Reviewed,
UniProtKB/Swiss-Prot Q9P2D0 (IBTK_HUMAN)
Last modified
November 24, 2009.
Version 61.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Inhibitor of Bruton tyrosine kinase Short name=IBtk | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1353 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Acts as an inhibitor of BTK tyrosine kinase activity, thereby playing a role in B-cell development. Down-regulates BTK kinase activity, leading to interference with BTK-mediated calcium mobilization and NF-kappa-B-driven transcription. Ref.7 |
| Subunit structure | Interacts with the PH domain of BTK. Isoform 2 does not interact with BTK. Ref.7 |
| Subcellular location | Cytoplasm. Membrane; Peripheral membrane protein. Note: Translocates to the plasma membrane upon IgM stimulation. Ref.7 Isoform 2: Nucleus. |
| Tissue specificity | Expressed in DeFew, 293T, Hela and in Jurkat, MC3 and NB4 lymphoid cells (at protein level). Isoform 1 is the predominant isoform expressed in all examined tissues and cell lines. Highly expressed in hemopoietic tissues (fetal liver, spleen, lymph node, thymus, peripheral blood leukocytes and bone marrow). Weakly or not expressed in other tissues. |
| Sequence similarities | Contains 3 ANK repeats. Contains 2 BTB (POZ) domains. Contains 3 RCC1 repeats. |
| Sequence caution | The sequence AAG27170.1 differs from that shown. Reason: Miscellaneous discrepancy. Aberrant splicing. The sequence CAI23414.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI23416.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Membrane Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | ANK repeat Repeat |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | negative regulation of protein amino acid phosphorylation Ref.7 Inferred from direct assay. Source: MGI release of sequestered calcium ion into cytosol Ref.7Inferred from direct assay. Source: MGI |
| Cellular component | cytoplasm Ref.7 Inferred from direct assay. Source: MGI extrinsic to membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | protein kinase binding Ref.7 Inferred from direct assay. Source: MGI protein tyrosine kinase inhibitor activity Ref.7Inferred from direct assay. Source: MGI |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BTK | Q06187 | 1 | EBI-1052017,EBI-624835 | |
| BTK | Q06187 | 3 | EBI-1521221,EBI-624835 | |
| RGS2 | P41220 | 1 | EBI-1052017,EBI-712388 | |
| SNRPN | P63162 | 1 | EBI-1052017,EBI-712493 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P2D0-1) Also known as: IBtk-alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P2D0-2) Also known as: IBtk-beta; The sequence of this isoform differs from the canonical sequence as follows: 1145-1196: KTVSHGVKLS...KPVNAWASSL → WVENITKDHF...GQFSLHNIIS 1197-1353: Missing. | ||||||
| Note: Due to a partial intron retention. | ||||||
| Isoform 3 (identifier: Q9P2D0-3) Also known as: IBtk-gamma; The sequence of this isoform differs from the canonical sequence as follows: 1-1113: Missing. 1114-1144: PVSPPVVDLRTIMEIEESRQKCGATPKSHLG → MLIDIISSKMISHGIKLCQKKPLKLIGLISS | ||||||
| Note: Due to a partial intron retention. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1353 | 1353 | Inhibitor of Bruton tyrosine kinase | PRO_0000280276 | |||||
Regions | |||||||||
| Repeat | 51 – 80 | 30 | ANK 1 | ||||||
| Repeat | 85 – 114 | 30 | ANK 2 | ||||||
| Repeat | 141 – 194 | 54 | RCC1 1 | ||||||
| Repeat | 195 – 246 | 52 | RCC1 2 | ||||||
| Repeat | 248 – 301 | 54 | RCC1 3 | ||||||
| Domain | 564 – 644 | 81 | BTB 1 | ||||||
| Domain | 768 – 836 | 69 | BTB 2 | ||||||
| Repeat | 806 – 835 | 30 | ANK 3 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 630 | 1 | Phosphotyrosine Ref.9 | ||||||
| Modified residue | 990 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 992 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 993 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 1004 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 1045 | 1 | Phosphoserine Ref.10 Ref.8 | ||||||
| Modified residue | 1054 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 1113 | 1113 | Missing in isoform 3. | VSP_023600 | |||||
| Alternative sequence | 1114 – 1144 | 31 | PVSPP…KSHLG → MLIDIISSKMISHGIKLCQK KPLKLIGLISS in isoform 3. | VSP_023601 | |||||
| Alternative sequence | 1145 – 1196 | 52 | KTVSH…WASSL → WVENITKDHFMLYFCPKNWT DLLHLSYYFSAFDVIVNYTS FSGQFSLHNIIS in isoform 2. | VSP_023602 | |||||
| Alternative sequence | 1197 – 1353 | 157 | Missing in isoform 2. | VSP_023604 | |||||
| Natural variant | 1065 | 1 | V → I: dbSNP rs12662902. | VAR_031106 | |||||
| Natural variant | 1185 | 1 | A → V: dbSNP rs9449444. Ref.7 Ref.5 | VAR_031107 | |||||
Experimental info | |||||||||
| Sequence conflict | 971 | 1 | S → G in CAB43239. Ref.6 | ||||||
