SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P278

- FNIP2_HUMAN

UniProt

Q9P278 - FNIP2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Folliculin-interacting protein 2
Gene
FNIP2, FNIPL, KIAA1450, MAPO1
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

May play a role in the signal transduction pathway of apoptosis induced by O6-methylguanine-mispaired lesions By similarity. May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways. May regulate phosphorylation of RPS6KB1.2 Publications

GO - Molecular functioni

  1. protein binding Source: UniProtKB
Complete GO annotation...

GO - Biological processi

  1. intrinsic apoptotic signaling pathway in response to DNA damage Source: UniProtKB
  2. negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  3. positive regulation of peptidyl-serine phosphorylation Source: UniProtKB
  4. protein phosphorylation Source: UniProtKB
  5. regulation of protein phosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

DNA damage

Names & Taxonomyi

Protein namesi
Recommended name:
Folliculin-interacting protein 2
Alternative name(s):
FNIP1-like protein
O6-methylguanine-induced apoptosis 1 protein
Gene namesi
Name:FNIP2
Synonyms:FNIPL, KIAA1450, MAPO1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 4

Organism-specific databases

HGNCiHGNC:29280. FNIP2.

Subcellular locationi

Cytoplasm
Note: Colocalizes with FLCN in the cytoplasm.3 Publications

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB
  2. microtubule organizing center Source: HPA
  3. nucleus Source: HPA
  4. plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162388758.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11141114Folliculin-interacting protein 2
PRO_0000320553Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei723 – 7231Phosphoserine1 Publication
Modified residuei726 – 7261Phosphoserine1 Publication

Post-translational modificationi

Phosphorylated by AMPK.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9P278.
PaxDbiQ9P278.
PRIDEiQ9P278.

PTM databases

PhosphoSiteiQ9P278.

Expressioni

Tissue specificityi

Widely expressed with highest levels in muscle, nasal mucosa, salivary gland, uvula, fat, liver, heart, placenta and pancreas. Moderately expressed in the lung, small intestine, kidney and brain. Lower levels detected in renal cell carcinoma than in normal kidney tissue. Higher levels detected in oncocytoma than in normal kidney.2 Publications

Gene expression databases

ArrayExpressiQ9P278.
BgeeiQ9P278.
CleanExiHS_FNIP2.
GenevestigatoriQ9P278.

Organism-specific databases

HPAiHPA042779.
HPA052758.

Interactioni

Subunit structurei

Forms homomultimers and heteromultimers with FNIP1. Interacts (via C-terminus) with FLCN (via C-terminus). Phosphorylated FLCN is preferentially bound. Interacts with PRKAA1, PRKAB1 and PRKAG1 subunits of 5'-AMP-activated protein kinase.2 Publications

Protein-protein interaction databases

IntActiQ9P278. 1 interaction.
MINTiMINT-7298240.
STRINGi9606.ENSP00000264433.

Structurei

3D structure databases

ProteinModelPortaliQ9P278.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni544 – 911368Interaction with PRKAA1
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi95 – 11622Ser-rich
Add
BLAST
Compositional biasi242 – 26524Ser-rich
Add
BLAST

Sequence similaritiesi

Belongs to the FNIP family.

Phylogenomic databases

eggNOGiNOG330489.
HOGENOMiHOG000112624.
HOVERGENiHBG059425.
InParanoidiQ9P278.
OMAiENQLTWS.
OrthoDBiEOG7JMGCQ.
PhylomeDBiQ9P278.
TreeFamiTF324090.

Family and domain databases

InterProiIPR028086. FNIP_C_dom.
IPR026156. FNIP_fam.
IPR028085. FNIP_mid_dom.
IPR028084. FNIP_N_dom.
[Graphical view]
PANTHERiPTHR21634. PTHR21634. 1 hit.
PfamiPF14638. FNIP_C. 1 hit.
PF14637. FNIP_M. 1 hit.
PF14636. FNIP_N. 1 hit.
[Graphical view]
PRINTSiPR02073. FOLLICULNIP1.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P278-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAPTLLQKLF NKRGSSGSSA AASAQGRAPK EGPAFSWSCS EFDLNEIRLI     50
VYQDCDRRGR QVLFDSKAVQ KIEEVTAQKT EDVPIKISAK CCQGSSSVSS 100
SSSSSISSHS SSGGSSHHAK EQLPKYQYTR PASDVNMLGE MMFGSVAMSY 150
KGSTLKIHYI RSPPQLMISK VFSARMGSFC GSTNNLQDSF EYINQDPNLG 200
KLNTNQNSLG PCRTGSNLAH STPVDMPSRG QNEDRDSGIA RSASLSSLLI 250
TPFPSPSSST SSSSSYQRRW LRSQTTSLEN GIIPRRSTDE TFSLAEETCS 300
SNPAMVRRKK IAISIIFSLC EKEEAQRNFQ DFFFSHFPLF ESHMNRLKSA 350
IEKAMISCRK IAESSLRVQF YVSRLMEALG EFRGTIWNLY SVPRIAEPVW 400
LTMMSGTLEK NQLCQRFLKE FTLLIEQINK NQFFAALLTA VLTYHLAWVP 450
TVMPVDHPPI KAFSEKRTSQ SVNMLAKTHP YNPLWAQLGD LYGAIGSPVR 500
LTRTVVVGKQ KDLVQRILYV LTYFLRCSEL QENQLTWSGN HGEGDQVLNG 550
SKIITALEKG EVEESEYVVI TVRNEPALVP PILPPTAAER HNPWPTGFPE 600
CPEGTDSRDL GLKPDKEANR RPEQGSEACS AGCLGPASDA SWKPQNAFCG 650
DEKNKEAPQD GSSRLPSCEV LGAGMKMDQQ AVCELLKVEM PTRLPDRSVA 700
WPCPDRHLRE KPSLEKVTFQ IGSFASPESD FESRMKKMEE RVKACGPSLE 750
ASEAADVAQD PQVSRSPFKP GFQENVCCPQ NRLSEGDEGE SDKGFAEDRG 800
SRNDMAADIA GQLSHAADLG TASHGAGGTG GRRLEATRGL YVKAAEGPVL 850
EPVAPRCVQR GPGLVAGANI PCGDDNKKAN FRTEGDIPRN ESSDSALGDS 900
DDEACASAML DLGHGGDRTG GSLEVELPLP RSQSISTQNV RNFGRSLLAG 950
YCPTYMPDLV LHGTGSDEKL KQCLVADLVH TVHHPVLDEP IAEAVCIIAD 1000
TDKWSVQVAT SQRKVTDNMK LGQDVLVSSQ VSSLLQSILQ LYKLHLPADF 1050
CIMHLEDRLQ EMYLKSKMLS EYLRGHTRVH VKELGVVLGI ESNDLPLLTA 1100
IASTHSPYVA QILL 1114
Length:1,114
Mass (Da):122,115
Last modified:February 26, 2008 - v2
Checksum:i8951340C11EE0D5B
GO
Isoform 2 (identifier: Q9P278-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAF → MCGGTANTTN...RSTDHTELDN

Show »
Length:1,137
Mass (Da):124,860
Checksum:iEE3CE381023899EC
GO

Sequence cautioni

The sequence AAH16638.1 differs from that shown. Reason: Potential poly-A sequence.
The sequence AAH07861.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAA95974.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAB14338.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti298 – 2981T → S.
Corresponds to variant rs2276938 [ dbSNP | Ensembl ].
VAR_045612

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3535MAPTL…EGPAF → MCGGTANTTNQPESWQDSAR CVSDAVPGAGRIYRALLCTK IKKHTGVDRSTDHTELDN in isoform 2.
VSP_031656Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB040883 mRNA. Translation: BAA95974.1. Different initiation.
BC007861 mRNA. Translation: AAH07861.1. Different initiation.
BC016638 mRNA. Translation: AAH16638.1. Sequence problems.
AK022968 mRNA. Translation: BAB14338.1. Different initiation.
CCDSiCCDS47155.1. [Q9P278-1]
RefSeqiNP_065891.1. NM_020840.1. [Q9P278-1]
XP_005263216.1. XM_005263159.1. [Q9P278-2]
UniGeneiHs.652441.
Hs.731810.

