Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Semaphorin-5B

Gene

SEMA5B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

May act as positive axonal guidance cues.By similarity

Caution

It is uncertain whether Met-1 or Met-59 is the initiator.Curated

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processDifferentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiR-HSA-5083635 Defective B3GALTL causes Peters-plus syndrome (PpS)
R-HSA-5173214 O-glycosylation of TSR domain-containing proteins

Names & Taxonomyi

Protein namesi
Recommended name:
Semaphorin-5B
Gene namesi
Name:SEMA5B
Synonyms:KIAA1445, SEMAG
ORF Names:UNQ5867/PRO34001
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000082684.14
HGNCiHGNC:10737 SEMA5B
MIMi609298 gene
neXtProtiNX_Q9P283

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 1036ExtracellularSequence analysisAdd BLAST1036
Transmembranei1037 – 1057Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini1058 – 1151CytoplasmicSequence analysisAdd BLAST94

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi54437
OpenTargetsiENSG00000082684
PharmGKBiPA35659

Polymorphism and mutation databases

BioMutaiSEMA5B
DMDMi212276522

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000323371 – 1151Semaphorin-5BAdd BLAST1151

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi153N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi172 ↔ 182By similarity
Disulfide bondi199 ↔ 208By similarity
Glycosylationi236N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi322 ↔ 425By similarity
Glycosylationi345N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi346 ↔ 388By similarity
Glycosylationi436N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi556 ↔ 573By similarity
Disulfide bondi565 ↔ 582By similarity
Disulfide bondi676 ↔ 713By similarity
Disulfide bondi680 ↔ 719By similarity
Disulfide bondi691 ↔ 703By similarity
Disulfide bondi734 ↔ 765By similarity
Disulfide bondi738 ↔ 770By similarity
Disulfide bondi749 ↔ 755By similarity
Glycosylationi788O-linked (GalNAc...) threonineSequence analysis1
Disulfide bondi865 ↔ 902By similarity
Disulfide bondi869 ↔ 907By similarity
Disulfide bondi880 ↔ 892By similarity
Disulfide bondi922 ↔ 959By similarity
Disulfide bondi926 ↔ 964By similarity
Disulfide bondi937 ↔ 949By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MaxQBiQ9P283
PaxDbiQ9P283
PeptideAtlasiQ9P283
PRIDEiQ9P283

PTM databases

iPTMnetiQ9P283
PhosphoSitePlusiQ9P283

Expressioni

Gene expression databases

BgeeiENSG00000082684
CleanExiHS_SEMA5B
ExpressionAtlasiQ9P283 baseline and differential
GenevisibleiQ9P283 HS

Organism-specific databases

HPAiHPA017084
HPA066548

Interactioni

GO - Molecular functioni

Protein-protein interaction databases

BioGridi119953, 9 interactors
IntActiQ9P283, 8 interactors
MINTiQ9P283
STRINGi9606.ENSP00000350215

Structurei

3D structure databases

ProteinModelPortaliQ9P283
SMRiQ9P283
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini103 – 553SemaPROSITE-ProRule annotationAdd BLAST451
Domaini664 – 720TSP type-1 1PROSITE-ProRule annotationAdd BLAST57
Domaini722 – 771TSP type-1 2PROSITE-ProRule annotationAdd BLAST50
Domaini853 – 908TSP type-1 3PROSITE-ProRule annotationAdd BLAST56
Domaini910 – 965TSP type-1 4PROSITE-ProRule annotationAdd BLAST56
Domaini966 – 1010TSP type-1 5PROSITE-ProRule annotationAdd BLAST45

Sequence similaritiesi

Belongs to the semaphorin family.Curated

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3611 Eukaryota
ENOG410XQZC LUCA
GeneTreeiENSGT00760000119134
HOGENOMiHOG000047106
HOVERGENiHBG062356
InParanoidiQ9P283
KOiK06841
OMAiPEGCPEV
OrthoDBiEOG091G01T5
PhylomeDBiQ9P283
TreeFamiTF329951

Family and domain databases

Gene3Di2.130.10.10, 1 hit
2.20.100.10, 6 hits
InterProiView protein in InterPro
IPR002165 Plexin_repeat
IPR016201 PSI
IPR001627 Semap_dom
IPR036352 Semap_dom_sf
IPR027231 Semaphorin
IPR000884 TSP1_rpt
IPR036383 TSP1_rpt_sf
IPR015943 WD40/YVTN_repeat-like_dom_sf
PANTHERiPTHR11036 PTHR11036, 1 hit
PfamiView protein in Pfam
PF01437 PSI, 1 hit
PF01403 Sema, 1 hit
PF00090 TSP_1, 5 hits
SMARTiView protein in SMART
SM00423 PSI, 1 hit
SM00630 Sema, 1 hit
SM00209 TSP1, 5 hits
SUPFAMiSSF101912 SSF101912, 1 hit
SSF82895 SSF82895, 5 hits
PROSITEiView protein in PROSITE
PS51004 SEMA, 1 hit
PS50092 TSP1, 5 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P283-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPCGFSPSPV AHHLVPGPPD TPAQQLRCGW TVGGWLLSLV RGLLPCLPPG
60 70 80 90 100
ARTAEGPIMV LAGPLAVSLL LPSLTLLVSH LSSSQDVSSE PSSEQQLCAL
110 120 130 140 150
SKHPTVAFED LQPWVSNFTY PGARDFSQLA LDPSGNQLIV GARNYLFRLS
160 170 180 190 200
LANVSLLQAT EWASSEDTRR SCQSKGKTEE ECQNYVRVLI VAGRKVFMCG
210 220 230 240 250
TNAFSPMCTS RQVGNLSRTI EKINGVARCP YDPRHNSTAV ISSQGELYAA
260 270 280 290 300
TVIDFSGRDP AIYRSLGSGP PLRTAQYNSK WLNEPNFVAA YDIGLFAYFF
310 320 330 340 350
LRENAVEHDC GRTVYSRVAR VCKNDVGGRF LLEDTWTTFM KARLNCSRPG
360 370 380 390 400
EVPFYYNELQ SAFHLPEQDL IYGVFTTNVN SIAASAVCAF NLSAISQAFN
410 420 430 440 450
GPFRYQENPR AAWLPIANPI PNFQCGTLPE TGPNENLTER SLQDAQRLFL
460 470 480 490 500
MSEAVQPVTP EPCVTQDSVR FSHLVVDLVQ AKDTLYHVLY IGTESGTILK
510 520 530 540 550
ALSTASRSLH GCYLEELHVL PPGRREPLRS LRILHSARAL FVGLRDGVLR
560 570 580 590 600
VPLERCAAYR SQGACLGARD PYCGWDGKQQ RCSTLEDSSN MSLWTQNITA
610 620 630 640 650
CPVRNVTRDG GFGPWSPWQP CEHLDGDNSG SCLCRARSCD SPRPRCGGLD
660 670 680 690 700
CLGPAIHIAN CSRNGAWTPW SSWALCSTSC GIGFQVRQRS CSNPAPRHGG
710 720 730 740 750
RICVGKSREE RFCNENTPCP VPIFWASWGS WSKCSSNCGG GMQSRRRACE
760 770 780 790 800
NGNSCLGCGV EFKTCNPEGC PEVRRNTPWT PWLPVNVTQG GARQEQRFRF
810 820 830 840 850
TCRAPLADPH GLQFGRRRTE TRTCPADGSG SCDTDALVEV LLRSGSTSPH
860 870 880 890 900
TVSGGWAAWG PWSSCSRDCE LGFRVRKRTC TNPEPRNGGL PCVGDAAEYQ
910 920 930 940 950
DCNPQACPVR GAWSCWTSWS PCSASCGGGH YQRTRSCTSP APSPGEDICL
960 970 980 990 1000
GLHTEEALCA TQACPEGWSP WSEWSKCTDD GAQSRSRHCE ELLPGSSACA
1010 1020 1030 1040 1050
GNSSQSRPCP YSEIPVILPA SSMEEATDCA GFNLIHLVAT GISCFLGSGL
1060 1070 1080 1090 1100
LTLAVYLSCQ HCQRQSQEST LVHPATPNHL HYKGGGTPKN EKYTPMEFKT
1110 1120 1130 1140 1150
LNKNNLIPDD RANFYPLQQT NVYTTTYYPS PLNKHSFRPE ASPGQRCFPN

S
Length:1,151
Mass (Da):125,913
Last modified:November 4, 2008 - v4
Checksum:i96B1D4BC2A1E36C9
GO
Isoform 2 (identifier: Q9P283-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     760-760: Missing.
     966-966: Missing.
     1032-1151: FNLIHLVATG...SPGQRCFPNS → KRNRTYLMLR...ASPASWALGS

Note: No experimental confirmation available.
Show »
Length:1,092
Mass (Da):119,280
Checksum:i3F9AF6108E99CD23
GO
Isoform 3 (identifier: Q9P283-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     944-964: Missing.

