SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P283

- SEM5B_HUMAN

UniProt

Q9P283 - SEM5B_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Semaphorin-5B
Gene
SEMA5B, KIAA1445, SEMAG, UNQ5867/PRO34001
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

May act as positive axonal guidance cues By similarity.

GO - Molecular functioni

  1. receptor activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. nervous system development Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Neurogenesis

Enzyme and pathway databases

ReactomeiREACT_200626. O-glycosylation of TSR domain-containing proteins.

Names & Taxonomyi

Protein namesi
Recommended name:
Semaphorin-5B
Gene namesi
Name:SEMA5B
Synonyms:KIAA1445, SEMAG
ORF Names:UNQ5867/PRO34001
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:10737. SEMA5B.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 10361036Extracellular Reviewed prediction
Add
BLAST
Transmembranei1037 – 105721Helical; Signal-anchor for type III membrane protein; Reviewed prediction
Add
BLAST
Topological domaini1058 – 115194Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35659.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11511151Semaphorin-5B
PRO_0000032337Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi153 – 1531N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi172 ↔ 182 By similarity
Disulfide bondi199 ↔ 208 By similarity
Glycosylationi236 – 2361N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi322 ↔ 425 By similarity
Glycosylationi345 – 3451N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi346 ↔ 388 By similarity
Glycosylationi436 – 4361N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi556 ↔ 573 By similarity
Disulfide bondi565 ↔ 582 By similarity
Disulfide bondi676 ↔ 713 By similarity
Disulfide bondi680 ↔ 719 By similarity
Disulfide bondi691 ↔ 703 By similarity
Disulfide bondi734 ↔ 765 By similarity
Disulfide bondi738 ↔ 770 By similarity
Disulfide bondi749 ↔ 755 By similarity
Glycosylationi788 – 7881O-linked (GalNAc...) Reviewed prediction
Disulfide bondi865 ↔ 902 By similarity
Disulfide bondi869 ↔ 907 By similarity
Disulfide bondi880 ↔ 892 By similarity
Disulfide bondi922 ↔ 959 By similarity
Disulfide bondi926 ↔ 964 By similarity
Disulfide bondi937 ↔ 949 By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9P283.
PRIDEiQ9P283.

PTM databases

PhosphoSiteiQ9P283.

Expressioni

Gene expression databases

ArrayExpressiQ9P283.
BgeeiQ9P283.
CleanExiHS_SEMA5B.
GenevestigatoriQ9P283.

Organism-specific databases

HPAiHPA017084.

Interactioni

Protein-protein interaction databases

BioGridi119953. 8 interactions.
IntActiQ9P283. 8 interactions.
MINTiMINT-8247359.

Structurei

3D structure databases

ProteinModelPortaliQ9P283.
SMRiQ9P283. Positions 104-592, 608-720, 725-774, 779-907, 911-1015.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini103 – 553451Sema
Add
BLAST
Domaini664 – 72057TSP type-1 1
Add
BLAST
Domaini722 – 77150TSP type-1 2
Add
BLAST
Domaini853 – 90856TSP type-1 3
Add
BLAST
Domaini910 – 96556TSP type-1 4
Add
BLAST
Domaini966 – 101045TSP type-1 5
Add
BLAST

Sequence similaritiesi

Belongs to the semaphorin family.
Contains 1 PSI domain.
Contains 1 Sema domain.
Contains 5 TSP type-1 domains.

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG316291.
HOVERGENiHBG062356.
InParanoidiQ9P283.
KOiK06841.
OMAiSRSRHCE.
OrthoDBiEOG7SN8C0.
PhylomeDBiQ9P283.
TreeFamiTF329951.