Genome annotation databases

EnsembliENST00000264433; ENSP00000264433; ENSG00000052795. [Q9P278-1]
ENST00000379346; ENSP00000368651; ENSG00000052795. [Q9P278-2]
GeneIDi57600.
KEGGihsa:57600.
UCSCiuc003iqe.4. human. [Q9P278-1]

Polymorphism databases

DMDMi189035874.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB040883 mRNA. Translation: BAA95974.1 . Different initiation.
BC007861 mRNA. Translation: AAH07861.1 . Different initiation.
BC016638 mRNA. Translation: AAH16638.1 . Sequence problems.
AK022968 mRNA. Translation: BAB14338.1 . Different initiation.
CCDSi CCDS47155.1. [Q9P278-1 ]
RefSeqi NP_065891.1. NM_020840.1. [Q9P278-1 ]
XP_005263216.1. XM_005263159.1. [Q9P278-2 ]
UniGenei Hs.652441.
Hs.731810.

3D structure databases

ProteinModelPortali Q9P278.
ModBasei Search...

Protein-protein interaction databases

IntActi Q9P278. 1 interaction.
MINTi MINT-7298240.
STRINGi 9606.ENSP00000264433.

PTM databases

PhosphoSitei Q9P278.

Polymorphism databases

DMDMi 189035874.

Proteomic databases

MaxQBi Q9P278.
PaxDbi Q9P278.
PRIDEi Q9P278.

Protocols and materials databases

DNASUi 57600.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264433 ; ENSP00000264433 ; ENSG00000052795 . [Q9P278-1 ]
ENST00000379346 ; ENSP00000368651 ; ENSG00000052795 . [Q9P278-2 ]
GeneIDi 57600.
KEGGi hsa:57600.
UCSCi uc003iqe.4. human. [Q9P278-1 ]

Organism-specific databases

CTDi 57600.
GeneCardsi GC04P159690.
HGNCi HGNC:29280. FNIP2.
HPAi HPA042779.
HPA052758.
MIMi 612768. gene.
neXtProti NX_Q9P278.
PharmGKBi PA162388758.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG330489.
HOGENOMi HOG000112624.
HOVERGENi HBG059425.
InParanoidi Q9P278.
OMAi ENQLTWS.
OrthoDBi EOG7JMGCQ.
PhylomeDBi Q9P278.
TreeFami TF324090.

Miscellaneous databases

ChiTaRSi FNIP2. human.
GenomeRNAii 57600.
NextBioi 64218.
PROi Q9P278.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9P278.
Bgeei Q9P278.
CleanExi HS_FNIP2.
Genevestigatori Q9P278.

Family and domain databases

InterProi IPR028086. FNIP_C_dom.
IPR026156. FNIP_fam.
IPR028085. FNIP_mid_dom.
IPR028084. FNIP_N_dom.
[Graphical view ]
PANTHERi PTHR21634. PTHR21634. 1 hit.
Pfami PF14638. FNIP_C. 1 hit.
PF14637. FNIP_M. 1 hit.
PF14636. FNIP_N. 1 hit.
[Graphical view ]
PRINTSi PR02073. FOLLICULNIP1.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-650 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 787-983 (ISOFORM 1).
    Tissue: Lymph and Uterus.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 663-1114 (ISOFORM 1).
  4. "Identification and characterization of a novel folliculin-interacting protein FNIP2."
    Hasumi H., Baba M., Hong S.-B., Hasumi Y., Huang Y., Yao M., Valera V.A., Linehan W.M., Schmidt L.S.
    Gene 415:60-67(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, INTERACTION WITH FLCN; PRKAA1; PRKAB1 AND PRKAG1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  5. "Interaction of folliculin (Birt-Hogg-Dube gene product) with a novel Fnip1-like (FnipL/Fnip2) protein."
    Takagi Y., Kobayashi T., Shiono M., Wang L., Piao X., Sun G., Zhang D., Abe M., Hagiwara Y., Takahashi K., Hino O.
    Oncogene 27:5339-5347(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH FLCN AND PRKAA1, TISSUE SPECIFICITY, PHOSPHORYLATION.
  6. "A novel protein, MAPO1, that functions in apoptosis triggered by O6-methylguanine mispair in DNA."
    Komori K., Takagi Y., Sanada M., Lim T.H., Nakatsu Y., Tsuzuki T., Sekiguchi M., Hidaka M.
    Oncogene 28:1142-1150(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-723 AND SER-726, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.

Entry informationi

Entry nameiFNIP2_HUMAN
AccessioniPrimary (citable) accession number: Q9P278
Secondary accession number(s): Q05DC3, Q96I31, Q9H994
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: July 9, 2014
This is version 79 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Elevated expression levels in histologic variants of renal tumors.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi