SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P243

- ZFAT_HUMAN

UniProt

Q9P243 - ZFAT_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Zinc finger protein ZFAT
Gene
ZFAT, KIAA1485, ZFAT1, ZNF406
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation. Overexpression causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated By similarity.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri12 – 3524C2H2-type 1
Add
BLAST
Zinc fingeri116 – 14126C2H2-type 2; degenerate
Add
BLAST
Zinc fingeri271 – 29323C2H2-type 3
Add
BLAST
Zinc fingeri299 – 32123C2H2-type 4
Add
BLAST
Zinc fingeri326 – 34924C2H2-type 5
Add
BLAST
Zinc fingeri354 – 37724C2H2-type 6
Add
BLAST
Zinc fingeri404 – 42623C2H2-type 7
Add
BLAST
Zinc fingeri432 – 45423C2H2-type 8
Add
BLAST
Zinc fingeri458 – 48124C2H2-type 9
Add
BLAST
Zinc fingeri742 – 76423C2H2-type 10
Add
BLAST
Zinc fingeri770 – 79324C2H2-type 11
Add
BLAST
Zinc fingeri798 – 82225C2H2-type 12
Add
BLAST
Zinc fingeri830 – 85324C2H2-type 13
Add
BLAST
Zinc fingeri880 – 90324C2H2-type 14; degenerate
Add
BLAST
Zinc fingeri909 – 93123C2H2-type 15
Add
BLAST
Zinc fingeri937 – 95923C2H2-type 16
Add
BLAST
Zinc fingeri966 – 98823C2H2-type 17
Add
BLAST
Zinc fingeri994 – 101724C2H2-type 18
Add
BLAST
Zinc fingeri1041 – 106424C2H2-type 19
Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: Ensembl
  3. metal ion binding Source: UniProtKB-KW

GO - Biological processi

  1. hematopoietic progenitor cell differentiation Source: Ensembl
  2. spongiotrophoblast layer development Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein ZFAT
Alternative name(s):
Zinc finger gene in AITD susceptibility region
Zinc finger protein 406
Gene namesi
Name:ZFAT
Synonyms:KIAA1485, ZFAT1, ZNF406
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:19899. ZFAT.

Subcellular locationi

Nucleus By similarity. Cytoplasmcytosol By similarity

GO - Cellular componenti

  1. cytosol Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162409638.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12431243Zinc finger protein ZFAT
PRO_0000047566Add
BLAST

Proteomic databases

MaxQBiQ9P243.
PaxDbiQ9P243.
PRIDEiQ9P243.

PTM databases

PhosphoSiteiQ9P243.

Expressioni

Tissue specificityi

Isoform 1 is strongly expressed in placenta, spleen, kidney, testis and peripheral blood leukocytes. Expressed in CD4+ and CD8+ T-cells, CD19+ B-cells and CB14+ monocytes. Isoform 3 is strongly expressed in placenta, ovary, tonsil, CD19+ B-cells and CD14+ monocytes.1 Publication

Gene expression databases

ArrayExpressiQ9P243.
BgeeiQ9P243.
CleanExiHS_ZFAT.
GenevestigatoriQ9P243.

Organism-specific databases

HPAiHPA020989.

Interactioni

Protein-protein interaction databases

BioGridi121669. 1 interaction.
IntActiQ9P243. 2 interactions.
STRINGi9606.ENSP00000367069.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni274 – 2763
Beta strandi279 – 2824
Helixi283 – 29311
Beta strandi298 – 3003
Beta strandi302 – 3054
Beta strandi307 – 3104
Helixi311 – 32111
Beta strandi329 – 3313
Beta strandi334 – 3363
Helixi338 – 34710
Turni357 – 3593
Beta strandi362 – 3654
Helixi366 – 37510
Beta strandi407 – 4093
Beta strandi412 – 4154
Helixi416 – 4238
Turni424 – 4263
Beta strandi769 – 7713
Beta strandi773 – 7764
Beta strandi778 – 7803
Helixi782 – 79211
Beta strandi801 – 8044
Beta strandi808 – 8103
Helixi812 – 82211
Turni833 – 8364
Helixi842 – 85211
Beta strandi883 – 8864
Helixi894 – 90411
Beta strandi908 – 9103
Beta strandi912 – 9154
Beta strandi917 – 9193
Helixi921 – 93010
Turni940 – 9423
Helixi949 – 95911