Family and domain databases

Gene3Di2.130.10.10. 1 hit.
InterProiIPR016201. Plexin-like_fold.
IPR002165. Plexin_repeat.
IPR001627. Semap_dom.
IPR027231. Semaphorin.
IPR000884. Thrombospondin_1_rpt.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view]
PANTHERiPTHR11036. PTHR11036. 1 hit.
PfamiPF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF00090. TSP_1. 5 hits.
[Graphical view]
SMARTiSM00423. PSI. 1 hit.
SM00630. Sema. 1 hit.
SM00209. TSP1. 5 hits.
[Graphical view]
SUPFAMiSSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 1 hit.
SSF82895. SSF82895. 5 hits.
PROSITEiPS51004. SEMA. 1 hit.
PS50092. TSP1. 5 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P283-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPCGFSPSPV AHHLVPGPPD TPAQQLRCGW TVGGWLLSLV RGLLPCLPPG     50
ARTAEGPIMV LAGPLAVSLL LPSLTLLVSH LSSSQDVSSE PSSEQQLCAL 100
SKHPTVAFED LQPWVSNFTY PGARDFSQLA LDPSGNQLIV GARNYLFRLS 150
LANVSLLQAT EWASSEDTRR SCQSKGKTEE ECQNYVRVLI VAGRKVFMCG 200
TNAFSPMCTS RQVGNLSRTI EKINGVARCP YDPRHNSTAV ISSQGELYAA 250
TVIDFSGRDP AIYRSLGSGP PLRTAQYNSK WLNEPNFVAA YDIGLFAYFF 300
LRENAVEHDC GRTVYSRVAR VCKNDVGGRF LLEDTWTTFM KARLNCSRPG 350
EVPFYYNELQ SAFHLPEQDL IYGVFTTNVN SIAASAVCAF NLSAISQAFN 400
GPFRYQENPR AAWLPIANPI PNFQCGTLPE TGPNENLTER SLQDAQRLFL 450
MSEAVQPVTP EPCVTQDSVR FSHLVVDLVQ AKDTLYHVLY IGTESGTILK 500
ALSTASRSLH GCYLEELHVL PPGRREPLRS LRILHSARAL FVGLRDGVLR 550
VPLERCAAYR SQGACLGARD PYCGWDGKQQ RCSTLEDSSN MSLWTQNITA 600
CPVRNVTRDG GFGPWSPWQP CEHLDGDNSG SCLCRARSCD SPRPRCGGLD 650
CLGPAIHIAN CSRNGAWTPW SSWALCSTSC GIGFQVRQRS CSNPAPRHGG 700
RICVGKSREE RFCNENTPCP VPIFWASWGS WSKCSSNCGG GMQSRRRACE 750
NGNSCLGCGV EFKTCNPEGC PEVRRNTPWT PWLPVNVTQG GARQEQRFRF 800
TCRAPLADPH GLQFGRRRTE TRTCPADGSG SCDTDALVEV LLRSGSTSPH 850
TVSGGWAAWG PWSSCSRDCE LGFRVRKRTC TNPEPRNGGL PCVGDAAEYQ 900
DCNPQACPVR GAWSCWTSWS PCSASCGGGH YQRTRSCTSP APSPGEDICL 950
GLHTEEALCA TQACPEGWSP WSEWSKCTDD GAQSRSRHCE ELLPGSSACA 1000
GNSSQSRPCP YSEIPVILPA SSMEEATDCA GFNLIHLVAT GISCFLGSGL 1050
LTLAVYLSCQ HCQRQSQEST LVHPATPNHL HYKGGGTPKN EKYTPMEFKT 1100
LNKNNLIPDD RANFYPLQQT NVYTTTYYPS PLNKHSFRPE ASPGQRCFPN 1150
S 1151
Length:1,151
Mass (Da):125,913
Last modified:November 4, 2008 - v4
Checksum:i96B1D4BC2A1E36C9
GO
Isoform 2 (identifier: Q9P283-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     760-760: Missing.
     966-966: Missing.
     1032-1151: FNLIHLVATG...SPGQRCFPNS → KRNRTYLMLR...ASPASWALGS

Note: No experimental confirmation available.

Show »
Length:1,092
Mass (Da):119,280
Checksum:i3F9AF6108E99CD23
GO
Isoform 3 (identifier: Q9P283-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     944-964: Missing.

Note: No experimental confirmation available.

Show »
Length:1,130
Mass (Da):123,757
Checksum:i20ECAB8D936AE0FA
GO
Isoform 4 (identifier: Q9P283-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MLHLSAEEAIGCVRVRRSFIDELAFGRGHSTGTGKQKRRDRVSGSSWCLACVSWM

Note: No experimental confirmation available.

Show »
Length:1,205
Mass (Da):131,904
Checksum:i9EA9AB44CC93588D
GO

Sequence cautioni

The sequence BAA91570.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA95969.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti42 – 421G → S in a breast cancer sample; somatic mutation. 1 Publication
VAR_037196
Natural varianti220 – 2201I → T.2 Publications
Corresponds to variant rs2276774 [ dbSNP | Ensembl ].
VAR_037197
Natural varianti223 – 2231I → M in a breast cancer sample; somatic mutation. 1 Publication
VAR_037198
Natural varianti742 – 7421M → T.1 Publication
Corresponds to variant rs2276781 [ dbSNP | Ensembl ].
VAR_037199
Natural varianti840 – 8401V → D.3 Publications
Corresponds to variant rs2276782 [ dbSNP | Ensembl ].
VAR_037200
Natural varianti996 – 9961S → P.
Corresponds to variant rs35306342 [ dbSNP | Ensembl ].
VAR_037201
Natural varianti1028 – 10281D → G.3 Publications
Corresponds to variant rs2303983 [ dbSNP | Ensembl ].
VAR_037202

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MLHLSAEEAIGCVRVRRSFI DELAFGRGHSTGTGKQKRRD RVSGSSWCLACVSWM in isoform 4.
VSP_044748
Alternative sequencei760 – 7601Missing in isoform 2.
VSP_029462
Alternative sequencei944 – 96421Missing in isoform 3.
VSP_029463Add
BLAST
Alternative sequencei966 – 9661Missing in isoform 2.
VSP_029464
Alternative sequencei1032 – 1151120FNLIH…CFPNS → KRNRTYLMLRSSQPSSTPLQ SLDSFHILLQTAKLCWGPHC FEMGSISSTWWPRASPASWA LGS in isoform 2.
VSP_029465Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti703 – 7031C → F in AAQ88491. 1 Publication
Isoform 4 (identifier: Q9P283-4)
Sequence conflicti14 – 141R → K in BAH12129. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB040878 mRNA. Translation: BAA95969.1. Different initiation.
AY358124 mRNA. Translation: AAQ88491.1.
AK001234 mRNA. Translation: BAA91570.1. Different initiation.
AK291407 mRNA. Translation: BAF84096.1.
AK295619 mRNA. Translation: BAH12129.1.
AC078794 Genomic DNA. No translation available.
AC083797 Genomic DNA. No translation available.
AC109130 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW79457.1.
BC077726 mRNA. Translation: AAH77726.1.
CCDSiCCDS35491.1. [Q9P283-1]
CCDS58848.1. [Q9P283-4]
RefSeqiNP_001026872.2. NM_001031702.3. [Q9P283-1]
NP_001243275.1. NM_001256346.1. [Q9P283-1]
NP_001243276.1. NM_001256347.1. [Q9P283-4]
UniGeneiHs.210870.

Genome annotation databases

EnsembliENST00000357599; ENSP00000350215; ENSG00000082684. [Q9P283-1]
ENST00000451055; ENSP00000389588; ENSG00000082684. [Q9P283-4]
GeneIDi54437.
KEGGihsa:54437.
UCSCiuc003efz.2. human. [Q9P283-1]

Polymorphism databases

DMDMi212276522.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB040878 mRNA. Translation: BAA95969.1 . Different initiation.
AY358124 mRNA. Translation: AAQ88491.1 .
AK001234 mRNA. Translation: BAA91570.1 . Different initiation.
AK291407 mRNA. Translation: BAF84096.1 .
AK295619 mRNA. Translation: BAH12129.1 .
AC078794 Genomic DNA. No translation available.
AC083797 Genomic DNA. No translation available.
AC109130 Genomic DNA. No translation available.
CH471052 Genomic DNA. Translation: EAW79457.1 .
BC077726 mRNA. Translation: AAH77726.1 .
CCDSi CCDS35491.1. [Q9P283-1 ]
CCDS58848.1. [Q9P283-4 ]
RefSeqi NP_001026872.2. NM_001031702.3. [Q9P283-1 ]
NP_001243275.1. NM_001256346.1. [Q9P283-1 ]
NP_001243276.1. NM_001256347.1. [Q9P283-4 ]
UniGenei Hs.210870.

