Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P278

- FNIP2_HUMAN

UniProt

Q9P278 - FNIP2_HUMAN

Protein

Folliculin-interacting protein 2

Gene

FNIP2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 80 (01 Oct 2014)
      Sequence version 2 (26 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May play a role in the signal transduction pathway of apoptosis induced by O6-methylguanine-mispaired lesions By similarity. May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways. May regulate phosphorylation of RPS6KB1.By similarity2 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. intrinsic apoptotic signaling pathway in response to DNA damage Source: UniProtKB
    2. negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
    3. positive regulation of peptidyl-serine phosphorylation Source: UniProtKB
    4. protein phosphorylation Source: UniProtKB
    5. regulation of protein phosphorylation Source: UniProtKB

    Keywords - Biological processi

    DNA damage

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Folliculin-interacting protein 2
    Alternative name(s):
    FNIP1-like protein
    O6-methylguanine-induced apoptosis 1 protein
    Gene namesi
    Name:FNIP2
    Synonyms:FNIPL, KIAA1450, MAPO1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 4

    Organism-specific databases

    HGNCiHGNC:29280. FNIP2.

    Subcellular locationi

    Cytoplasm 3 Publications
    Note: Colocalizes with FLCN in the cytoplasm.

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB
    2. microtubule organizing center Source: HPA
    3. nucleus Source: HPA
    4. plasma membrane Source: HPA

    Keywords - Cellular componenti

    Cytoplasm

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162388758.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11141114Folliculin-interacting protein 2PRO_0000320553Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei723 – 7231Phosphoserine2 Publications
    Modified residuei726 – 7261Phosphoserine2 Publications

    Post-translational modificationi

    Phosphorylated by AMPK.2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9P278.
    PaxDbiQ9P278.
    PRIDEiQ9P278.

    PTM databases

    PhosphoSiteiQ9P278.

    Expressioni

    Tissue specificityi

    Widely expressed with highest levels in muscle, nasal mucosa, salivary gland, uvula, fat, liver, heart, placenta and pancreas. Moderately expressed in the lung, small intestine, kidney and brain. Lower levels detected in renal cell carcinoma than in normal kidney tissue. Higher levels detected in oncocytoma than in normal kidney.2 Publications

    Gene expression databases

    ArrayExpressiQ9P278.
    BgeeiQ9P278.
    CleanExiHS_FNIP2.
    GenevestigatoriQ9P278.

    Organism-specific databases

    HPAiHPA042779.
    HPA052758.

    Interactioni

    Subunit structurei

    Forms homomultimers and heteromultimers with FNIP1. Interacts (via C-terminus) with FLCN (via C-terminus). Phosphorylated FLCN is preferentially bound. Interacts with PRKAA1, PRKAB1 and PRKAG1 subunits of 5'-AMP-activated protein kinase.2 Publications

    Protein-protein interaction databases

    IntActiQ9P278. 1 interaction.
    MINTiMINT-7298240.
    STRINGi9606.ENSP00000264433.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9P278.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni544 – 911368Interaction with PRKAA1Add
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi95 – 11622Ser-richAdd
    BLAST
    Compositional biasi242 – 26524Ser-richAdd
    BLAST

    Sequence similaritiesi

    Belongs to the FNIP family.Curated

    Phylogenomic databases

    eggNOGiNOG330489.
    HOGENOMiHOG000112624.
    HOVERGENiHBG059425.
    InParanoidiQ9P278.
    OMAiENQLTWS.
    OrthoDBiEOG7JMGCQ.
    PhylomeDBiQ9P278.
    TreeFamiTF324090.

    Family and domain databases

    InterProiIPR028086. FNIP_C_dom.
    IPR026156. FNIP_fam.
    IPR028085. FNIP_mid_dom.
    IPR028084. FNIP_N_dom.
    [Graphical view]
    PANTHERiPTHR21634. PTHR21634. 1 hit.
    PfamiPF14638. FNIP_C. 1 hit.
    PF14637. FNIP_M. 1 hit.
    PF14636. FNIP_N. 1 hit.
    [Graphical view]
    PRINTSiPR02073. FOLLICULNIP1.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P278-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAPTLLQKLF NKRGSSGSSA AASAQGRAPK EGPAFSWSCS EFDLNEIRLI     50
    VYQDCDRRGR QVLFDSKAVQ KIEEVTAQKT EDVPIKISAK CCQGSSSVSS 100
    SSSSSISSHS SSGGSSHHAK EQLPKYQYTR PASDVNMLGE MMFGSVAMSY 150
    KGSTLKIHYI RSPPQLMISK VFSARMGSFC GSTNNLQDSF EYINQDPNLG 200
    KLNTNQNSLG PCRTGSNLAH STPVDMPSRG QNEDRDSGIA RSASLSSLLI 250
    TPFPSPSSST SSSSSYQRRW LRSQTTSLEN GIIPRRSTDE TFSLAEETCS 300
    SNPAMVRRKK IAISIIFSLC EKEEAQRNFQ DFFFSHFPLF ESHMNRLKSA 350
    IEKAMISCRK IAESSLRVQF YVSRLMEALG EFRGTIWNLY SVPRIAEPVW 400
    LTMMSGTLEK NQLCQRFLKE FTLLIEQINK NQFFAALLTA VLTYHLAWVP 450
    TVMPVDHPPI KAFSEKRTSQ SVNMLAKTHP YNPLWAQLGD LYGAIGSPVR 500
    LTRTVVVGKQ KDLVQRILYV LTYFLRCSEL QENQLTWSGN HGEGDQVLNG 550
    SKIITALEKG EVEESEYVVI TVRNEPALVP PILPPTAAER HNPWPTGFPE 600
    CPEGTDSRDL GLKPDKEANR RPEQGSEACS AGCLGPASDA SWKPQNAFCG 650
    DEKNKEAPQD GSSRLPSCEV LGAGMKMDQQ AVCELLKVEM PTRLPDRSVA 700
    WPCPDRHLRE KPSLEKVTFQ IGSFASPESD FESRMKKMEE RVKACGPSLE 750
    ASEAADVAQD PQVSRSPFKP GFQENVCCPQ NRLSEGDEGE SDKGFAEDRG 800
    SRNDMAADIA GQLSHAADLG TASHGAGGTG GRRLEATRGL YVKAAEGPVL 850
    EPVAPRCVQR GPGLVAGANI PCGDDNKKAN FRTEGDIPRN ESSDSALGDS 900
    DDEACASAML DLGHGGDRTG GSLEVELPLP RSQSISTQNV RNFGRSLLAG 950
    YCPTYMPDLV LHGTGSDEKL KQCLVADLVH TVHHPVLDEP IAEAVCIIAD 1000
    TDKWSVQVAT SQRKVTDNMK LGQDVLVSSQ VSSLLQSILQ LYKLHLPADF 1050
    CIMHLEDRLQ EMYLKSKMLS EYLRGHTRVH VKELGVVLGI ESNDLPLLTA 1100
    IASTHSPYVA QILL 1114
    Length:1,114
    Mass (Da):122,115
    Last modified:February 26, 2008 - v2
    Checksum:i8951340C11EE0D5B
    GO
    Isoform 2 (identifier: Q9P278-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-35: MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAF → MCGGTANTTN...RSTDHTELDN

    Show »
    Length:1,137
    Mass (Da):124,860
    Checksum:iEE3CE381023899EC
    GO

    Sequence cautioni

    The sequence AAH16638.1 differs from that shown. Reason: Potential poly-A sequence.
    The sequence AAH07861.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAA95974.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAB14338.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti298 – 2981T → S.
    Corresponds to variant rs2276938 [ dbSNP | Ensembl ].
    VAR_045612

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3535MAPTL…EGPAF → MCGGTANTTNQPESWQDSAR CVSDAVPGAGRIYRALLCTK IKKHTGVDRSTDHTELDN in isoform 2. 1 PublicationVSP_031656Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB040883 mRNA. Translation: BAA95974.1. Different initiation.
    BC007861 mRNA. Translation: AAH07861.1. Different initiation.
    BC016638 mRNA. Translation: AAH16638.1. Sequence problems.
    AK022968 mRNA. Translation: BAB14338.1. Different initiation.
    CCDSiCCDS47155.1. [Q9P278-1]
    RefSeqiNP_065891.1. NM_020840.1. [Q9P278-1]
    XP_005263216.1. XM_005263159.1. [Q9P278-2]
    UniGeneiHs.652441.
    Hs.731810.