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2ELMNMR-A768-797[»]
2ELNNMR-A796-826[»]
2ELONMR-A828-857[»]
2ELPNMR-A878-907[»]
2ELQNMR-A907-935[»]
2ELRNMR-A935-963[»]
2ELSNMR-A269-297[»]
2ELTNMR-A297-325[»]
2ELUNMR-A352-381[»]
2ELVNMR-A402-430[»]
2RSHNMR-A324-353[»]
2RSINMR-A297-381[»]
2RSJNMR-A269-353[»]
ProteinModelPortaliQ9P243.
SMRiQ9P243. Positions 269-485, 743-1064.

Miscellaneous databases

EvolutionaryTraceiQ9P243.

Family & Domainsi

Sequence similaritiesi

Contains 19 C2H2-type zinc fingers.

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG5048.
HOVERGENiHBG065928.
InParanoidiQ9P243.
OMAiHMEQHVS.
PhylomeDBiQ9P243.
TreeFamiTF350017.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 3 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 19 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 10 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P243-1) [UniParc]FASTAAdd to Basket

Also known as: ZFAT-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

METRAAENTA IFMCKCCNLF SPNQSELLSH VSEKHMEEGV NVDEIIIPLR     50
PLSTPEPPNS SKTGDEFLVM KRKRGRPKGS TKKSSTEEEL AENIVSPTED 100
SPLAPEEGNS LPPSSLECSK CCRKFSNTRQ LRKHICIIVL NLGEEEGEAG 150
NESDLELEKK CKEDDREKAS KRPRSQKTEK VQKISGKEAR QLSGAKKPII 200
SVVLTAHEAI PGATKIVPVE AGPPETGATN SETTSADLVP RRGYQEYAIQ 250
QTPYEQPMKS SRLGPTQLKI FTCEYCNKVF KFKHSLQAHL RIHTNEKPYK 300
CPQCSYASAI KANLNVHLRK HTGEKFACDY CSFTCLSKGH LKVHIERVHK 350
KIKQHCRFCK KKYSDVKNLI KHIRDAHDPQ DKKVKEALDE LCLMTREGKR 400
QLLYDCHICE RKFKNELDRD RHMLVHGDKW PFACELCGHG ATKYQALELH 450
VRKHPFVYVC AVCRKKFVSS IRLRTHIKEV HGAAQEALVF TSSINQSFCL 500
LEPGGDIQQE ALGDQLQLVE EEFALQGVNA LKEEACPGDT QLEEGRKEPE 550
APGEMPAPAV HLASPQAEST ALPPCELETT VVSSSDLHSQ EVVSDDFLLK 600
NDTSSAEAHA APEKPPDMQH RSSVQTQGEV ITLLLSKAQS AGSDQESHGA 650
QSPLGEGQNM AVLSAGDPDP SRCLRSNPAE ASDLLPPVAG GGDTITHQPD 700
SCKAAPEHRS GITAFMKVLN SLQKKQMNTS LCERIRKVYG DLECEYCGKL 750
FWYQVHFDMH VRTHTREHLY YCSQCHYSSI TKNCLKRHVI QKHSNILLKC 800
PTDGCDYSTP DKYKLQAHLK VHTALDKRSY SCPVCEKSFS EDRLIKSHIK 850
TNHPEVSMST ISEVLGRRVQ LKGLIGKRAM KCPYCDFYFM KNGSDLQRHI 900
WAHEGVKPFK CSLCEYATRS KSNLKAHMNR HSTEKTHLCD MCGKKFKSKG 950
TLKSHKLLHT ADGKQFKCTV CDYTAAQKPQ LLRHMEQHVS FKPFRCAHCH 1000
YSCNISGSLK RHYNRKHPNE EYANVGTGEL AAEVLIQQGG LKCPVCSFVY 1050
GTKWEFNRHL KNKHGLKVVE IDGDPKWETA TEAPEEPSTQ YLHITEAEED 1100
VQGTQAAVAA LQDLRYTSES GDRLDPTAVN ILQQIIELGA ETHDATALAS 1150
VVAMAPGTVT VVKQVTEEEP SSNHTVMIQE TVQQASVELA EQHHLVVSSD 1200
DVEGIETVTV YTQGGEASEF IVYVQEAMQP VEEQAVEQPA QEL 1243
Length:1,243
Mass (Da):139,034
Last modified:January 10, 2006 - v2
Checksum:iAF3E5339ED38D91C
GO
Isoform 2 (identifier: Q9P243-2) [UniParc]FASTAAdd to Basket

Also known as: ZFAT-2, ZFAT-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: Missing.

Show »
Length:1,231
Mass (Da):137,698
Checksum:iC4BA114EEC3AF2A6
GO
Isoform 3 (identifier: Q9P243-3) [UniParc]FASTAAdd to Basket

Also known as: TR-ZFAT

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: Missing.
     826-858: DKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSM → VSSKPKRQPRLPWVLIAFSSLCLYVGVSAAGQP
     859-1243: Missing.

Show »
Length:846
Mass (Da):94,437
Checksum:iDD3B6FD75DEEF958
GO
Isoform 4 (identifier: Q9P243-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-211: Missing.

Note: No experimental confirmation available.

Show »
Length:1,181
Mass (Da):132,137
Checksum:i8CC03D90ACB3DD3B
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti64 – 641G → R.2 Publications
Corresponds to variant rs17778003 [ dbSNP | Ensembl ].
VAR_024840
Natural varianti102 – 1021P → S.1 Publication
Corresponds to variant rs12541381 [ dbSNP | Ensembl ].
VAR_045815
Natural varianti672 – 6721R → K.
Corresponds to variant rs35003767 [ dbSNP | Ensembl ].
VAR_052819

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1212Missing in isoform 2 and isoform 3.
VSP_016959Add
BLAST
Alternative sequencei150 – 21162Missing in isoform 4.
VSP_045461Add
BLAST
Alternative sequencei826 – 85833DKRSY…PEVSM → VSSKPKRQPRLPWVLIAFSS LCLYVGVSAAGQP in isoform 3.
VSP_034938Add
BLAST
Alternative sequencei859 – 1243385Missing in isoform 3.
VSP_034939Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB167738 mRNA. Translation: BAD12567.1.
AB167739 mRNA. Translation: BAD12568.1.
AB167740 mRNA. Translation: BAD12569.1.
AB167741 mRNA. Translation: BAD12570.1.
AC015599 Genomic DNA. No translation available.
AC087045 Genomic DNA. No translation available.
AC135075 Genomic DNA. No translation available.
BC025423 mRNA. Translation: AAH25423.1.
BC046180 mRNA. Translation: AAH46180.1.
BC101766 mRNA. Translation: AAI01767.1.
BC101768 mRNA. Translation: AAI01769.1.
BC143519 mRNA. Translation: AAI43520.1.
AB040918 mRNA. Translation: BAA96009.1.
CCDSiCCDS43768.2. [Q9P243-2]
CCDS47924.1. [Q9P243-1]
CCDS55276.1. [Q9P243-4]
RefSeqiNP_001025110.2. NM_001029939.3. [Q9P243-2]
NP_001167628.1. NM_001174157.1. [Q9P243-4]
NP_001276323.1. NM_001289394.1. [Q9P243-2]
NP_065914.2. NM_020863.3. [Q9P243-1]
UniGeneiHs.446172.

