Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P2D0

- IBTK_HUMAN

UniProt

Q9P2D0 - IBTK_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Inhibitor of Bruton tyrosine kinase

Gene

IBTK

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Acts as an inhibitor of BTK tyrosine kinase activity, thereby playing a role in B-cell development. Down-regulates BTK kinase activity, leading to interference with BTK-mediated calcium mobilization and NF-kappa-B-driven transcription.1 Publication

GO - Molecular functioni

  1. protein kinase binding Source: MGI
  2. protein tyrosine kinase inhibitor activity Source: MGI

GO - Biological processi

  1. negative regulation of protein phosphorylation Source: MGI
  2. negative regulation of protein tyrosine kinase activity Source: GOC
  3. release of sequestered calcium ion into cytosol Source: MGI
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Inhibitor of Bruton tyrosine kinase
Short name:
IBtk
Gene namesi
Name:IBTK
Synonyms:BTKI, KIAA1417
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:17853. IBTK.

Subcellular locationi

Cytoplasm. Membrane; Peripheral membrane protein
Note: Translocates to the plasma membrane upon IgM stimulation.

GO - Cellular componenti

  1. cytoplasm Source: MGI
  2. membrane Source: UniProtKB-KW
  3. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134898277.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 13531353Inhibitor of Bruton tyrosine kinasePRO_0000280276Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei990 – 9901Phosphoserine1 Publication
Modified residuei1004 – 10041Phosphoserine1 Publication
Modified residuei1045 – 10451Phosphoserine3 Publications
Modified residuei1054 – 10541Phosphoserine1 Publication
Modified residuei1113 – 11131Phosphoserine1 Publication
Modified residuei1116 – 11161Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9P2D0.
PaxDbiQ9P2D0.
PRIDEiQ9P2D0.

PTM databases

PhosphoSiteiQ9P2D0.

Expressioni

Tissue specificityi

Expressed in DeFew, HEK293T, HeLa and in Jurkat, MC3 and NB4 lymphoid cells (at protein level). Isoform 1 is the predominant isoform expressed in all examined tissues and cell lines. Highly expressed in hemopoietic tissues (fetal liver, spleen, lymph node, thymus, peripheral blood leukocytes and bone marrow). Weakly or not expressed in other tissues.2 Publications

Gene expression databases

BgeeiQ9P2D0.
ExpressionAtlasiQ9P2D0. baseline and differential.
GenevestigatoriQ9P2D0.

Organism-specific databases

HPAiHPA023826.

Interactioni

Subunit structurei

Interacts with the PH domain of BTK. Isoform 2 does not interact with BTK.2 Publications

Protein-protein interaction databases

BioGridi117474. 17 interactions.
IntActiQ9P2D0. 4 interactions.
MINTiMINT-215747.

Structurei

3D structure databases

ProteinModelPortaliQ9P2D0.
SMRiQ9P2D0. Positions 21-362, 744-899.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati51 – 8030ANK 1Add
BLAST
Repeati85 – 11430ANK 2Add
BLAST
Repeati141 – 19454RCC1 1Add
BLAST
Repeati195 – 24652RCC1 2Add
BLAST
Repeati248 – 30154RCC1 3Add
BLAST
Domaini564 – 64481BTB 1PROSITE-ProRule annotationAdd
BLAST
Domaini768 – 83669BTB 2PROSITE-ProRule annotationAdd
BLAST
Repeati806 – 83530ANK 3Add
BLAST

Sequence similaritiesi

Contains 3 ANK repeats.PROSITE-ProRule annotation
Contains 2 BTB (POZ) domains.PROSITE-ProRule annotation
Contains 3 RCC1 repeats.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiCOG5184.
GeneTreeiENSGT00770000120483.
HOVERGENiHBG081779.
InParanoidiQ9P2D0.
OMAiVSALHHK.
OrthoDBiEOG7K6PT6.
PhylomeDBiQ9P2D0.
TreeFamiTF323747.

Family and domain databases

Gene3Di1.25.40.20. 1 hit.
2.130.10.30. 1 hit.
3.30.710.10. 3 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR009091. RCC1/BLIP-II.
IPR000408. Reg_chr_condens.
[Graphical view]
PfamiPF12796. Ank_2. 1 hit.
PF00651. BTB. 2 hits.
PF00415. RCC1. 3 hits.
[Graphical view]
SMARTiSM00248. ANK. 2 hits.
SM00225. BTB. 2 hits.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
SSF50985. SSF50985. 1 hit.
SSF54695. SSF54695. 2 hits.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 2 hits.
PS50097. BTB. 2 hits.
PS50012. RCC1_3. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P2D0-1) [UniParc]FASTAAdd to Basket

Also known as: IBtk-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSPMPDCTS KCRSLKHALD VLSVVTKGSE NQIKAFLSSH CYNAATIKDV
60 70 80 90 100
FGRNALHLVS SCGKKGVLDW LIQKGVDLLV KDKESGWTAL HRSIFYGHID
110 120 130 140 150
CVWSLLKHGV SLYIQDKEGL SALDLVMKDR PTHVVFKNTD PTDVYTWGDN
160 170 180 190 200
TNFTLGHGSQ NSKHHPELVD LFSRSGIYIK QVVLCKFHSV FLSQKGQVYT
210 220 230 240 250
CGHGPGGRLG HGDEQTCLVP RLVEGLNGHN CSQVAAAKDH TVVLTEDGCV
260 270 280 290 300
YTFGLNIFHQ LGIIPPPSSC NVPRQIQAKY LKGRTIIGVA AGRFHTVLWT
310 320 330 340 350
REAVYTMGLN GGQLGCLLDP NGEKCVTAPR QVSALHHKDI ALSLVAASDG
360 370 380 390 400
ATVCVTTRGD IYLLADYQCK KMASKQLNLK KVLVSGGHME YKVDPEHLKE
410 420 430 440 450
NGGQKICILA MDGAGRVFCW RSVNSSLKQC RWAYPRQVFI SDIALNRNEI
460 470 480 490 500
LFVTQDGEGF RGRWFEEKRK SSEKKEILSN LHNSSSDVSY VSDINSVYER
510 520 530 540 550
IRLEKLTFAH RAVSVSTDPS GCNFAILQSD PKTSLYEIPA VSSSSFFEEF
560 570 580 590 600
GKLLREADEM DSIHDVTFQV GNRLFPAHKY ILAVHSDFFQ KLFLSDGNTS
610 620 630 640 650
EFTDIYQKDE DSAGCHLFVV EKVHPDMFEY LLQFIYTDTC DFLTHGFKPR
660 670 680 690 700
IHLNKNPEEY QGTLNSHLNK VNFHEDDNQK SAFEVYKSNQ AQTVSERQKS
710 720 730 740 750
KPKSCKKGKN IREDDPVRML QTVAKKFDFS NLSSRLDGVR FENEKINVIA
760 770 780 790 800
KNTGNKLKLS QKKCSFLCDV TMKSVDGKEF PCHKCVLCAR LEYFHSMLSS
810 820 830 840 850
SWIEASSCAA LEMPIHSDIL KVILDYLYTD EAVVIKESQN VDFICSVLVV
860 870 880 890 900
ADQLLITRLK EICEVALTEK LTLKNAAMLL EFAAMYSAKQ LKLSCLQFIG
910 920 930 940 950
LNMAALLEAR SLDVLSDGVL KDLSEFYRKM IPAMDRRVIT PYQDGPDISY
960 970 980 990 1000
LEVEDGDIFL KEEINMEQNH SETMFKKAKT KAKKKPRKRS DSSGGYNLSD
1010 1020 1030 1040 1050
IIQSPSSTGL LKSGKTNSVE SLPELLTSDS EGSYAGVGSP RDLQSPDFTT
1060 1070 1080 1090 1100
GFHSDKIEAK VKPYVNGTSP VYSREDLKPW EKSPILKISA PQPIPSNRID
1110 1120 1130 1140 1150
TTSSASWVAG SFSPVSPPVV DLRTIMEIEE SRQKCGATPK SHLGKTVSHG
1160 1170 1180 1190 1200
VKLSQKQRKM IALTTKENNS GMNSMETVLF TPSKAPKPVN AWASSLHSVS
1210 1220 1230 1240 1250
SKSFRDFLLE EKKSVTSHSS GDHVKKVSFK GIENSQAPKI VRCSTHGTPG
1260 1270 1280 1290 1300
PEGNHISDLP LLDSPNPWLS SSVTAPSMVA PVTFASIVEE ELQQEAALIR
1310 1320 1330 1340 1350
SREKPLALIQ IEEHAIQDLL VFYEAFGNPE EFVIVERTPQ GPLAVPMWNK

HGC
Length:1,353
Mass (Da):150,528
Last modified:March 20, 2007 - v3
Checksum:i67B2D11E276A6AF1
GO
Isoform 2 (identifier: Q9P2D0-2) [UniParc]FASTAAdd to Basket

Also known as: IBtk-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1145-1196: KTVSHGVKLS...KPVNAWASSL → WVENITKDHF...GQFSLHNIIS
     1197-1353: Missing.

Note: Due to a partial intron retention.

Show »
Length:1,196
Mass (Da):133,859
Checksum:i7AEB0AF9F4B92805
GO
Isoform 3 (identifier: Q9P2D0-3) [UniParc]FASTAAdd to Basket

Also known as: IBtk-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     1-1113: Missing.
     1114-1144: PVSPPVVDLRTIMEIEESRQKCGATPKSHLG → MLIDIISSKMISHGIKLCQKKPLKLIGLISS

Note: Due to a partial intron retention.

Show »
Length:240
Mass (Da):26,314
Checksum:i55673D0FC6EE3FEB
GO

Sequence cautioni

The sequence AAG27170.1 differs from that shown. Reason: Aberrant splicing.Curated
The sequence BAA92655.2 differs from that shown. Reason: Erroneous initiation. Curated
The sequence CAI23414.1 differs from that shown. Reason: Erroneous gene model prediction. Curated
The sequence CAI23416.1 differs from that shown. Reason: Erroneous gene model prediction. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti971 – 9711S → G in CAB43239. (PubMed:17974005)Curated
Sequence conflicti1197 – 11971H → R in CAB43239. (PubMed:17974005)Curated
Sequence conflicti1218 – 12181H → L in CAB43239. (PubMed:17974005)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1065 – 10651V → I.
Corresponds to variant rs12662902 [ dbSNP | Ensembl ].
VAR_031106
Natural varianti1185 – 11851A → V.2 Publications
Corresponds to variant rs9449444 [ dbSNP | Ensembl ].
VAR_031107

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11131113Missing in isoform 3. 1 PublicationVSP_023600Add
BLAST
Alternative sequencei1114 – 114431PVSPP…KSHLG → MLIDIISSKMISHGIKLCQK KPLKLIGLISS in isoform 3. 1 PublicationVSP_023601Add
BLAST
Alternative sequencei1145 – 119652KTVSH…WASSL → WVENITKDHFMLYFCPKNWT DLLHLSYYFSAFDVIVNYTS FSGQFSLHNIIS in isoform 2. 1 PublicationVSP_023602Add
BLAST
Alternative sequencei1197 – 1353157Missing in isoform 2. 1 PublicationVSP_023604Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ005633 mRNA. Translation: AAY55906.1.
DQ005634 mRNA. Translation: AAY55907.1.
DQ005635 mRNA. Translation: AAY55908.1.
AB037838 mRNA. Translation: BAA92655.2. Different initiation.
AL050333 Genomic DNA. Translation: CAI23414.1. Sequence problems.
AL050333 Genomic DNA. Translation: CAI23416.1. Sequence problems.
BC027490 mRNA. Translation: AAH27490.1.
BC038244 mRNA. Translation: AAH38244.2.
BC042171 mRNA. Translation: AAH42171.2.
BC113696 mRNA. Translation: AAI13697.1.
BC113698 mRNA. Translation: AAI13699.1.
AL050018 mRNA. Translation: CAB43239.1.
AF235049 mRNA. Translation: AAG27170.1. Sequence problems.
CCDSiCCDS34490.1. [Q9P2D0-1]
PIRiT08705.
RefSeqiNP_001287835.1. NM_001300906.1.
NP_056340.2. NM_015525.3. [Q9P2D0-1]
UniGeneiHs.306425.

Genome annotation databases

EnsembliENST00000306270; ENSP00000305721; ENSG00000005700. [Q9P2D0-1]
GeneIDi25998.
KEGGihsa:25998.
UCSCiuc003pjl.1. human. [Q9P2D0-1]
uc003pjm.2. human. [Q9P2D0-2]

Polymorphism databases

DMDMi134034141.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ005633 mRNA. Translation: AAY55906.1 .
DQ005634 mRNA. Translation: AAY55907.1 .
DQ005635 mRNA. Translation: AAY55908.1 .
AB037838 mRNA. Translation: BAA92655.2 . Different initiation.
AL050333 Genomic DNA. Translation: CAI23414.1 . Sequence problems.
AL050333 Genomic DNA. Translation: CAI23416.1 . Sequence problems.
BC027490 mRNA. Translation: AAH27490.1 .
BC038244 mRNA. Translation: AAH38244.2 .
BC042171 mRNA. Translation: AAH42171.2 .
BC113696 mRNA. Translation: AAI13697.1 .
BC113698 mRNA. Translation: AAI13699.1 .
AL050018 mRNA. Translation: CAB43239.1 .
AF235049 mRNA. Translation: AAG27170.1 . Sequence problems.
CCDSi CCDS34490.1. [Q9P2D0-1 ]
PIRi T08705.
RefSeqi NP_001287835.1. NM_001300906.1.
NP_056340.2. NM_015525.3. [Q9P2D0-1 ]
UniGenei Hs.306425.

