Reviewed,
UniProtKB/Swiss-Prot Q9P287 (BCCIP_HUMAN)
Last modified
June 16, 2009.
Version 53.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: BRCA2 and CDKN1A-interacting protein Alternative name(s): Protein TOK-1 P21- and CDK-associated protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 314 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May promote cell cycle arrest by enhancing the inhibition of CDK2 activity by CDKN1A. May be required for repair of DNA damage by homologous recombination in conjunction with BRCA2. May not be involved in non-homologous end joining (NHEJ). Ref.1 Ref.7 Ref.8 Ref.9 Ref.12 |
| Subunit structure | Interacts with BRCA2, CDKN1A and MTDH/LYRIC. Ref.1 Ref.7 Ref.9 Ref.6 Ref.13 |
| Subcellular location | Nucleus. Note: Colocalizes with BRCA2 in discrete nuclear foci. Ref.1 Ref.9 Ref.6 |
| Tissue specificity | Expressed at high levels in testis and skeletal muscle and at lower levels in brain, heart, kidney, liver, lung, ovary, pancreas, placenta, and spleen. Ref.1 Ref.6 |
| Developmental stage | Isoform 1 is expressed throughout the cell cycle while isoform 2 is expressed following mitosis and peaks in the G1/S phase of the cell cycle. Ref.1 |
| Miscellaneous | HT1080 cells that constitutively express low levels of BCCIP display increased levels of spontaneous single-stranded DNA and double-strand breaks. |
| Sequence similarities | Belongs to the BCP1 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle DNA damage DNA repair |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Gene Ontology (GO) | |
| Biological process | DNA repair Inferred from electronic annotation. Source: UniProtKB-KW cell cycleInferred from electronic annotation. Source: UniProtKB-KW regulation of cyclin-dependent protein kinase activity Ref.1Traceable author statement. Source: ProtInc |
| Cellular component | nucleus Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | protein binding Ref.13 Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P287-1) Also known as: Beta; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P287-2) Also known as: Alpha; The sequence of this isoform differs from the canonical sequence as follows: 259-314: KAILKFNYSV...MDKLKEYLSV → EQGKPEVLGG...TFMTVGIALS | ||||||
| Isoform 3 (identifier: Q9P287-3) The sequence of this isoform differs from the canonical sequence as follows: 285-314: VPMTPLRTVMLIPGDKMNEIMDKLKEYLSV → WSVPPVLE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 314 | 314 | BRCA2 and CDKN1A-interacting protein | PRO_0000249687 | |||||
Regions | |||||||||
| Region | 59 – 167 | 109 | Interaction with BRCA2 | ||||||
| Region | 161 – 259 | 99 | Interaction with CDKN1A | ||||||
Amino acid modifications | |||||||||
| Modified residue | 12 | 1 | Phosphoserine Ref.11 | ||||||
| Modified residue | 42 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 112 | 1 | Phosphoserine Ref.10 | ||||||
| Modified residue | 115 | 1 | Phosphoserine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 259 – 314 | 56 | KAILK…EYLSV → EQGKPEVLGGPDTRRGLEPV PIQHNGGSRGQVTALVSLKA GLIQSRSTLSDFQGTFMTVG IALS in isoform 2. | VSP_020540 | |||||
| Alternative sequence | 285 – 314 | 30 | VPMTP…EYLSV → WSVPPVLE in isoform 3. | VSP_020541 | |||||
| Natural variant | 254 | 1 | E → Q: dbSNP rs17153610. | VAR_046642 | |||||
Experimental info | |||||||||
| Sequence conflict | 230 | 1 | G → E in AAH09771. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "TOK-1, a novel p21Cip1-binding protein that cooperatively enhances p21-dependent inhibitory activity toward CDK2 kinase." Ono T., Kitaura H., Ugai H., Murata T., Yokoyama K.K., Iguchi-Ariga S.M.M., Ariga H. J. Biol. Chem. 275:31145-31154(2000) [PubMed: 10878006] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), FUNCTION, INTERACTION WITH CDKN1A, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, DEVELOPMENTAL STAGE. Tissue: Brain. |
