Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P2D0

- IBTK_HUMAN

UniProt

Q9P2D0 - IBTK_HUMAN

Protein

Inhibitor of Bruton tyrosine kinase

Gene

IBTK

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 3 (20 Mar 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as an inhibitor of BTK tyrosine kinase activity, thereby playing a role in B-cell development. Down-regulates BTK kinase activity, leading to interference with BTK-mediated calcium mobilization and NF-kappa-B-driven transcription.1 Publication

    GO - Molecular functioni

    1. protein kinase binding Source: MGI
    2. protein tyrosine kinase inhibitor activity Source: MGI

    GO - Biological processi

    1. negative regulation of protein phosphorylation Source: MGI
    2. negative regulation of protein tyrosine kinase activity Source: GOC
    3. release of sequestered calcium ion into cytosol Source: MGI

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Inhibitor of Bruton tyrosine kinase
    Short name:
    IBtk
    Gene namesi
    Name:IBTK
    Synonyms:BTKI, KIAA1417
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:17853. IBTK.

    Subcellular locationi

    Cytoplasm. Membrane; Peripheral membrane protein
    Note: Translocates to the plasma membrane upon IgM stimulation.

    GO - Cellular componenti

    1. cytoplasm Source: MGI
    2. membrane Source: UniProtKB-SubCell
    3. nucleus Source: HPA

    Keywords - Cellular componenti

    Cytoplasm, Membrane, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134898277.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 13531353Inhibitor of Bruton tyrosine kinasePRO_0000280276Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei990 – 9901Phosphoserine1 Publication
    Modified residuei1004 – 10041Phosphoserine1 Publication
    Modified residuei1045 – 10451Phosphoserine3 Publications
    Modified residuei1054 – 10541Phosphoserine1 Publication
    Modified residuei1113 – 11131Phosphoserine1 Publication
    Modified residuei1116 – 11161Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9P2D0.
    PaxDbiQ9P2D0.
    PRIDEiQ9P2D0.

    PTM databases

    PhosphoSiteiQ9P2D0.

    Expressioni

    Tissue specificityi

    Expressed in DeFew, HEK293T, HeLa and in Jurkat, MC3 and NB4 lymphoid cells (at protein level). Isoform 1 is the predominant isoform expressed in all examined tissues and cell lines. Highly expressed in hemopoietic tissues (fetal liver, spleen, lymph node, thymus, peripheral blood leukocytes and bone marrow). Weakly or not expressed in other tissues.2 Publications

    Gene expression databases

    ArrayExpressiQ9P2D0.
    BgeeiQ9P2D0.
    GenevestigatoriQ9P2D0.

    Organism-specific databases

    HPAiHPA023826.

    Interactioni

    Subunit structurei

    Interacts with the PH domain of BTK. Isoform 2 does not interact with BTK.2 Publications

    Protein-protein interaction databases

    BioGridi117474. 17 interactions.
    IntActiQ9P2D0. 4 interactions.
    MINTiMINT-215747.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9P2D0.
    SMRiQ9P2D0. Positions 21-466, 744-899.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati51 – 8030ANK 1Add
    BLAST
    Repeati85 – 11430ANK 2Add
    BLAST
    Repeati141 – 19454RCC1 1Add
    BLAST
    Repeati195 – 24652RCC1 2Add
    BLAST
    Repeati248 – 30154RCC1 3Add
    BLAST
    Domaini564 – 64481BTB 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini768 – 83669BTB 2PROSITE-ProRule annotationAdd
    BLAST
    Repeati806 – 83530ANK 3Add
    BLAST

    Sequence similaritiesi

    Contains 3 ANK repeats.PROSITE-ProRule annotation
    Contains 2 BTB (POZ) domains.PROSITE-ProRule annotation
    Contains 3 RCC1 repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    ANK repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG5184.
    HOVERGENiHBG081779.
    InParanoidiQ9P2D0.
    OMAiVSALHHK.
    OrthoDBiEOG7K6PT6.
    PhylomeDBiQ9P2D0.
    TreeFamiTF323747.

