Q9P283 (SEM5B_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Semaphorin-5B | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1151 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | May act as positive axonal guidance cues By similarity. |
| Subcellular location | |
| Sequence similarities | Belongs to the semaphorin family. Contains 1 PSI domain. Contains 1 Sema domain. Contains 5 TSP type-1 domains. |
| Caution | It is uncertain whether Met-1 or Met-59 is the initiator. |
| Sequence caution | The sequence BAA91570.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA95969.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Differentiation Neurogenesis |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Signal-anchor Transmembrane Transmembrane helix |
| Molecular function | Developmental protein |
| PTM | Disulfide bond Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell differentiation Inferred from electronic annotation. Source: UniProtKB-KW nervous system developmentInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | receptor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P283-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P283-2) The sequence of this isoform differs from the canonical sequence as follows: 760-760: Missing. 966-966: Missing. 1032-1151: FNLIHLVATG...SPGQRCFPNS → KRNRTYLMLR...ASPASWALGS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9P283-3) The sequence of this isoform differs from the canonical sequence as follows: 944-964: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9P283-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MLHLSAEEAIGCVRVRRSFIDELAFGRGHSTGTGKQKRRDRVSGSSWCLACVSWM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1151 | 1151 | Semaphorin-5B | PRO_0000032337 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 1036 | 1036 | Extracellular Potential | ||||||||
| Transmembrane | 1037 – 1057 | 21 | Helical; Signal-anchor for type III membrane protein; Potential | ||||||||
| Topological domain | 1058 – 1151 | 94 | Cytoplasmic Potential | ||||||||
| Domain | 103 – 553 | 451 | Sema | ||||||||
| Domain | 664 – 720 | 57 | TSP type-1 1 | ||||||||
| Domain | 722 – 771 | 50 | TSP type-1 2 | ||||||||
| Domain | 853 – 908 | 56 | TSP type-1 3 | ||||||||
| Domain | 910 – 965 | 56 | TSP type-1 4 | ||||||||
| Domain | 966 – 1010 | 45 | TSP type-1 5 | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 153 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 236 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 345 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 436 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 788 | 1 | O-linked (GalNAc...) Potential | ||||||||
| Disulfide bond | 172 ↔ 182 | By similarity | |||||||||
| Disulfide bond | 199 ↔ 208 | By similarity | |||||||||
| Disulfide bond | 322 ↔ 425 | By similarity | |||||||||
| Disulfide bond | 346 ↔ 388 | By similarity | |||||||||
| Disulfide bond | 556 ↔ 573 | By similarity | |||||||||
| Disulfide bond | 565 ↔ 582 | By similarity | |||||||||
| Disulfide bond | 676 ↔ 713 | By similarity | |||||||||
| Disulfide bond | 680 ↔ 719 | By similarity | |||||||||
| Disulfide bond | 691 ↔ 703 | By similarity | |||||||||
| Disulfide bond | 734 ↔ 765 | By similarity | |||||||||
| Disulfide bond | 738 ↔ 770 | By similarity | |||||||||
| Disulfide bond | 749 ↔ 755 | By similarity | |||||||||
| Disulfide bond | 865 ↔ 902 | By similarity | |||||||||
| Disulfide bond | 869 ↔ 907 | By similarity | |||||||||
| Disulfide bond | 880 ↔ 892 | By similarity | |||||||||
| Disulfide bond | 922 ↔ 959 | By similarity | |||||||||
| Disulfide bond | 926 ↔ 964 | By similarity | |||||||||
| Disulfide bond | 937 ↔ 949 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 | 1 | M → MLHLSAEEAIGCVRVRRSFI DELAFGRGHSTGTGKQKRRD RVSGSSWCLACVSWM in isoform 4. | VSP_044748 | |||||||
| Alternative sequence | 760 | 1 | Missing in isoform 2. | VSP_029462 | |||||||
| Alternative sequence | 944 – 964 | 21 | Missing in isoform 3. | VSP_029463 | |||||||
| Alternative sequence | 966 | 1 | Missing in isoform 2. | VSP_029464 | |||||||
| Alternative sequence | 1032 – 1151 | 120 | FNLIH…CFPNS → KRNRTYLMLRSSQPSSTPLQ SLDSFHILLQTAKLCWGPHC FEMGSISSTWWPRASPASWA LGS in isoform 2. | VSP_029465 | |||||||
| Natural variant | 42 | 1 | G → S in a breast cancer sample; somatic mutation. Ref.7 | VAR_037196 | |||||||
| Natural variant | 220 | 1 | I → T. Ref.1 Ref.3 Corresponds to variant rs2276774 [ dbSNP | Ensembl ]. | VAR_037197 | |||||||
| Natural variant | 223 | 1 | I → M in a breast cancer sample; somatic mutation. Ref.7 | VAR_037198 | |||||||
| Natural variant | 742 | 1 | M → T. Ref.3 Corresponds to variant rs2276781 [ dbSNP | Ensembl ]. | VAR_037199 | |||||||
| Natural variant | 840 | 1 | V → D. Ref.1 Ref.3 Ref.6 Corresponds to variant rs2276782 [ dbSNP | Ensembl ]. | VAR_037200 | |||||||
| Natural variant | 996 | 1 | S → P. Corresponds to variant rs35306342 [ dbSNP | Ensembl ]. | VAR_037201 | |||||||
| Natural variant | 1028 | 1 | D → G. Ref.1 Ref.3 Ref.6 Corresponds to variant rs2303983 [ dbSNP | Ensembl ]. | VAR_037202 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 703 | 1 | C → F in AAQ88491. Ref.2 | ||||||||
| Isoform 4: | |||||||||||
| Sequence conflict | 14 | 1 | R → K in BAH12129. Ref.3 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS THR-220; ASP-840 AND GLY-1028. Tissue: Brain. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 935-1151 (ISOFORM 3), VARIANTS THR-220; THR-742; ASP-840 AND GLY-1028. Tissue: Brain and Hippocampus. |
| [4] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ASP-840 AND GLY-1028. Tissue: Ovary. |
| [7] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-42 AND MET-223. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB040878 mRNA. Translation: BAA95969.1. Different initiation. AY358124 mRNA. Translation: AAQ88491.1. AK001234 mRNA. Translation: BAA91570.1. Different initiation. AK291407 mRNA. Translation: BAF84096.1. AK295619 mRNA. Translation: BAH12129.1. AC078794 Genomic DNA. No translation available. AC083797 Genomic DNA. No translation available. AC109130 Genomic DNA. No translation available. CH471052 Genomic DNA. Translation: EAW79457.1. BC077726 mRNA. Translation: AAH77726.1. |
| IPI | IPI00395376. IPI00788999. IPI00945133. IPI01011436. |
| RefSeq | NP_001026872.2. NM_001031702.3. NP_001243275.1. NM_001256346.1. NP_001243276.1. NM_001256347.1. |
| UniGene | Hs.210870. |
3D structure databases | |
| ProteinModelPortal | Q9P283. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-8247359. |
PTM databases | |
| PhosphoSite | Q9P283. |
Polymorphism databases | |
| DMDM | 212276522. |
Proteomic databases | |
| PaxDb | Q9P283. |
| PRIDE | Q9P283. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000357599; ENSP00000350215; ENSG00000082684. ENST00000451055; ENSP00000389588; ENSG00000082684. |
| GeneID | 54437. |
| KEGG | hsa:54437. |
| UCSC | uc003efz.1. human. |
Organism-specific databases | |
| CTD | 54437. |
| GeneCards | GC03M122628. |
| H-InvDB | HIX0020193. |
| HGNC | HGNC:10737. SEMA5B. |
| HPA | HPA017084. |
| MIM | 609298. gene. |
| neXtProt | NX_Q9P283. |
| PharmGKB | PA35659. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG316291. |
| HOVERGEN | HBG062356. |
| InParanoid | Q9P283. |
| KO | K06841. |
| OMA | DSPRPRC. |
| OrthoDB | EOG4DJJVN. |
Gene expression databases | |
| ArrayExpress | Q9P283. |
| Bgee | Q9P283. |
| CleanEx | HS_SEMA5B. |
| Genevestigator | Q9P283. |
| GermOnline | ENSG00000082684. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 1 hit. |
| InterPro | IPR003659. Plexin-like. IPR016201. Plexin-like_fold. IPR002165. Plexin_repeat. IPR027231. Semaphorin. IPR001627. Semaphorin/CD100_Ag. IPR000884. Thrombospondin_1_rpt. IPR015943. WD40/YVTN_repeat-like_dom. [Graphical view] |
| PANTHER | PTHR11036. PTHR11036. 1 hit. |
| Pfam | PF01437. PSI. 1 hit. PF01403. Sema. 1 hit. PF00090. TSP_1. 5 hits. [Graphical view] |
| SMART | SM00423. PSI. 1 hit. SM00630. Sema. 1 hit. SM00209. TSP1. 5 hits. [Graphical view] |
| SUPFAM | SSF103575. Plexin-like_fold. 1 hit. SSF101912. Sema. 1 hit. SSF82895. TSP1. 6 hits. |
| PROSITE | PS51004. SEMA. 1 hit. PS50092. TSP1. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 54437. |
| NextBio | 56654. |
| SOURCE | Search... |
Entry information
| Entry name | SEM5B_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P283 Secondary accession number(s): A8K5U2 Q9NW17 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
