Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Folliculin-interacting protein 2

Gene

FNIP2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a co-chaperone of HSP90AA1. Inhibits the ATPase activity of HSP90AA1 leading to reduction in its chaperone activity. Facilitates the binding of client protein FLCN to HSP90AA1 (PubMed:27353360). May play a role in the signal transduction pathway of apoptosis induced by O6-methylguanine-mispaired lesions (By similarity). May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways (PubMed:18403135). May regulate phosphorylation of RPS6KB1 (PubMed:18663353).By similarity3 Publications

GO - Molecular functioni

  • ATPase inhibitor activity Source: UniProtKB
  • chaperone binding Source: UniProtKB

GO - Biological processi

  • intrinsic apoptotic signaling pathway in response to DNA damage Source: UniProtKB
  • negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • positive regulation of peptidyl-serine phosphorylation Source: UniProtKB
  • positive regulation of protein complex assembly Source: ParkinsonsUK-UCL
  • protein phosphorylation Source: UniProtKB
  • regulation of protein phosphorylation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

DNA damage

Enzyme and pathway databases

BioCyciZFISH:ENSG00000052795-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Folliculin-interacting protein 2
Alternative name(s):
FNIP1-like protein
O6-methylguanine-induced apoptosis 1 protein
Gene namesi
Name:FNIP2
Synonyms:FNIPL, KIAA1450, MAPO1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:29280. FNIP2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi57600.
OpenTargetsiENSG00000052795.
PharmGKBiPA162388758.

Polymorphism and mutation databases

BioMutaiFNIP2.
DMDMi189035874.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003205531 – 1114Folliculin-interacting protein 2Add BLAST1114

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei216PhosphoserineCombined sources1
Modified residuei221PhosphoserineCombined sources1
Modified residuei723PhosphoserineCombined sources1
Modified residuei726PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by AMPK.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9P278.
MaxQBiQ9P278.
PaxDbiQ9P278.
PeptideAtlasiQ9P278.
PRIDEiQ9P278.

PTM databases

iPTMnetiQ9P278.
PhosphoSitePlusiQ9P278.

Expressioni

Tissue specificityi

Widely expressed with highest levels in muscle, nasal mucosa, salivary gland, uvula, fat, liver, heart, placenta and pancreas. Moderately expressed in the lung, small intestine, kidney and brain. Lower levels detected in renal cell carcinoma than in normal kidney tissue (PubMed:18403135). Higher levels detected in oncocytoma tumors than in normal kidney. Higher levels detected in renal cell carcinoma tumors than in normal kidney tissue (PubMed:27353360).3 Publications

Gene expression databases

BgeeiENSG00000052795.
CleanExiHS_FNIP2.
ExpressionAtlasiQ9P278. baseline and differential.
GenevisibleiQ9P278. HS.

Organism-specific databases

HPAiHPA042779.
HPA052758.

Interactioni

Subunit structurei

Homodimer and homomultimer. Heterodimer and heteromultimer with FNIP1 (PubMed:27353360, PubMed:18403135). Interacts (via C-terminus) with FLCN (via C-terminus) (PubMed:18403135, PubMed:18663353, PubMed:27353360). Phosphorylated FLCN is preferentially bound (PubMed:18663353). Interacts with PRKAA1, PRKAB1 and PRKAG1 subunits of 5'-AMP-activated protein kinase (PubMed:18403135, PubMed:18663353). Interacts with HSP70, HSP90AA1, STIP1, PTGES3, CDC37, BRAF, GCR and CDK4 (PubMed:27353360).3 Publications

GO - Molecular functioni

  • chaperone binding Source: UniProtKB

Protein-protein interaction databases

BioGridi121650. 3 interactors.
IntActiQ9P278. 2 interactors.
MINTiMINT-7298240.
STRINGi9606.ENSP00000264433.

Structurei

3D structure databases

ProteinModelPortaliQ9P278.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni544 – 911Interaction with PRKAA11 PublicationAdd BLAST368

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi95 – 116Ser-richAdd BLAST22
Compositional biasi242 – 265Ser-richAdd BLAST24

Sequence similaritiesi

Belongs to the FNIP family.Curated

Phylogenomic databases

eggNOGiKOG3693. Eukaryota.
ENOG410ZIEC. LUCA.
GeneTreeiENSGT00390000009391.
HOGENOMiHOG000112624.
HOVERGENiHBG059425.
InParanoidiQ9P278.
KOiK20401.
OMAiENQLTWS.
OrthoDBiEOG091G016D.
PhylomeDBiQ9P278.
TreeFamiTF324090.

