Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P283

- SEM5B_HUMAN

UniProt

Q9P283 - SEM5B_HUMAN

Protein

Semaphorin-5B

Gene

SEMA5B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 4 (04 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May act as positive axonal guidance cues.By similarity

    GO - Molecular functioni

    1. receptor activity Source: InterPro

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. nervous system development Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Neurogenesis

    Enzyme and pathway databases

    ReactomeiREACT_200626. O-glycosylation of TSR domain-containing proteins.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Semaphorin-5B
    Gene namesi
    Name:SEMA5B
    Synonyms:KIAA1445, SEMAG
    ORF Names:UNQ5867/PRO34001
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:10737. SEMA5B.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35659.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11511151Semaphorin-5BPRO_0000032337Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi153 – 1531N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi172 ↔ 182By similarity
    Disulfide bondi199 ↔ 208By similarity
    Glycosylationi236 – 2361N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi322 ↔ 425By similarity
    Glycosylationi345 – 3451N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi346 ↔ 388By similarity
    Glycosylationi436 – 4361N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi556 ↔ 573By similarity
    Disulfide bondi565 ↔ 582By similarity
    Disulfide bondi676 ↔ 713By similarity
    Disulfide bondi680 ↔ 719By similarity
    Disulfide bondi691 ↔ 703By similarity
    Disulfide bondi734 ↔ 765By similarity
    Disulfide bondi738 ↔ 770By similarity
    Disulfide bondi749 ↔ 755By similarity
    Glycosylationi788 – 7881O-linked (GalNAc...)Sequence Analysis
    Disulfide bondi865 ↔ 902By similarity
    Disulfide bondi869 ↔ 907By similarity
    Disulfide bondi880 ↔ 892By similarity
    Disulfide bondi922 ↔ 959By similarity
    Disulfide bondi926 ↔ 964By similarity
    Disulfide bondi937 ↔ 949By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9P283.
    PRIDEiQ9P283.

    PTM databases

    PhosphoSiteiQ9P283.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9P283.
    BgeeiQ9P283.
    CleanExiHS_SEMA5B.
    GenevestigatoriQ9P283.

    Organism-specific databases

    HPAiHPA017084.

    Interactioni

    Protein-protein interaction databases

    BioGridi119953. 8 interactions.
    IntActiQ9P283. 8 interactions.
    MINTiMINT-8247359.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9P283.
    SMRiQ9P283. Positions 104-592, 608-720, 725-774, 779-907, 911-1015.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 10361036ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini1058 – 115194CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei1037 – 105721Helical; Signal-anchor for type III membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini103 – 553451SemaPROSITE-ProRule annotationAdd
    BLAST
    Domaini664 – 72057TSP type-1 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini722 – 77150TSP type-1 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini853 – 90856TSP type-1 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini910 – 96556TSP type-1 4PROSITE-ProRule annotationAdd
    BLAST
    Domaini966 – 101045TSP type-1 5PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the semaphorin family.Curated
    Contains 1 PSI domain.Curated
    Contains 1 Sema domain.PROSITE-ProRule annotation
    Contains 5 TSP type-1 domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG316291.
    HOVERGENiHBG062356.
    InParanoidiQ9P283.
    KOiK06841.
    OMAiSRSRHCE.
    OrthoDBiEOG7SN8C0.
    PhylomeDBiQ9P283.
    TreeFamiTF329951.