3D structure databases

ProteinModelPortali Q9P283.
SMRi Q9P283. Positions 104-592, 608-720, 725-774, 779-907, 911-1015.
ModBasei Search...

Protein-protein interaction databases

BioGridi 119953. 8 interactions.
IntActi Q9P283. 8 interactions.
MINTi MINT-8247359.

PTM databases

PhosphoSitei Q9P283.

Polymorphism databases

DMDMi 212276522.

Proteomic databases

PaxDbi Q9P283.
PRIDEi Q9P283.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000357599 ; ENSP00000350215 ; ENSG00000082684 . [Q9P283-1 ]
ENST00000451055 ; ENSP00000389588 ; ENSG00000082684 . [Q9P283-4 ]
GeneIDi 54437.
KEGGi hsa:54437.
UCSCi uc003efz.2. human. [Q9P283-1 ]

Organism-specific databases

CTDi 54437.
GeneCardsi GC03M122628.
H-InvDB HIX0020193.
HGNCi HGNC:10737. SEMA5B.
HPAi HPA017084.
MIMi 609298. gene.
neXtProti NX_Q9P283.
PharmGKBi PA35659.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG316291.
HOVERGENi HBG062356.
InParanoidi Q9P283.
KOi K06841.
OMAi SRSRHCE.
OrthoDBi EOG7SN8C0.
PhylomeDBi Q9P283.
TreeFami TF329951.

Enzyme and pathway databases

Reactomei REACT_200626. O-glycosylation of TSR domain-containing proteins.

Miscellaneous databases

GenomeRNAii 54437.
NextBioi 56654.
PROi Q9P283.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9P283.
Bgeei Q9P283.
CleanExi HS_SEMA5B.
Genevestigatori Q9P283.

Family and domain databases

Gene3Di 2.130.10.10. 1 hit.
InterProi IPR016201. Plexin-like_fold.
IPR002165. Plexin_repeat.
IPR001627. Semap_dom.
IPR027231. Semaphorin.
IPR000884. Thrombospondin_1_rpt.
IPR015943. WD40/YVTN_repeat-like_dom.
[Graphical view ]
PANTHERi PTHR11036. PTHR11036. 1 hit.
Pfami PF01437. PSI. 1 hit.
PF01403. Sema. 1 hit.
PF00090. TSP_1. 5 hits.
[Graphical view ]
SMARTi SM00423. PSI. 1 hit.
SM00630. Sema. 1 hit.
SM00209. TSP1. 5 hits.
[Graphical view ]
SUPFAMi SSF101912. SSF101912. 1 hit.
SSF103575. SSF103575. 1 hit.
SSF82895. SSF82895. 5 hits.
PROSITEi PS51004. SEMA. 1 hit.
PS50092. TSP1. 5 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS THR-220; ASP-840 AND GLY-1028.
    Tissue: Brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 935-1151 (ISOFORM 3), VARIANTS THR-220; THR-742; ASP-840 AND GLY-1028.
    Tissue: Brain and Hippocampus.
  4. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS ASP-840 AND GLY-1028.
    Tissue: Ovary.
  7. Cited for: VARIANTS [LARGE SCALE ANALYSIS] SER-42 AND MET-223.

Entry informationi

Entry nameiSEM5B_HUMAN
AccessioniPrimary (citable) accession number: Q9P283
Secondary accession number(s): A8K5U2
, B7Z393, F8W9U8, Q6DD89, Q6UY12, Q9NW17
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 10, 2003
Last sequence update: November 4, 2008
Last modified: September 3, 2014
This is version 114 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi