Q6RJU1, Q6RJU2, Q6RJU3, Q6RJU5, Q8IXS1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: April 3, 2007
    Last modified: October 1, 2014
    This is version 103 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Caution

    The translocation involving this gene was originally published as t(X;11)(q13;23), but BRWD3 is localized to Xq21 and not to Xq13.1 Publication

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3