    Family and domain databases

    Gene3Di2.130.10.10. 1 hit.
    InterProiIPR016201. Plexin-like_fold.
    IPR002165. Plexin_repeat.
    IPR001627. Semap_dom.
    IPR027231. Semaphorin.
    IPR000884. Thrombospondin_1_rpt.
    IPR015943. WD40/YVTN_repeat-like_dom.
    [Graphical view]
    PANTHERiPTHR11036. PTHR11036. 1 hit.
    PfamiPF01437. PSI. 1 hit.
    PF01403. Sema. 1 hit.
    PF00090. TSP_1. 5 hits.
    [Graphical view]
    SMARTiSM00423. PSI. 1 hit.
    SM00630. Sema. 1 hit.
    SM00209. TSP1. 5 hits.
    [Graphical view]
    SUPFAMiSSF101912. SSF101912. 1 hit.
    SSF103575. SSF103575. 1 hit.
    SSF82895. SSF82895. 5 hits.
    PROSITEiPS51004. SEMA. 1 hit.
    PS50092. TSP1. 5 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P283-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPCGFSPSPV AHHLVPGPPD TPAQQLRCGW TVGGWLLSLV RGLLPCLPPG     50
    ARTAEGPIMV LAGPLAVSLL LPSLTLLVSH LSSSQDVSSE PSSEQQLCAL 100
    SKHPTVAFED LQPWVSNFTY PGARDFSQLA LDPSGNQLIV GARNYLFRLS 150
    LANVSLLQAT EWASSEDTRR SCQSKGKTEE ECQNYVRVLI VAGRKVFMCG 200
    TNAFSPMCTS RQVGNLSRTI EKINGVARCP YDPRHNSTAV ISSQGELYAA 250
    TVIDFSGRDP AIYRSLGSGP PLRTAQYNSK WLNEPNFVAA YDIGLFAYFF 300
    LRENAVEHDC GRTVYSRVAR VCKNDVGGRF LLEDTWTTFM KARLNCSRPG 350
    EVPFYYNELQ SAFHLPEQDL IYGVFTTNVN SIAASAVCAF NLSAISQAFN 400
    GPFRYQENPR AAWLPIANPI PNFQCGTLPE TGPNENLTER SLQDAQRLFL 450
    MSEAVQPVTP EPCVTQDSVR FSHLVVDLVQ AKDTLYHVLY IGTESGTILK 500
    ALSTASRSLH GCYLEELHVL PPGRREPLRS LRILHSARAL FVGLRDGVLR 550
    VPLERCAAYR SQGACLGARD PYCGWDGKQQ RCSTLEDSSN MSLWTQNITA 600
    CPVRNVTRDG GFGPWSPWQP CEHLDGDNSG SCLCRARSCD SPRPRCGGLD 650
    CLGPAIHIAN CSRNGAWTPW SSWALCSTSC GIGFQVRQRS CSNPAPRHGG 700
    RICVGKSREE RFCNENTPCP VPIFWASWGS WSKCSSNCGG GMQSRRRACE 750
    NGNSCLGCGV EFKTCNPEGC PEVRRNTPWT PWLPVNVTQG GARQEQRFRF 800
    TCRAPLADPH GLQFGRRRTE TRTCPADGSG SCDTDALVEV LLRSGSTSPH 850
    TVSGGWAAWG PWSSCSRDCE LGFRVRKRTC TNPEPRNGGL PCVGDAAEYQ 900
    DCNPQACPVR GAWSCWTSWS PCSASCGGGH YQRTRSCTSP APSPGEDICL 950
    GLHTEEALCA TQACPEGWSP WSEWSKCTDD GAQSRSRHCE ELLPGSSACA 1000
    GNSSQSRPCP YSEIPVILPA SSMEEATDCA GFNLIHLVAT GISCFLGSGL 1050
    LTLAVYLSCQ HCQRQSQEST LVHPATPNHL HYKGGGTPKN EKYTPMEFKT 1100
    LNKNNLIPDD RANFYPLQQT NVYTTTYYPS PLNKHSFRPE ASPGQRCFPN 1150
    S 1151
    Length:1,151
    Mass (Da):125,913
    Last modified:November 4, 2008 - v4
    Checksum:i96B1D4BC2A1E36C9
    GO
    Isoform 2 (identifier: Q9P283-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         760-760: Missing.
         966-966: Missing.
         1032-1151: FNLIHLVATG...SPGQRCFPNS → KRNRTYLMLR...ASPASWALGS

    Note: No experimental confirmation available.