Family and domain databases

InterProiIPR028086. FNIP_C_dom.
IPR026156. FNIP_fam.
IPR028085. FNIP_mid_dom.
IPR028084. FNIP_N_dom.
[Graphical view]
PANTHERiPTHR21634. PTHR21634. 1 hit.
PfamiPF14638. FNIP_C. 1 hit.
PF14637. FNIP_M. 1 hit.
PF14636. FNIP_N. 1 hit.
[Graphical view]
PRINTSiPR02073. FOLLICULNIP1.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P278-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPTLLQKLF NKRGSSGSSA AASAQGRAPK EGPAFSWSCS EFDLNEIRLI
60 70 80 90 100
VYQDCDRRGR QVLFDSKAVQ KIEEVTAQKT EDVPIKISAK CCQGSSSVSS
110 120 130 140 150
SSSSSISSHS SSGGSSHHAK EQLPKYQYTR PASDVNMLGE MMFGSVAMSY
160 170 180 190 200
KGSTLKIHYI RSPPQLMISK VFSARMGSFC GSTNNLQDSF EYINQDPNLG
210 220 230 240 250
KLNTNQNSLG PCRTGSNLAH STPVDMPSRG QNEDRDSGIA RSASLSSLLI
260 270 280 290 300
TPFPSPSSST SSSSSYQRRW LRSQTTSLEN GIIPRRSTDE TFSLAEETCS
310 320 330 340 350
SNPAMVRRKK IAISIIFSLC EKEEAQRNFQ DFFFSHFPLF ESHMNRLKSA
360 370 380 390 400
IEKAMISCRK IAESSLRVQF YVSRLMEALG EFRGTIWNLY SVPRIAEPVW
410 420 430 440 450
LTMMSGTLEK NQLCQRFLKE FTLLIEQINK NQFFAALLTA VLTYHLAWVP
460 470 480 490 500
TVMPVDHPPI KAFSEKRTSQ SVNMLAKTHP YNPLWAQLGD LYGAIGSPVR
510 520 530 540 550
LTRTVVVGKQ KDLVQRILYV LTYFLRCSEL QENQLTWSGN HGEGDQVLNG
560 570 580 590 600
SKIITALEKG EVEESEYVVI TVRNEPALVP PILPPTAAER HNPWPTGFPE
610 620 630 640 650
CPEGTDSRDL GLKPDKEANR RPEQGSEACS AGCLGPASDA SWKPQNAFCG
660 670 680 690 700
DEKNKEAPQD GSSRLPSCEV LGAGMKMDQQ AVCELLKVEM PTRLPDRSVA
710 720 730 740 750
WPCPDRHLRE KPSLEKVTFQ IGSFASPESD FESRMKKMEE RVKACGPSLE
760 770 780 790 800
ASEAADVAQD PQVSRSPFKP GFQENVCCPQ NRLSEGDEGE SDKGFAEDRG
810 820 830 840 850
SRNDMAADIA GQLSHAADLG TASHGAGGTG GRRLEATRGL YVKAAEGPVL
860 870 880 890 900
EPVAPRCVQR GPGLVAGANI PCGDDNKKAN FRTEGDIPRN ESSDSALGDS
910 920 930 940 950
DDEACASAML DLGHGGDRTG GSLEVELPLP RSQSISTQNV RNFGRSLLAG
960 970 980 990 1000
YCPTYMPDLV LHGTGSDEKL KQCLVADLVH TVHHPVLDEP IAEAVCIIAD
1010 1020 1030 1040 1050
TDKWSVQVAT SQRKVTDNMK LGQDVLVSSQ VSSLLQSILQ LYKLHLPADF
1060 1070 1080 1090 1100
CIMHLEDRLQ EMYLKSKMLS EYLRGHTRVH VKELGVVLGI ESNDLPLLTA
1110
IASTHSPYVA QILL
Length:1,114
Mass (Da):122,115
Last modified:February 26, 2008 - v2
Checksum:i8951340C11EE0D5B
GO
Isoform 2 (identifier: Q9P278-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAF → MCGGTANTTN...RSTDHTELDN

Show »
Length:1,137
Mass (Da):124,860
Checksum:iEE3CE381023899EC
GO

Sequence cautioni

The sequence AAH07861 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence AAH16638 differs from that shown. Potential poly-A sequence.Curated
The sequence BAA95974 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAB14338 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_045612298T → S.Corresponds to variant rs2276938dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0316561 – 35MAPTL…EGPAF → MCGGTANTTNQPESWQDSAR CVSDAVPGAGRIYRALLCTK IKKHTGVDRSTDHTELDN in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040883 mRNA. Translation: BAA95974.1. Different initiation.
BC007861 mRNA. Translation: AAH07861.1. Different initiation.
BC016638 mRNA. Translation: AAH16638.1. Sequence problems.
AK022968 mRNA. Translation: BAB14338.1. Different initiation.
CCDSiCCDS47155.1. [Q9P278-1]
RefSeqiNP_001310845.1. NM_001323916.1. [Q9P278-2]
NP_065891.1. NM_020840.2. [Q9P278-1]
UniGeneiHs.652441.
Hs.731810.

Genome annotation databases

EnsembliENST00000264433; ENSP00000264433; ENSG00000052795. [Q9P278-1]
GeneIDi57600.
KEGGihsa:57600.
UCSCiuc003iqe.5. human. [Q9P278-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040883 mRNA. Translation: BAA95974.1. Different initiation.
BC007861 mRNA. Translation: AAH07861.1. Different initiation.
BC016638 mRNA. Translation: AAH16638.1. Sequence problems.
AK022968 mRNA. Translation: BAB14338.1. Different initiation.
CCDSiCCDS47155.1. [Q9P278-1]
RefSeqiNP_001310845.1. NM_001323916.1. [Q9P278-2]
NP_065891.1. NM_020840.2. [Q9P278-1]
UniGeneiHs.652441.
Hs.731810.

3D structure databases

ProteinModelPortaliQ9P278.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121650. 3 interactors.
IntActiQ9P278. 2 interactors.
MINTiMINT-7298240.
STRINGi9606.ENSP00000264433.

PTM databases

iPTMnetiQ9P278.
PhosphoSitePlusiQ9P278.

Polymorphism and mutation databases

BioMutaiFNIP2.
DMDMi189035874.

Proteomic databases

EPDiQ9P278.
MaxQBiQ9P278.
PaxDbiQ9P278.
PeptideAtlasiQ9P278.
PRIDEiQ9P278.

Protocols and materials databases

DNASUi57600.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264433; ENSP00000264433; ENSG00000052795. [Q9P278-1]
GeneIDi57600.
KEGGihsa:57600.
UCSCiuc003iqe.5. human. [Q9P278-1]

Organism-specific databases

CTDi57600.
DisGeNETi57600.
GeneCardsiFNIP2.
HGNCiHGNC:29280. FNIP2.
HPAiHPA042779.
HPA052758.
MIMi612768. gene.
neXtProtiNX_Q9P278.
OpenTargetsiENSG00000052795.
PharmGKBiPA162388758.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3693. Eukaryota.
ENOG410ZIEC. LUCA.
GeneTreeiENSGT00390000009391.
HOGENOMiHOG000112624.
HOVERGENiHBG059425.
InParanoidiQ9P278.
KOiK20401.
OMAiENQLTWS.
OrthoDBiEOG091G016D.
PhylomeDBiQ9P278.
TreeFamiTF324090.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000052795-MONOMER.

Miscellaneous databases

ChiTaRSiFNIP2. human.
GenomeRNAii57600.
PROiQ9P278.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000052795.
CleanExiHS_FNIP2.
ExpressionAtlasiQ9P278. baseline and differential.
GenevisibleiQ9P278. HS.

Family and domain databases

InterProiIPR028086. FNIP_C_dom.
IPR026156. FNIP_fam.
IPR028085. FNIP_mid_dom.
IPR028084. FNIP_N_dom.
[Graphical view]
PANTHERiPTHR21634. PTHR21634. 1 hit.
PfamiPF14638. FNIP_C. 1 hit.
PF14637. FNIP_M. 1 hit.
PF14636. FNIP_N. 1 hit.
[Graphical view]
PRINTSiPR02073. FOLLICULNIP1.
ProtoNetiSearch...

Entry informationi

Entry nameiFNIP2_HUMAN
AccessioniPrimary (citable) accession number: Q9P278
Secondary accession number(s): Q05DC3, Q96I31, Q9H994
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: November 30, 2016
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Elevated expression levels in histologic variants of renal tumors.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.