Note: No experimental confirmation available.
Show »
Length:1,130
Mass (Da):123,757
Checksum:i20ECAB8D936AE0FA
GO
Isoform 4 (identifier: Q9P283-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLHLSAEEAIGCVRVRRSFIDELAFGRGHSTGTGKQKRRDRVSGSSWCLACVSWM

Note: No experimental confirmation available.Curated
Show »
Length:1,205
Mass (Da):131,904
Checksum:i9EA9AB44CC93588D
GO

Sequence cautioni

The sequence BAA91570 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA95969 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti703C → F in AAQ88491 (PubMed:12975309).Curated1
Isoform 4 (identifier: Q9P283-4)
Sequence conflicti14R → K in BAH12129 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03719642G → S in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs148102705Ensembl.1
Natural variantiVAR_037197220I → T2 PublicationsCorresponds to variant dbSNP:rs2276774Ensembl.1
Natural variantiVAR_037198223I → M in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_037199742M → T1 PublicationCorresponds to variant dbSNP:rs2276781Ensembl.1
Natural variantiVAR_037200840V → D3 PublicationsCorresponds to variant dbSNP:rs2276782Ensembl.1
Natural variantiVAR_037201996S → P. Corresponds to variant dbSNP:rs35306342Ensembl.1
Natural variantiVAR_0372021028D → G3 PublicationsCorresponds to variant dbSNP:rs2303983Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0447481M → MLHLSAEEAIGCVRVRRSFI DELAFGRGHSTGTGKQKRRD RVSGSSWCLACVSWM in isoform 4. 1 Publication1
Alternative sequenceiVSP_029462760Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_029463944 – 964Missing in isoform 3. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_029464966Missing in isoform 2. 1 Publication1
Alternative sequenceiVSP_0294651032 – 1151FNLIH…CFPNS → KRNRTYLMLRSSQPSSTPLQ SLDSFHILLQTAKLCWGPHC FEMGSISSTWWPRASPASWA LGS in isoform 2. 1 PublicationAdd BLAST120

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040878 mRNA Translation: BAA95969.1 Different initiation.
AY358124 mRNA Translation: AAQ88491.1
AK001234 mRNA Translation: BAA91570.1 Different initiation.
AK291407 mRNA Translation: BAF84096.1
AK295619 mRNA Translation: BAH12129.1
AC078794 Genomic DNA No translation available.
AC083797 Genomic DNA No translation available.
AC109130 Genomic DNA No translation available.
CH471052 Genomic DNA Translation: EAW79457.1
BC077726 mRNA Translation: AAH77726.1
CCDSiCCDS35491.1 [Q9P283-1]
CCDS58848.1 [Q9P283-4]
RefSeqiNP_001026872.2, NM_001031702.3 [Q9P283-1]
NP_001243275.1, NM_001256346.1 [Q9P283-1]
NP_001243276.1, NM_001256347.1 [Q9P283-4]
UniGeneiHs.210870

Genome annotation databases

EnsembliENST00000357599; ENSP00000350215; ENSG00000082684 [Q9P283-1]
ENST00000451055; ENSP00000389588; ENSG00000082684 [Q9P283-4]
ENST00000616742; ENSP00000479602; ENSG00000082684 [Q9P283-1]
GeneIDi54437
KEGGihsa:54437
UCSCiuc003efz.3 human [Q9P283-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiSEM5B_HUMAN
AccessioniPrimary (citable) accession number: Q9P283
Secondary accession number(s): A8K5U2
, B7Z393, F8W9U8, Q6DD89, Q6UY12, Q9NW17
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: November 4, 2008
Last modified: March 28, 2018
This is version 147 of the entry and version 4 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health