    Show »
    Length:1,092
    Mass (Da):119,280
    Checksum:i3F9AF6108E99CD23
    GO
    Isoform 3 (identifier: Q9P283-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         944-964: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,130
    Mass (Da):123,757
    Checksum:i20ECAB8D936AE0FA
    GO
    Isoform 4 (identifier: Q9P283-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MLHLSAEEAIGCVRVRRSFIDELAFGRGHSTGTGKQKRRDRVSGSSWCLACVSWM

    Note: No experimental confirmation available.Curated

    Show »
    Length:1,205
    Mass (Da):131,904
    Checksum:i9EA9AB44CC93588D
    GO

    Sequence cautioni

    The sequence BAA91570.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA95969.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti703 – 7031C → F in AAQ88491. (PubMed:12975309)Curated
    Isoform 4 (identifier: Q9P283-4)
    Sequence conflicti14 – 141R → K in BAH12129. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti42 – 421G → S in a breast cancer sample; somatic mutation. 1 Publication
    VAR_037196
    Natural varianti220 – 2201I → T.2 Publications
    Corresponds to variant rs2276774 [ dbSNP | Ensembl ].
    VAR_037197
    Natural varianti223 – 2231I → M in a breast cancer sample; somatic mutation. 1 Publication
    VAR_037198
    Natural varianti742 – 7421M → T.1 Publication
    Corresponds to variant rs2276781 [ dbSNP | Ensembl ].
    VAR_037199
    Natural varianti840 – 8401V → D.3 Publications
    Corresponds to variant rs2276782 [ dbSNP | Ensembl ].
    VAR_037200
    Natural varianti996 – 9961S → P.
    Corresponds to variant rs35306342 [ dbSNP | Ensembl ].
    VAR_037201
    Natural varianti1028 – 10281D → G.3 Publications
    Corresponds to variant rs2303983 [ dbSNP | Ensembl ].
    VAR_037202

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MLHLSAEEAIGCVRVRRSFI DELAFGRGHSTGTGKQKRRD RVSGSSWCLACVSWM in isoform 4. 1 PublicationVSP_044748
    Alternative sequencei760 – 7601Missing in isoform 2. 1 PublicationVSP_029462
    Alternative sequencei944 – 96421Missing in isoform 3. 1 PublicationVSP_029463Add
    BLAST
    Alternative sequencei966 – 9661Missing in isoform 2. 1 PublicationVSP_029464
    Alternative sequencei1032 – 1151120FNLIH…CFPNS → KRNRTYLMLRSSQPSSTPLQ SLDSFHILLQTAKLCWGPHC FEMGSISSTWWPRASPASWA LGS in isoform 2. 1 PublicationVSP_029465Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB040878 mRNA. Translation: BAA95969.1. Different initiation.
    AY358124 mRNA. Translation: AAQ88491.1.
    AK001234 mRNA. Translation: BAA91570.1. Different initiation.
    AK291407 mRNA. Translation: BAF84096.1.
    AK295619 mRNA. Translation: BAH12129.1.
    AC078794 Genomic DNA. No translation available.
    AC083797 Genomic DNA. No translation available.
    AC109130 Genomic DNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW79457.1.
    BC077726 mRNA. Translation: AAH77726.1.
    CCDSiCCDS35491.1. [Q9P283-1]
    CCDS58848.1. [Q9P283-4]
    RefSeqiNP_001026872.2. NM_001031702.3. [Q9P283-1]
    NP_001243275.1. NM_001256346.1. [Q9P283-1]
    NP_001243276.1. NM_001256347.1. [Q9P283-4]
    UniGeneiHs.210870.

    Genome annotation databases

    EnsembliENST00000357599; ENSP00000350215; ENSG00000082684. [Q9P283-1]
    ENST00000451055; ENSP00000389588; ENSG00000082684. [Q9P283-4]
    GeneIDi54437.
    KEGGihsa:54437.
    UCSCiuc003efz.2. human. [Q9P283-1]

    Polymorphism databases

    DMDMi212276522.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB040878 mRNA. Translation: BAA95969.1 . Different initiation.
    AY358124 mRNA. Translation: AAQ88491.1 .
    AK001234 mRNA. Translation: BAA91570.1 . Different initiation.
    AK291407 mRNA. Translation: BAF84096.1 .
    AK295619 mRNA. Translation: BAH12129.1 .
    AC078794 Genomic DNA. No translation available.
    AC083797 Genomic DNA. No translation available.
    AC109130 Genomic DNA. No translation available.
    CH471052 Genomic DNA. Translation: EAW79457.1 .
    BC077726 mRNA. Translation: AAH77726.1 .
    CCDSi CCDS35491.1. [Q9P283-1 ]
    CCDS58848.1. [Q9P283-4 ]
    RefSeqi NP_001026872.2. NM_001031702.3. [Q9P283-1 ]
    NP_001243275.1. NM_001256346.1. [Q9P283-1 ]
    NP_001243276.1. NM_001256347.1. [Q9P283-4 ]
    UniGenei Hs.210870.

    3D structure databases

    ProteinModelPortali Q9P283.
    SMRi Q9P283. Positions 104-592, 608-720, 725-774, 779-907, 911-1015.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119953. 8 interactions.
    IntActi Q9P283. 8 interactions.
    MINTi MINT-8247359.

    PTM databases

    PhosphoSitei Q9P283.

    Polymorphism databases

    DMDMi 212276522.

    Proteomic databases

    PaxDbi Q9P283.
    PRIDEi Q9P283.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000357599 ; ENSP00000350215 ; ENSG00000082684 . [Q9P283-1 ]
    ENST00000451055 ; ENSP00000389588 ; ENSG00000082684 . [Q9P283-4 ]
    GeneIDi 54437.
    KEGGi hsa:54437.
    UCSCi uc003efz.2. human. [Q9P283-1 ]

    Organism-specific databases

    CTDi 54437.
    GeneCardsi GC03M122628.
    H-InvDB HIX0020193.
    HGNCi HGNC:10737. SEMA5B.
    HPAi HPA017084.
    MIMi 609298. gene.
    neXtProti NX_Q9P283.
    PharmGKBi PA35659.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG316291.
    HOVERGENi HBG062356.
    InParanoidi Q9P283.
    KOi K06841.
    OMAi SRSRHCE.
    OrthoDBi EOG7SN8C0.
    PhylomeDBi Q9P283.
    TreeFami TF329951.

    Enzyme and pathway databases

    Reactomei REACT_200626. O-glycosylation of TSR domain-containing proteins.

    Miscellaneous databases

    GenomeRNAii 54437.
    NextBioi 56654.
    PROi Q9P283.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9P283.
    Bgeei Q9P283.
    CleanExi HS_SEMA5B.
    Genevestigatori Q9P283.

    Family and domain databases

    Gene3Di 2.130.10.10. 1 hit.
    InterProi IPR016201. Plexin-like_fold.
    IPR002165. Plexin_repeat.
    IPR001627. Semap_dom.
    IPR027231. Semaphorin.
    IPR000884. Thrombospondin_1_rpt.
    IPR015943. WD40/YVTN_repeat-like_dom.
    [Graphical view ]
    PANTHERi PTHR11036. PTHR11036. 1 hit.
    Pfami PF01437. PSI. 1 hit.
    PF01403. Sema. 1 hit.
    PF00090. TSP_1. 5 hits.
    [Graphical view ]
    SMARTi SM00423. PSI. 1 hit.
    SM00630. Sema. 1 hit.
    SM00209. TSP1. 5 hits.
    [Graphical view ]
    SUPFAMi SSF101912. SSF101912. 1 hit.
    SSF103575. SSF103575. 1 hit.
    SSF82895. SSF82895. 5 hits.
    PROSITEi PS51004. SEMA. 1 hit.
    PS50092. TSP1. 5 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS THR-220; ASP-840 AND GLY-1028.
      Tissue: Brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 935-1151 (ISOFORM 3), VARIANTS THR-220; THR-742; ASP-840 AND GLY-1028.
      Tissue: Brain and Hippocampus.
    4. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ASP-840 AND GLY-1028.
      Tissue: Ovary.
    7. Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-42 AND MET-223.

    Entry informationi

    Entry nameiSEM5B_HUMAN
    AccessioniPrimary (citable) accession number: Q9P283
    Secondary accession number(s): A8K5U2
    , B7Z393, F8W9U8, Q6DD89, Q6UY12, Q9NW17
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 10, 2003
    Last sequence update: November 4, 2008
    Last modified: October 1, 2014
    This is version 115 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3