Q9P260 (K1468_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 80.
History...
Clusters with 
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: LisH domain and HEAT repeat-containing protein KIAA1468 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 1216 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Contains 3 HEAT repeats. Contains 1 LisH domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil Repeat |
| PTM | Acetylation Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P260-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P260-2) The sequence of this isoform differs from the canonical sequence as follows: 920-920: Q → QIKEYLHIHNEISWEWDPSLNTKCVSYTHYTHSLK 991-1017: TLRGMSEALVDKRVAPALVTLSSDPEF → LVKGVNETLVAQRVVPALITLSSDPEI | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.7 | ||||||
| Chain | 2 – 1216 | 1215 | LisH domain and HEAT repeat-containing protein KIAA1468 | PRO_0000313093 | |||||
Regions | |||||||||
| Domain | 255 – 287 | 33 | LisH | ||||||
| Repeat | 601 – 639 | 39 | HEAT 1 | ||||||
| Repeat | 640 – 679 | 40 | HEAT 2 | ||||||
| Repeat | 1004 – 1042 | 39 | HEAT 3 | ||||||
| Coiled coil | 197 – 231 | 35 | Potential | ||||||
| Coiled coil | 359 – 397 | 39 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.7 | ||||||
| Modified residue | 20 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 22 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 32 | 1 | Phosphothreonine By similarity | ||||||
| Modified residue | 54 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 56 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 180 | 1 | Phosphoserine Ref.4 Ref.7 | ||||||
| Modified residue | 182 | 1 | Phosphoserine Ref.4 | ||||||
| Modified residue | 183 | 1 | Phosphothreonine Ref.4 | ||||||
| Modified residue | 186 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 920 | 1 | Q → QIKEYLHIHNEISWEWDPSL NTKCVSYTHYTHSLK in isoform 2. | VSP_030016 | |||||
| Alternative sequence | 991 – 1017 | 27 | TLRGM…SDPEF → LVKGVNETLVAQRVVPALIT LSSDPEI in isoform 2. | VSP_030017 | |||||
| Natural variant | 929 | 1 | G → E in a colorectal cancer sample; somatic mutation. Ref.8 | VAR_037660 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "DNA sequence and analysis of human chromosome 18." Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J.  Lander E.S.Nature 437:551-555(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 266-1216 (ISOFORM 2). Tissue: Brain. |
| [3] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [4] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-180; SER-182; THR-183 AND SER-186, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [5] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-54 AND SER-56, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-20; SER-22 AND SER-180, MASS SPECTROMETRY, CLEAVAGE OF INITIATOR METHIONINE. |
| [8] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] GLU-929. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC027514 Genomic DNA. No translation available. AC090396 Genomic DNA. No translation available. AB040901 mRNA. Translation: BAA95992.1. |
| IPI | IPI00023330. IPI00797368. |
| RefSeq | NP_065905.2. NM_020854.3. |
| UniGene | Hs.465323. |
3D structure databases | |
| ProteinModelPortal | Q9P260. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9P260. 2 interactions. |
| STRING | 9606.ENSP00000381198. |
PTM databases | |
| PhosphoSite | Q9P260. |
Polymorphism databases | |
| DMDM | 166218823. |
Proteomic databases | |
| PaxDb | Q9P260. |
| PRIDE | Q9P260. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000256858; ENSP00000256858; ENSG00000134444. ENST00000398130; ENSP00000381198; ENSG00000134444. |
| GeneID | 57614. |
| KEGG | hsa:57614. |
| UCSC | uc002lik.1. human. uc002lim.3. human. |
Organism-specific databases | |
| CTD | 57614. |
| GeneCards | GC18P059861. |
| HGNC | HGNC:29289. KIAA1468. |
| HPA | HPA039708. HPA040038. |
| neXtProt | NX_Q9P260. |
| PharmGKB | PA134865247. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG139708. |
| HOGENOM | HOG000067741. |
| HOVERGEN | HBG062583. |
| InParanoid | Q9P260. |
| OMA | NTVHFDK. |
| OrthoDB | EOG4N5VW1. |
Gene expression databases | |
| ArrayExpress | Q9P260. |
| Bgee | Q9P260. |
| CleanEx | HS_KIAA1468. |
| Genevestigator | Q9P260. |
Family and domain databases | |
| Gene3D | 1.25.10.10. 3 hits. |
| InterPro | IPR011989. ARM-like. IPR016024. ARM-type_fold. IPR021133. HEAT_type_2. IPR006594. LisH_dimerisation. [Graphical view] |
| SMART | SM00667. LisH. 1 hit. [Graphical view] |
| SUPFAM | SSF48371. ARM-type_fold. 1 hit. |
| PROSITE | PS50077. HEAT_REPEAT. 1 hit. PS50896. LISH. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 57614. |
| NextBio | 64272. |
Entry information
| Entry name | K1468_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P260 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |