Q9P278 (FNIP2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 70.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Folliculin-interacting protein 2 Alternative name(s): FNIP1-like protein O6-methylguanine-induced apoptosis 1 protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1114 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May play a role in the signal transduction pathway of apoptosis induced by O6-methylguanine-mispaired lesions By similarity. May be involved in energy and/or nutrient sensing through the AMPK and mTOR signaling pathways. May regulate phosphorylation of RPS6KB1. Ref.4 Ref.5 |
| Subunit structure | Forms homomultimers and heteromultimers with FNIP1. Interacts (via C-terminus) with FLCN (via C-terminus). Phosphorylated FLCN is preferentially bound. Interacts with PRKAA1, PRKAB1 and PRKAG1 subunits of 5'-AMP-activated protein kinase. Ref.4 Ref.5 |
| Subcellular location | Cytoplasm. Note: Co-localizes with FLCN in the cytoplasm. Ref.4 Ref.5 Ref.6 |
| Tissue specificity | Widely expressed with highest levels in muscle, nasal mucosa, salivary gland, uvula, fat, liver, heart, placenta and pancreas. Moderately expressed in the lung, small intestine, kidney and brain. Lower levels detected in renal cell carcinoma than in normal kidney tissue. Higher levels detected in oncocytoma than in normal kidney. Ref.4 Ref.5 |
| Post-translational modification | Phosphorylated by AMPK. Ref.5 |
| Miscellaneous | Elevated expression levels in histologic variants of renal tumors. |
| Sequence similarities | Belongs to the FNIP family. |
| Sequence caution | The sequence AAH07861.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence AAH16638.1 differs from that shown. Reason: Potential poly-A sequence. The sequence BAA95974.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAB14338.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA damage |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | intrinsic apoptotic signaling pathway in response to DNA damage Inferred from sequence or structural similarity. Source: UniProtKB negative regulation of transcription from RNA polymerase II promoterInferred from direct assay PubMed 21209915. Source: UniProtKB positive regulation of peptidyl-serine phosphorylationInferred from direct assay PubMed 19914239. Source: UniProtKB protein phosphorylationInferred from direct assay Ref.5. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from direct assay Ref.4Ref.5Ref.6. Source: UniProtKB nucleusInferred from direct assay. Source: HPA plasma membraneInferred from direct assay. Source: HPA |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P278-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P278-2) The sequence of this isoform differs from the canonical sequence as follows: 1-35: MAPTLLQKLFNKRGSSGSSAAASAQGRAPKEGPAF → MCGGTANTTN...RSTDHTELDN |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1114 | 1114 | Folliculin-interacting protein 2 | PRO_0000320553 | |||||
Regions | |||||||||
| Region | 544 – 911 | 368 | Interaction with PRKAA1 | ||||||
| Compositional bias | 95 – 116 | 22 | Ser-rich | ||||||
| Compositional bias | 242 – 265 | 24 | Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 723 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 726 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 35 | 35 | MAPTL…EGPAF → MCGGTANTTNQPESWQDSAR CVSDAVPGAGRIYRALLCTK IKKHTGVDRSTDHTELDN in isoform 2. | VSP_031656 | |||||
| Natural variant | 298 | 1 | T → S. Corresponds to variant rs2276938 [ dbSNP | Ensembl ]. | VAR_045612 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-650 (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 787-983 (ISOFORM 1). Tissue: Lymph and Uterus. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 663-1114 (ISOFORM 1). |
| [4] | "Identification and characterization of a novel folliculin-interacting protein FNIP2." Hasumi H., Baba M., Hong S.-B., Hasumi Y., Huang Y., Yao M., Valera V.A., Linehan W.M., Schmidt L.S. Gene 415:60-67(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, INTERACTION WITH FLCN; PRKAA1; PRKAB1 AND PRKAG1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [5] | "Interaction of folliculin (Birt-Hogg-Dube gene product) with a novel Fnip1-like (FnipL/Fnip2) protein." Takagi Y., Kobayashi T., Shiono M., Wang L., Piao X., Sun G., Zhang D., Abe M., Hagiwara Y., Takahashi K., Hino O. Oncogene 27:5339-5347(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH FLCN AND PRKAA1, TISSUE SPECIFICITY, PHOSPHORYLATION. |
| [6] | "A novel protein, MAPO1, that functions in apoptosis triggered by O6-methylguanine mispair in DNA." Komori K., Takagi Y., Sanada M., Lim T.H., Nakatsu Y., Tsuzuki T., Sekiguchi M., Hidaka M. Oncogene 28:1142-1150(2009) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [7] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-723 AND SER-726, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB040883 mRNA. Translation: BAA95974.1. Different initiation. BC007861 mRNA. Translation: AAH07861.1. Different initiation. BC016638 mRNA. Translation: AAH16638.1. Sequence problems. AK022968 mRNA. Translation: BAB14338.1. Different initiation. |
| IPI | IPI00001790. IPI00885074. |
| RefSeq | NP_065891.1. NM_020840.1. |
| UniGene | Hs.652441. Hs.731810. |
3D structure databases | |
| ProteinModelPortal | Q9P278. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-7298240. |
| STRING | 9606.ENSP00000264433. |
PTM databases | |
| PhosphoSite | Q9P278. |
Polymorphism databases | |
| DMDM | 189035874. |
Proteomic databases | |
| PaxDb | Q9P278. |
| PRIDE | Q9P278. |
Protocols and materials databases | |
| DNASU | 57600. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264433; ENSP00000264433; ENSG00000052795. ENST00000379346; ENSP00000368651; ENSG00000052795. |
| GeneID | 57600. |
| KEGG | hsa:57600. |
| UCSC | uc003iqe.4. human. |
Organism-specific databases | |
| CTD | 57600. |
| GeneCards | GC04P159690. |
| HGNC | HGNC:29280. FNIP2. |
| HPA | HPA042779. |
| MIM | 612768. gene. |
| neXtProt | NX_Q9P278. |
| PharmGKB | PA162388758. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG330489. |
| HOGENOM | HOG000112624. |
| HOVERGEN | HBG059425. |
| InParanoid | Q9P278. |
| OMA | ENQLTWS. |
| OrthoDB | EOG42821N. |
Gene expression databases | |
| ArrayExpress | Q9P278. |
| Bgee | Q9P278. |
| CleanEx | HS_FNIP2. |
| Genevestigator | Q9P278. |
Family and domain databases | |
| InterPro | IPR026156. FNIP_fam. [Graphical view] |
| PANTHER | PTHR21634. PTHR21634. 1 hit. |
| PRINTS | PR02073. FOLLICULNIP1. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | FNIP2. human. |
| GenomeRNAi | 57600. |
| NextBio | 64218. |
| SOURCE | Search... |
Entry information
| Entry name | FNIP2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P278 Secondary accession number(s): Q05DC3, Q96I31, Q9H994 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