| [2] | "Genomic structure of the human BCCIP gene and its expression in cancer." Meng X., Liu J., Shen Z. Gene 302:139-146(2003) [PubMed: 12527204] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS 1 AND 2). |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Blocker H., Heubner D., Hoerlein A., Michel G., Wedler H., Kohrer K., Ottenwalder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Brain. |
| [4] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [6] | "Inhibition of breast and brain cancer cell growth by BCCIPalpha, an evolutionarily conserved nuclear protein that interacts with BRCA2." Liu J., Yuan Y., Huan J., Shen Z. Oncogene 20:336-345(2001) [PubMed: 11313963] [Abstract] Cited for: INTERACTION WITH BRCA2, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [7] | "Inhibition of G1 to S cell cycle progression by BCCIP beta." Meng X., Liu J., Shen Z. Cell Cycle 3:343-348(2004) [PubMed: 14726710] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDKN1A. |
| [8] | "BCCIP functions through p53 to regulate the expression of p21Waf1/Cip1." Meng X., Lu H., Shen Z. Cell Cycle 3:1457-1462(2004) [PubMed: 15539944] [Abstract] Cited for: FUNCTION. |
| [9] | "The BRCA2-interacting protein BCCIP functions in RAD51 and BRCA2 focus formation and homologous recombinational repair." Lu H., Guo X., Meng X., Liu J., Allen C., Wray J., Nickoloff J.A., Shen Z. Mol. Cell. Biol. 25:1949-1957(2005) [PubMed: 15713648] [Abstract] Cited for: FUNCTION, INTERACTION WITH BRCA2, SUBCELLULAR LOCATION. |
| [10] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed: 17081983] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-42; SER-112 AND SER-115, MASS SPECTROMETRY. Tissue: Epithelium. |
| [11] | "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry." Molina H., Horn D.M., Tang N., Mathivanan S., Pandey A. Proc. Natl. Acad. Sci. U.S.A. 104:2199-2204(2007) [PubMed: 17287340] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-12, MASS SPECTROMETRY. |
| [12] | "BCCIP regulates homologous recombination by distinct domains and suppresses spontaneous DNA damage." Lu H., Yue J., Meng X., Nickoloff J.A., Shen Z. Nucleic Acids Res. 35:7160-7170(2007) [PubMed: 17947333] [Abstract] Cited for: FUNCTION. |
| [13] | "LYRIC/AEG-1 overexpression modulates BCCIPalpha protein levels in prostate tumor cells." Ash S.C., Yang D.Q., Britt D.E. Biochem. Biophys. Res. Commun. 371:333-338(2008) [PubMed: 18440304] [Abstract] Cited for: INTERACTION WITH MTDH. |
| [14] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB040450 mRNA. Translation: BAA92927.1. AB040451 mRNA. Translation: BAA92928.1. AY064247 Genomic DNA. Translation: AAL55436.1. AY064247 Genomic DNA. Translation: AAL55438.1. AY064248 mRNA. Translation: AAL55439.1. AY064249 mRNA. Translation: AAL55440.1. AL834458 mRNA. Translation: CAD39118.1. AL360176 Genomic DNA. Translation: CAI12091.1. AL360176 Genomic DNA. Translation: CAI12092.1. AL360176 Genomic DNA. Translation: CAI12093.1. BC009771 mRNA. Translation: AAH09771.1. | |
| IPI | IPI00002203. IPI00220152. IPI00786906. |
| RefSeq | NP_057651.1. NP_510868.1. NP_510869.1. |
| UniGene | Hs.370292 Hs.501379 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9P287. 7 interactions. |
PTM databases | |
| PhosphoSite | Q9P287. |
Proteomic databases | |
| PRIDE | Q9P287. |
Genome annotation databases | |
| Ensembl | ENSG00000107949. Homo sapiens. [Contig view] |
| GeneID | 56647. |
| KEGG | hsa:56647. |
Organism-specific databases | |
| GeneCards | GC10P127502. |
| HGNC | HGNC:978. BCCIP. |
| MIM | 611883. gene. |
| PharmGKB | PA25290. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9P287. |
| OMA | Q9P287. LGGRWSF. |
Gene expression databases | |
| ArrayExpress | Q9P287. |
| Bgee | Q9P287. |
| CleanEx | HS_BCCIP. |
| GermOnline | ENSG00000107949. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 62077. |
| SOURCE | Search... |
Entry information
| Entry name | BCCIP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P287 Secondary accession number(s): Q8ND15, Q96GC4, Q9P288 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