    Family and domain databases

    Gene3Di1.25.40.20. 1 hit.
    2.130.10.30. 1 hit.
    3.30.710.10. 3 hits.
    InterProiIPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    IPR009091. RCC1/BLIP-II.
    IPR000408. Reg_chr_condens.
    [Graphical view]
    PfamiPF12796. Ank_2. 1 hit.
    PF00651. BTB. 2 hits.
    PF00415. RCC1. 3 hits.
    [Graphical view]
    SMARTiSM00248. ANK. 2 hits.
    SM00225. BTB. 2 hits.
    [Graphical view]
    SUPFAMiSSF48403. SSF48403. 1 hit.
    SSF50985. SSF50985. 1 hit.
    SSF54695. SSF54695. 2 hits.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 2 hits.
    PS50097. BTB. 2 hits.
    PS50012. RCC1_3. 3 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P2D0-1) [UniParc]FASTAAdd to Basket

    Also known as: IBtk-alpha

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSPMPDCTS KCRSLKHALD VLSVVTKGSE NQIKAFLSSH CYNAATIKDV     50
    FGRNALHLVS SCGKKGVLDW LIQKGVDLLV KDKESGWTAL HRSIFYGHID 100
    CVWSLLKHGV SLYIQDKEGL SALDLVMKDR PTHVVFKNTD PTDVYTWGDN 150
    TNFTLGHGSQ NSKHHPELVD LFSRSGIYIK QVVLCKFHSV FLSQKGQVYT 200
    CGHGPGGRLG HGDEQTCLVP RLVEGLNGHN CSQVAAAKDH TVVLTEDGCV 250
    YTFGLNIFHQ LGIIPPPSSC NVPRQIQAKY LKGRTIIGVA AGRFHTVLWT 300
    REAVYTMGLN GGQLGCLLDP NGEKCVTAPR QVSALHHKDI ALSLVAASDG 350
    ATVCVTTRGD IYLLADYQCK KMASKQLNLK KVLVSGGHME YKVDPEHLKE 400
    NGGQKICILA MDGAGRVFCW RSVNSSLKQC RWAYPRQVFI SDIALNRNEI 450
    LFVTQDGEGF RGRWFEEKRK SSEKKEILSN LHNSSSDVSY VSDINSVYER 500
    IRLEKLTFAH RAVSVSTDPS GCNFAILQSD PKTSLYEIPA VSSSSFFEEF 550
    GKLLREADEM DSIHDVTFQV GNRLFPAHKY ILAVHSDFFQ KLFLSDGNTS 600
    EFTDIYQKDE DSAGCHLFVV EKVHPDMFEY LLQFIYTDTC DFLTHGFKPR 650
    IHLNKNPEEY QGTLNSHLNK VNFHEDDNQK SAFEVYKSNQ AQTVSERQKS 700
    KPKSCKKGKN IREDDPVRML QTVAKKFDFS NLSSRLDGVR FENEKINVIA 750
    KNTGNKLKLS QKKCSFLCDV TMKSVDGKEF PCHKCVLCAR LEYFHSMLSS 800
    SWIEASSCAA LEMPIHSDIL KVILDYLYTD EAVVIKESQN VDFICSVLVV 850
    ADQLLITRLK EICEVALTEK LTLKNAAMLL EFAAMYSAKQ LKLSCLQFIG 900
    LNMAALLEAR SLDVLSDGVL KDLSEFYRKM IPAMDRRVIT PYQDGPDISY 950
    LEVEDGDIFL KEEINMEQNH SETMFKKAKT KAKKKPRKRS DSSGGYNLSD 1000
    IIQSPSSTGL LKSGKTNSVE SLPELLTSDS EGSYAGVGSP RDLQSPDFTT 1050
    GFHSDKIEAK VKPYVNGTSP VYSREDLKPW EKSPILKISA PQPIPSNRID 1100
    TTSSASWVAG SFSPVSPPVV DLRTIMEIEE SRQKCGATPK SHLGKTVSHG 1150
    VKLSQKQRKM IALTTKENNS GMNSMETVLF TPSKAPKPVN AWASSLHSVS 1200
    SKSFRDFLLE EKKSVTSHSS GDHVKKVSFK GIENSQAPKI VRCSTHGTPG 1250
    PEGNHISDLP LLDSPNPWLS SSVTAPSMVA PVTFASIVEE ELQQEAALIR 1300
    SREKPLALIQ IEEHAIQDLL VFYEAFGNPE EFVIVERTPQ GPLAVPMWNK 1350
    HGC 1353
    Length:1,353
    Mass (Da):150,528
    Last modified:March 20, 2007 - v3
    Checksum:i67B2D11E276A6AF1
    GO
    Isoform 2 (identifier: Q9P2D0-2) [UniParc]FASTAAdd to Basket

    Also known as: IBtk-beta

    The sequence of this isoform differs from the canonical sequence as follows:
         1145-1196: KTVSHGVKLS...KPVNAWASSL → WVENITKDHF...GQFSLHNIIS
         1197-1353: Missing.

    Note: Due to a partial intron retention.

    Show »
    Length:1,196
    Mass (Da):133,859
    Checksum:i7AEB0AF9F4B92805
    GO
    Isoform 3 (identifier: Q9P2D0-3) [UniParc]FASTAAdd to Basket

    Also known as: IBtk-gamma

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1113: Missing.
         1114-1144: PVSPPVVDLRTIMEIEESRQKCGATPKSHLG → MLIDIISSKMISHGIKLCQKKPLKLIGLISS

    Note: Due to a partial intron retention.

    Show »
    Length:240
    Mass (Da):26,314
    Checksum:i55673D0FC6EE3FEB
    GO

    Sequence cautioni

    The sequence AAG27170.1 differs from that shown. Reason: Aberrant splicing.
    The sequence BAA92655.2 differs from that shown. Reason: Erroneous initiation.
    The sequence CAI23414.1 differs from that shown. Reason: Erroneous gene model prediction.
    The sequence CAI23416.1 differs from that shown. Reason: Erroneous gene model prediction.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti971 – 9711S → G in CAB43239. (PubMed:17974005)Curated
    Sequence conflicti1197 – 11971H → R in CAB43239. (PubMed:17974005)Curated
    Sequence conflicti1218 – 12181H → L in CAB43239. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti1065 – 10651V → I.
    Corresponds to variant rs12662902 [ dbSNP | Ensembl ].
    VAR_031106
    Natural varianti1185 – 11851A → V.2 Publications
    Corresponds to variant rs9449444 [ dbSNP | Ensembl ].
    VAR_031107

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11131113Missing in isoform 3. 1 PublicationVSP_023600Add
    BLAST
    Alternative sequencei1114 – 114431PVSPP…KSHLG → MLIDIISSKMISHGIKLCQK KPLKLIGLISS in isoform 3. 1 PublicationVSP_023601Add
    BLAST
    Alternative sequencei1145 – 119652KTVSH…WASSL → WVENITKDHFMLYFCPKNWT DLLHLSYYFSAFDVIVNYTS FSGQFSLHNIIS in isoform 2. 1 PublicationVSP_023602Add
    BLAST
    Alternative sequencei1197 – 1353157Missing in isoform 2. 1 PublicationVSP_023604Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ005633 mRNA. Translation: AAY55906.1.
    DQ005634 mRNA. Translation: AAY55907.1.
    DQ005635 mRNA. Translation: AAY55908.1.
    AB037838 mRNA. Translation: BAA92655.2. Different initiation.
    AL050333 Genomic DNA. Translation: CAI23414.1. Sequence problems.
    AL050333 Genomic DNA. Translation: CAI23416.1. Sequence problems.
    BC027490 mRNA. Translation: AAH27490.1.
    BC038244 mRNA. Translation: AAH38244.2.
    BC042171 mRNA. Translation: AAH42171.2.
    BC113696 mRNA. Translation: AAI13697.1.
    BC113698 mRNA. Translation: AAI13699.1.
    AL050018 mRNA. Translation: CAB43239.1.
    AF235049 mRNA. Translation: AAG27170.1. Sequence problems.
    CCDSiCCDS34490.1. [Q9P2D0-1]
    PIRiT08705.
    RefSeqiNP_056340.2. NM_015525.2. [Q9P2D0-1]
    UniGeneiHs.306425.

    Genome annotation databases

    EnsembliENST00000306270; ENSP00000305721; ENSG00000005700. [Q9P2D0-1]
    GeneIDi25998.
    KEGGihsa:25998.
    UCSCiuc003pjl.1. human. [Q9P2D0-1]
    uc003pjm.2. human. [Q9P2D0-2]

    Polymorphism databases

    DMDMi134034141.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ005633 mRNA. Translation: AAY55906.1 .
    DQ005634 mRNA. Translation: AAY55907.1 .
    DQ005635 mRNA. Translation: AAY55908.1 .
    AB037838 mRNA. Translation: BAA92655.2 . Different initiation.
    AL050333 Genomic DNA. Translation: CAI23414.1 . Sequence problems.
    AL050333 Genomic DNA. Translation: CAI23416.1 . Sequence problems.
    BC027490 mRNA. Translation: AAH27490.1 .
    BC038244 mRNA. Translation: AAH38244.2 .
    BC042171 mRNA. Translation: AAH42171.2 .
    BC113696 mRNA. Translation: AAI13697.1 .
    BC113698 mRNA. Translation: AAI13699.1 .
    AL050018 mRNA. Translation: CAB43239.1 .
    AF235049 mRNA. Translation: AAG27170.1 . Sequence problems.
    CCDSi CCDS34490.1. [Q9P2D0-1 ]
    PIRi T08705.
    RefSeqi NP_056340.2. NM_015525.2. [Q9P2D0-1 ]
    UniGenei Hs.306425.

    3D structure databases

    ProteinModelPortali Q9P2D0.
    SMRi Q9P2D0. Positions 21-466, 744-899.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117474. 17 interactions.
    IntActi Q9P2D0. 4 interactions.
    MINTi MINT-215747.

    PTM databases

    PhosphoSitei Q9P2D0.

    Polymorphism databases

    DMDMi 134034141.

    Proteomic databases

    MaxQBi Q9P2D0.
    PaxDbi Q9P2D0.
    PRIDEi Q9P2D0.

    Protocols and materials databases

    DNASUi 25998.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000306270 ; ENSP00000305721 ; ENSG00000005700 . [Q9P2D0-1 ]
    GeneIDi 25998.
    KEGGi hsa:25998.
    UCSCi uc003pjl.1. human. [Q9P2D0-1 ]
    uc003pjm.2. human. [Q9P2D0-2 ]

    Organism-specific databases

    CTDi 25998.
    GeneCardsi GC06M082879.
    HGNCi HGNC:17853. IBTK.
    HPAi HPA023826.
    MIMi 606457. gene.
    neXtProti NX_Q9P2D0.
    PharmGKBi PA134898277.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5184.
    HOVERGENi HBG081779.
    InParanoidi Q9P2D0.
    OMAi VSALHHK.
    OrthoDBi EOG7K6PT6.
    PhylomeDBi Q9P2D0.
    TreeFami TF323747.

    Miscellaneous databases

    ChiTaRSi IBTK. human.
    GenomeRNAii 25998.
    NextBioi 47714.
    PROi Q9P2D0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9P2D0.
    Bgeei Q9P2D0.
    Genevestigatori Q9P2D0.

    Family and domain databases

    Gene3Di 1.25.40.20. 1 hit.
    2.130.10.30. 1 hit.
    3.30.710.10. 3 hits.
    InterProi IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    IPR009091. RCC1/BLIP-II.
    IPR000408. Reg_chr_condens.
    [Graphical view ]
    Pfami PF12796. Ank_2. 1 hit.
    PF00651. BTB. 2 hits.
    PF00415. RCC1. 3 hits.
    [Graphical view ]
    SMARTi SM00248. ANK. 2 hits.
    SM00225. BTB. 2 hits.
    [Graphical view ]
    SUPFAMi SSF48403. SSF48403. 1 hit.
    SSF50985. SSF50985. 1 hit.
    SSF54695. SSF54695. 2 hits.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 2 hits.
    PS50097. BTB. 2 hits.
    PS50012. RCC1_3. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Physical and functional characterization of the genetic locus of IBtk, an inhibitor of Bruton's tyrosine kinase: evidence for three protein isoforms of IBtk."
      Spatuzza C., Schiavone M., Di Salle E., Janda E., Sardiello M., Fiume G., Fierro O., Simonetta M., Argiriou N., Faraonio R., Capparelli R., Quinto I., Scala G.
      Nucleic Acids Res. 36:4402-4416(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE SPLICING, INTERACTION WITH BTK, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    2. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    3. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    4. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-1185.
      Tissue: Brain and Skin.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 971-1353 (ISOFORM 1).
      Tissue: Brain.
    7. "Direct inhibition of Bruton's tyrosine kinase by IBtk, a Btk-binding protein."
      Liu W., Quinto I., Chen X., Palmieri C., Rabin R.L., Schwartz O.M., Nelson D.L., Scala G.
      Nat. Immunol. 2:939-946(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1159-1353 (ISOFORMS 1/3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH BTK, VARIANT VAL-1185.
      Tissue: B-cell.
    8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-990; SER-1004; SER-1045 AND SER-1054, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1045; SER-1113 AND SER-1116, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1045, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiIBTK_HUMAN
    AccessioniPrimary (citable) accession number: Q9P2D0
    Secondary accession number(s): Q2QKU2
    , Q2QKU3, Q2QKU4, Q5TFD7, Q5TFD9, Q8IUQ9, Q8IUY7, Q8TAI4, Q9HBI8, Q9Y3T8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 20, 2007
    Last sequence update: March 20, 2007
    Last modified: October 1, 2014
    This is version 106 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3