3D structure databases

ProteinModelPortali Q9P2D0.
SMRi Q9P2D0. Positions 21-362, 744-899.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 117474. 17 interactions.
IntActi Q9P2D0. 4 interactions.
MINTi MINT-215747.

PTM databases

PhosphoSitei Q9P2D0.

Polymorphism databases

DMDMi 134034141.

Proteomic databases

MaxQBi Q9P2D0.
PaxDbi Q9P2D0.
PRIDEi Q9P2D0.

Protocols and materials databases

DNASUi 25998.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000306270 ; ENSP00000305721 ; ENSG00000005700 . [Q9P2D0-1 ]
GeneIDi 25998.
KEGGi hsa:25998.
UCSCi uc003pjl.1. human. [Q9P2D0-1 ]
uc003pjm.2. human. [Q9P2D0-2 ]

Organism-specific databases

CTDi 25998.
GeneCardsi GC06M082879.
HGNCi HGNC:17853. IBTK.
HPAi HPA023826.
MIMi 606457. gene.
neXtProti NX_Q9P2D0.
PharmGKBi PA134898277.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5184.
GeneTreei ENSGT00770000120483.
HOVERGENi HBG081779.
InParanoidi Q9P2D0.
OMAi VSALHHK.
OrthoDBi EOG7K6PT6.
PhylomeDBi Q9P2D0.
TreeFami TF323747.

Miscellaneous databases

ChiTaRSi IBTK. human.
GenomeRNAii 25998.
NextBioi 47714.
PROi Q9P2D0.
SOURCEi Search...

Gene expression databases

Bgeei Q9P2D0.
ExpressionAtlasi Q9P2D0. baseline and differential.
Genevestigatori Q9P2D0.

Family and domain databases

Gene3Di 1.25.40.20. 1 hit.
2.130.10.30. 1 hit.
3.30.710.10. 3 hits.
InterProi IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
IPR009091. RCC1/BLIP-II.
IPR000408. Reg_chr_condens.
[Graphical view ]
Pfami PF12796. Ank_2. 1 hit.
PF00651. BTB. 2 hits.
PF00415. RCC1. 3 hits.
[Graphical view ]
SMARTi SM00248. ANK. 2 hits.
SM00225. BTB. 2 hits.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 1 hit.
SSF50985. SSF50985. 1 hit.
SSF54695. SSF54695. 2 hits.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 2 hits.
PS50097. BTB. 2 hits.
PS50012. RCC1_3. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Physical and functional characterization of the genetic locus of IBtk, an inhibitor of Bruton's tyrosine kinase: evidence for three protein isoforms of IBtk."
    Spatuzza C., Schiavone M., Di Salle E., Janda E., Sardiello M., Fiume G., Fierro O., Simonetta M., Argiriou N., Faraonio R., Capparelli R., Quinto I., Scala G.
    Nucleic Acids Res. 36:4402-4416(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE SPLICING, INTERACTION WITH BTK, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  3. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-1185.
    Tissue: Brain and Skin.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 971-1353 (ISOFORM 1).
    Tissue: Brain.
  7. "Direct inhibition of Bruton's tyrosine kinase by IBtk, a Btk-binding protein."
    Liu W., Quinto I., Chen X., Palmieri C., Rabin R.L., Schwartz O.M., Nelson D.L., Scala G.
    Nat. Immunol. 2:939-946(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1159-1353 (ISOFORMS 1/3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH BTK, VARIANT VAL-1185.
    Tissue: B-cell.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-990; SER-1004; SER-1045 AND SER-1054, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1045; SER-1113 AND SER-1116, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1045, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiIBTK_HUMAN
AccessioniPrimary (citable) accession number: Q9P2D0
Secondary accession number(s): Q2QKU2
, Q2QKU3, Q2QKU4, Q5TFD7, Q5TFD9, Q8IUQ9, Q8IUY7, Q8TAI4, Q9HBI8, Q9Y3T8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: March 20, 2007
Last modified: November 26, 2014
This is version 108 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3