    Genome annotation databases

    EnsembliENST00000264433; ENSP00000264433; ENSG00000052795. [Q9P278-1]
    GeneIDi57600.
    KEGGihsa:57600.
    UCSCiuc003iqe.4. human. [Q9P278-1]

    Polymorphism databases

    DMDMi189035874.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB040883 mRNA. Translation: BAA95974.1 . Different initiation.
    BC007861 mRNA. Translation: AAH07861.1 . Different initiation.
    BC016638 mRNA. Translation: AAH16638.1 . Sequence problems.
    AK022968 mRNA. Translation: BAB14338.1 . Different initiation.
    CCDSi CCDS47155.1. [Q9P278-1 ]
    RefSeqi NP_065891.1. NM_020840.1. [Q9P278-1 ]
    XP_005263216.1. XM_005263159.1. [Q9P278-2 ]
    UniGenei Hs.652441.
    Hs.731810.

    3D structure databases

    ProteinModelPortali Q9P278.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q9P278. 1 interaction.
    MINTi MINT-7298240.
    STRINGi 9606.ENSP00000264433.

    PTM databases

    PhosphoSitei Q9P278.

    Polymorphism databases

    DMDMi 189035874.

    Proteomic databases

    MaxQBi Q9P278.
    PaxDbi Q9P278.
    PRIDEi Q9P278.

    Protocols and materials databases

    DNASUi 57600.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264433 ; ENSP00000264433 ; ENSG00000052795 . [Q9P278-1 ]
    GeneIDi 57600.
    KEGGi hsa:57600.
    UCSCi uc003iqe.4. human. [Q9P278-1 ]

    Organism-specific databases

    CTDi 57600.
    GeneCardsi GC04P159690.
    HGNCi HGNC:29280. FNIP2.
    HPAi HPA042779.
    HPA052758.
    MIMi 612768. gene.
    neXtProti NX_Q9P278.
    PharmGKBi PA162388758.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG330489.
    HOGENOMi HOG000112624.
    HOVERGENi HBG059425.
    InParanoidi Q9P278.
    OMAi ENQLTWS.
    OrthoDBi EOG7JMGCQ.
    PhylomeDBi Q9P278.
    TreeFami TF324090.

    Miscellaneous databases

    ChiTaRSi FNIP2. human.
    GenomeRNAii 57600.
    NextBioi 64218.
    PROi Q9P278.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9P278.
    Bgeei Q9P278.
    CleanExi HS_FNIP2.
    Genevestigatori Q9P278.

    Family and domain databases

    InterProi IPR028086. FNIP_C_dom.
    IPR026156. FNIP_fam.
    IPR028085. FNIP_mid_dom.
    IPR028084. FNIP_N_dom.
    [Graphical view ]
    PANTHERi PTHR21634. PTHR21634. 1 hit.
    Pfami PF14638. FNIP_C. 1 hit.
    PF14637. FNIP_M. 1 hit.
    PF14636. FNIP_N. 1 hit.
    [Graphical view ]
    PRINTSi PR02073. FOLLICULNIP1.
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-650 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 787-983 (ISOFORM 1).
      Tissue: Lymph and Uterus.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 663-1114 (ISOFORM 1).
    4. "Identification and characterization of a novel folliculin-interacting protein FNIP2."
      Hasumi H., Baba M., Hong S.-B., Hasumi Y., Huang Y., Yao M., Valera V.A., Linehan W.M., Schmidt L.S.
      Gene 415:60-67(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBUNIT, INTERACTION WITH FLCN; PRKAA1; PRKAB1 AND PRKAG1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    5. "Interaction of folliculin (Birt-Hogg-Dube gene product) with a novel Fnip1-like (FnipL/Fnip2) protein."
      Takagi Y., Kobayashi T., Shiono M., Wang L., Piao X., Sun G., Zhang D., Abe M., Hagiwara Y., Takahashi K., Hino O.
      Oncogene 27:5339-5347(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH FLCN AND PRKAA1, TISSUE SPECIFICITY, PHOSPHORYLATION.
    6. "A novel protein, MAPO1, that functions in apoptosis triggered by O6-methylguanine mispair in DNA."
      Komori K., Takagi Y., Sanada M., Lim T.H., Nakatsu Y., Tsuzuki T., Sekiguchi M., Hidaka M.
      Oncogene 28:1142-1150(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-723 AND SER-726, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.

    Entry informationi

    Entry nameiFNIP2_HUMAN
    AccessioniPrimary (citable) accession number: Q9P278
    Secondary accession number(s): Q05DC3, Q96I31, Q9H994
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 26, 2008
    Last sequence update: February 26, 2008
    Last modified: October 1, 2014
    This is version 80 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Elevated expression levels in histologic variants of renal tumors.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 4
      Human chromosome 4: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3