| Sequence conflict | 1197 | 1 | H → R in CAB43239. Ref.6 | ||||||
| Sequence conflict | 1218 | 1 | H → L in CAB43239. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Physical and functional characterization of the genetic locus of IBtk, an inhibitor of Bruton's tyrosine kinase: evidence for three protein isoforms of IBtk." Spatuzza C., Schiavone M., Di Salle E., Janda E., Sardiello M., Fiume G., Fierro O., Simonetta M., Argiriou N., Faraonio R., Capparelli R., Quinto I., Scala G. Nucleic Acids Res. 36:4402-4416(2008) [PubMed: 18596081] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE SPLICING, INTERACTION WITH BTK, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed: 10718198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones." Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T. DNA Res. 9:99-106(2002) [PubMed: 12168954] [Abstract] Cited for: SEQUENCE REVISION. |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed: 14574404] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT VAL-1185. Tissue: Brain and Skin. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 971-1353 (ISOFORM 1). Tissue: Brain. |
| [7] | "Direct inhibition of Bruton's tyrosine kinase by IBtk, a Btk-binding protein." Liu W., Quinto I., Chen X., Palmieri C., Rabin R.L., Schwartz O.M., Nelson D.L., Scala G. Nat. Immunol. 2:939-946(2001) [PubMed: 11577348] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1159-1353 (ISOFORMS 1/3), FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INTERACTION WITH BTK, VARIANT VAL-1185. Tissue: B-cell. |
| [8] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1045, MASS SPECTROMETRY. Tissue: Epithelium. |
| [9] | "Tyrosine phosphorylated Par3 regulates epithelial tight junction assembly promoted by EGFR signaling." Wang Y., Du D., Fang L., Yang G., Zhang C., Zeng R., Ullrich A., Lottspeich F., Chen Z. EMBO J. 25:5058-5070(2006) [PubMed: 17053785] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-630, MASS SPECTROMETRY. |
| [10] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-990; SER-992; SER-993; SER-1004; SER-1045 AND SER-1054, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| DQ005633 mRNA. Translation: AAY55906.1. DQ005634 mRNA. Translation: AAY55907.1. DQ005635 mRNA. Translation: AAY55908.1. AB037838 mRNA. Translation: BAA92655.2. Different initiation. AL050333 Genomic DNA. Translation: CAI23414.1. Sequence problems. AL050333 Genomic DNA. Translation: CAI23416.1. Sequence problems. BC027490 mRNA. Translation: AAH27490.1. BC038244 mRNA. Translation: AAH38244.2. BC042171 mRNA. Translation: AAH42171.2. BC113696 mRNA. Translation: AAI13697.1. BC113698 mRNA. Translation: AAI13699.1. AL050018 mRNA. Translation: CAB43239.1. AF235049 mRNA. Translation: AAG27170.1. Sequence problems. | |
| IPI | IPI00792333. IPI00829736. IPI00829860. IPI00910313. |
| PIR | T08705. |
| RefSeq | NP_056340.2. |
| UniGene | Hs.306425 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9P2D0. 6 interactions. |
| STRING | Q9P2D0. |
PTM databases | |
| PhosphoSite | Q9P2D0. |
Genome annotation databases | |
| Ensembl | ENST00000306270; ENSP00000305721; ENSG00000005700; Homo sapiens. [Genome view] |
| GeneID | 25998. |
| KEGG | hsa:25998. |
| UCSC | uc003pjj.1. human. uc003pjl.1. human. uc003pjm.1. human. |
Organism-specific databases | |
| CTD | 25998. |
| GeneCards | GC06M082936. |
| HGNC | HGNC:17853. IBTK. |
| HPA | HPA023826. |
| MIM | 606457. gene. |
| PharmGKB | PA134898277. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9P2D0. |
| OMA | KGQVYTC |
| OrthoDB | EOG9D81RK |
Enzyme and pathway databases | |
| Pathway_Interaction_DB | bcr_5pathway. BCR signaling pathway. |
Gene expression databases | |
| ArrayExpress | Q9P2D0. |
| Bgee | Q9P2D0. |
| Genevestigator | Q9P2D0. |
Family and domain databases | |
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR013069. BTB_POZ. IPR000408. Reg_chr_condens. IPR009091. Reg_csome_cond/b-lactamase_inh. [Graphical view] |
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. G3DSA:3.30.710.10. BTB/POZ_fold. 2 hits. G3DSA:2.130.10.30. Reg_csome_cond/b-lactamase_inh. 1 hit. |
| Pfam | PF00023. Ank. 2 hits. PF00651. BTB. 2 hits. PF00415. RCC1. 1 hit. [Graphical view] |
| SMART | SM00248. ANK. 2 hits. SM00225. BTB. 2 hits. [Graphical view] |
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 2 hits. PS50097. BTB. 2 hits. PS00625. RCC1_1. False negative. PS00626. RCC1_2. False negative. PS50012. RCC1_3. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 47714. |
| SOURCE | Search... |
Entry information
| Entry name | IBTK_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P2D0 Secondary accession number(s): Q2QKU2 Q9Y3T8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


