Q9P2D0 (IBTK_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 94.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Inhibitor of Bruton tyrosine kinase Short name=IBtk | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1353 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as an inhibitor of BTK tyrosine kinase activity, thereby playing a role in B-cell development. Down-regulates BTK kinase activity, leading to interference with BTK-mediated calcium mobilization and NF-kappa-B-driven transcription. Ref.7 |
| Subunit structure | Interacts with the PH domain of BTK. Isoform 2 does not interact with BTK. Ref.1 Ref.7 |
| Subcellular location | Cytoplasm. Membrane; Peripheral membrane protein. Note: Translocates to the plasma membrane upon IgM stimulation. Ref.1 Ref.7 |
| Tissue specificity | Expressed in DeFew, HEK293T, HeLa and in Jurkat, MC3 and NB4 lymphoid cells (at protein level). Isoform 1 is the predominant isoform expressed in all examined tissues and cell lines. Highly expressed in hemopoietic tissues (fetal liver, spleen, lymph node, thymus, peripheral blood leukocytes and bone marrow). Weakly or not expressed in other tissues. Ref.1 Ref.7 |
| Sequence similarities | Contains 3 ANK repeats. Contains 2 BTB (POZ) domains. Contains 3 RCC1 repeats. |
| Sequence caution | The sequence AAG27170.1 differs from that shown. Reason: Aberrant splicing. The sequence BAA92655.2 differs from that shown. Reason: Erroneous initiation. The sequence CAI23414.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI23416.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | ANK repeat Repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | release of sequestered calcium ion into cytosol Inferred from direct assay Ref.7. Source: MGI |
| Cellular_component | cytoplasm Inferred from direct assay Ref.7. Source: MGI membraneInferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from direct assay. Source: HPA |
| Molecular_function | protein kinase binding Inferred from direct assay Ref.7. Source: MGI protein tyrosine kinase inhibitor activityInferred from direct assay Ref.7. Source: MGI |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P2D0-1) Also known as: IBtk-alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P2D0-2) Also known as: IBtk-beta; The sequence of this isoform differs from the canonical sequence as follows: 1145-1196: KTVSHGVKLS...KPVNAWASSL → WVENITKDHF...GQFSLHNIIS 1197-1353: Missing. | ||||||
| Note: Due to a partial intron retention. | ||||||
| Isoform 3 (identifier: Q9P2D0-3) Also known as: IBtk-gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-1113: Missing. 1114-1144: PVSPPVVDLRTIMEIEESRQKCGATPKSHLG → MLIDIISSKMISHGIKLCQKKPLKLIGLISS | ||||||
| Note: Due to a partial intron retention. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1353 | 1353 | Inhibitor of Bruton tyrosine kinase | PRO_0000280276 | |||||
Regions | |||||||||
| Repeat | 51 – 80 | 30 | ANK 1 | ||||||
| Repeat | 85 – 114 | 30 | ANK 2 | ||||||
| Repeat | 141 – 194 | 54 | RCC1 1 | ||||||
| Repeat | 195 – 246 | 52 | RCC1 2 | ||||||
| Repeat | 248 – 301 | 54 | RCC1 3 | ||||||
| Domain | 564 – 644 | 81 | BTB 1 | ||||||
| Domain | 768 – 836 | 69 | BTB 2 | ||||||
| Repeat | 806 – 835 | 30 | ANK 3 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 990 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 1004 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 1045 | 1 | Phosphoserine Ref.8 Ref.10 Ref.11 | ||||||
| Modified residue | 1054 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 1113 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 1116 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 1113 | 1113 | Missing in isoform 3. | VSP_023600 | |||||
| Alternative sequence | 1114 – 1144 | 31 | PVSPP…KSHLG → MLIDIISSKMISHGIKLCQK KPLKLIGLISS in isoform 3. | VSP_023601 | |||||
| Alternative sequence | 1145 – 1196 | 52 | KTVSH…WASSL → WVENITKDHFMLYFCPKNWT DLLHLSYYFSAFDVIVNYTS FSGQFSLHNIIS in isoform 2. | VSP_023602 | |||||
| Alternative sequence | 1197 – 1353 | 157 | Missing in isoform 2. | VSP_023604 | |||||
| Natural variant | 1065 | 1 | V → I. Corresponds to variant rs12662902 [ dbSNP | Ensembl ]. | VAR_031106 | |||||
| Natural variant | 1185 | 1 | A → V. Ref.5 Ref.7 Corresponds to variant rs9449444 [ dbSNP | Ensembl ]. | VAR_031107 | |||||
Experimental info | |||||||||
| Sequence conflict | 971 | 1 | S → G in CAB43239. Ref.6 | ||||||
| Sequence conflict | 1197 | 1 | H → R in CAB43239. Ref.6 | ||||||
| Sequence conflict | 1218 | 1 | H → L in CAB43239. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Physical and functional characterization of the genetic locus of IBtk, an inhibitor of Bruton's tyrosine kinase: evidence for three protein isoforms of IBtk." Spatuzza C., Schiavone M., Di Salle E., Janda E., Sardiello M., Fiume G., Fierro O., Simonetta M., Argiriou N., Faraonio R., Capparelli R., Quinto I., Scala G. Nucleic Acids Res. 36:4402-4416(2008) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE SPLICING, INTERACTION WITH BTK, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract] Cited for: SEQUENCE REVISION. |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-1185. Tissue: Brain and Skin. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 971-1353 (ISOFORM 1). Tissue: Brain. |
| [7] | "Direct inhibition of Bruton's tyrosine kinase by IBtk, a Btk-binding protein." Liu W., Quinto I., Chen X., Palmieri C., Rabin R.L., Schwartz O.M., Nelson D.L., Scala G. Nat. Immunol. 2:939-946(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1159-1353 (ISOFORMS 1/3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH BTK, VARIANT VAL-1185. Tissue: B-cell. |
| [8] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-990; SER-1004; SER-1045 AND SER-1054, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1045; SER-1113 AND SER-1116, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1045, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | DQ005633 mRNA. Translation: AAY55906.1. DQ005634 mRNA. Translation: AAY55907.1. DQ005635 mRNA. Translation: AAY55908.1. AB037838 mRNA. Translation: BAA92655.2. Different initiation. AL050333 Genomic DNA. Translation: CAI23414.1. Sequence problems. AL050333 Genomic DNA. Translation: CAI23416.1. Sequence problems. BC027490 mRNA. Translation: AAH27490.1. BC038244 mRNA. Translation: AAH38244.2. BC042171 mRNA. Translation: AAH42171.2. BC113696 mRNA. Translation: AAI13697.1. BC113698 mRNA. Translation: AAI13699.1. AL050018 mRNA. Translation: CAB43239.1. AF235049 mRNA. Translation: AAG27170.1. Sequence problems. |
| IPI | IPI00792333. IPI00829736. IPI00910313. |
| PIR | T08705. |
| RefSeq | NP_056340.2. NM_015525.2. |
| UniGene | Hs.306425. |
3D structure databases | |
| ProteinModelPortal | Q9P2D0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9P2D0. 4 interactions. |
| MINT | MINT-215747. |
PTM databases | |
| PhosphoSite | Q9P2D0. |
Polymorphism databases | |
| DMDM | 134034141. |
Proteomic databases | |
| PaxDb | Q9P2D0. |
| PRIDE | Q9P2D0. |
Protocols and materials databases | |
| DNASU | 25998. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000306270; ENSP00000305721; ENSG00000005700. |
| GeneID | 25998. |
| KEGG | hsa:25998. |
| UCSC | uc003pjl.1. human. uc003pjm.2. human. |
Organism-specific databases | |
| CTD | 25998. |
| GeneCards | GC06M082879. |
| HGNC | HGNC:17853. IBTK. |
| HPA | HPA023826. |
| MIM | 606457. gene. |
| neXtProt | NX_Q9P2D0. |
| PharmGKB | PA134898277. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5184. |
| HOVERGEN | HBG081779. |
| InParanoid | Q9P2D0. |
| OMA | VSALHHK. |
| OrthoDB | EOG4J6RQ1. |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | bcr_5pathway. BCR signaling pathway. |
Gene expression databases | |
| ArrayExpress | Q9P2D0. |
| Bgee | Q9P2D0. |
| Genevestigator | Q9P2D0. |
Family and domain databases | |
| Gene3D | 1.25.40.20. 1 hit. 2.130.10.30. 1 hit. 3.30.710.10. 3 hits. |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR013069. BTB_POZ. IPR009091. RCC1/BLIP-II. IPR000408. Reg_chr_condens. [Graphical view] |
| Pfam | PF12796. Ank_2. 1 hit. PF00651. BTB. 2 hits. PF00415. RCC1. 3 hits. [Graphical view] |
| SMART | SM00248. ANK. 2 hits. SM00225. BTB. 2 hits. [Graphical view] |
| SUPFAM | SSF48403. ANK. 1 hit. SSF54695. BTB/POZ_fold. 2 hits. SSF50985. RCC1/BLIP-II. 1 hit. |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 2 hits. PS50097. BTB. 2 hits. PS00625. RCC1_1. False negative. PS00626. RCC1_2. False negative. PS50012. RCC1_3. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | IBTK. human. |
| GenomeRNAi | 25998. |
| NextBio | 47714. |
| SOURCE | Search... |
Entry information
| Entry name | IBTK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P2D0 Secondary accession number(s): Q2QKU2 Q9Y3T8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