Genome annotation databases

EnsembliENST00000377838; ENSP00000367069; ENSG00000066827. [Q9P243-1]
ENST00000520214; ENSP00000428483; ENSG00000066827. [Q9P243-2]
ENST00000520727; ENSP00000427831; ENSG00000066827. [Q9P243-2]
ENST00000523399; ENSP00000429091; ENSG00000066827. [Q9P243-4]
GeneIDi57623.
KEGGihsa:57623.
UCSCiuc003yun.3. human. [Q9P243-1]
uc003yur.3. human. [Q9P243-3]

Polymorphism databases

DMDMi85681862.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB167738 mRNA. Translation: BAD12567.1 .
AB167739 mRNA. Translation: BAD12568.1 .
AB167740 mRNA. Translation: BAD12569.1 .
AB167741 mRNA. Translation: BAD12570.1 .
AC015599 Genomic DNA. No translation available.
AC087045 Genomic DNA. No translation available.
AC135075 Genomic DNA. No translation available.
BC025423 mRNA. Translation: AAH25423.1 .
BC046180 mRNA. Translation: AAH46180.1 .
BC101766 mRNA. Translation: AAI01767.1 .
BC101768 mRNA. Translation: AAI01769.1 .
BC143519 mRNA. Translation: AAI43520.1 .
AB040918 mRNA. Translation: BAA96009.1 .
CCDSi CCDS43768.2. [Q9P243-2 ]
CCDS47924.1. [Q9P243-1 ]
CCDS55276.1. [Q9P243-4 ]
RefSeqi NP_001025110.2. NM_001029939.3. [Q9P243-2 ]
NP_001167628.1. NM_001174157.1. [Q9P243-4 ]
NP_001276323.1. NM_001289394.1. [Q9P243-2 ]
NP_065914.2. NM_020863.3. [Q9P243-1 ]
UniGenei Hs.446172.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2ELM NMR - A 768-797 [» ]
2ELN NMR - A 796-826 [» ]
2ELO NMR - A 828-857 [» ]
2ELP NMR - A 878-907 [» ]
2ELQ NMR - A 907-935 [» ]
2ELR NMR - A 935-963 [» ]
2ELS NMR - A 269-297 [» ]
2ELT NMR - A 297-325 [» ]
2ELU NMR - A 352-381 [» ]
2ELV NMR - A 402-430 [» ]
2RSH NMR - A 324-353 [» ]
2RSI NMR - A 297-381 [» ]
2RSJ NMR - A 269-353 [» ]
ProteinModelPortali Q9P243.
SMRi Q9P243. Positions 269-485, 743-1064.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121669. 1 interaction.
IntActi Q9P243. 2 interactions.
STRINGi 9606.ENSP00000367069.

PTM databases

PhosphoSitei Q9P243.

Polymorphism databases

DMDMi 85681862.

Proteomic databases

MaxQBi Q9P243.
PaxDbi Q9P243.
PRIDEi Q9P243.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000377838 ; ENSP00000367069 ; ENSG00000066827 . [Q9P243-1 ]
ENST00000520214 ; ENSP00000428483 ; ENSG00000066827 . [Q9P243-2 ]
ENST00000520727 ; ENSP00000427831 ; ENSG00000066827 . [Q9P243-2 ]
ENST00000523399 ; ENSP00000429091 ; ENSG00000066827 . [Q9P243-4 ]
GeneIDi 57623.
KEGGi hsa:57623.
UCSCi uc003yun.3. human. [Q9P243-1 ]
uc003yur.3. human. [Q9P243-3 ]

Organism-specific databases

CTDi 57623.
GeneCardsi GC08M135561.
HGNCi HGNC:19899. ZFAT.
HPAi HPA020989.
MIMi 610931. gene.
neXtProti NX_Q9P243.
PharmGKBi PA162409638.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5048.
HOVERGENi HBG065928.
InParanoidi Q9P243.
OMAi HMEQHVS.
PhylomeDBi Q9P243.
TreeFami TF350017.

Miscellaneous databases

ChiTaRSi ZFAT. human.
EvolutionaryTracei Q9P243.
GenomeRNAii 57623.
NextBioi 64310.
PROi Q9P243.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9P243.
Bgeei Q9P243.
CleanExi HS_ZFAT.
Genevestigatori Q9P243.

Family and domain databases

Gene3Di 3.30.160.60. 8 hits.
InterProi IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view ]
Pfami PF00096. zf-C2H2. 3 hits.
[Graphical view ]
SMARTi SM00355. ZnF_C2H2. 19 hits.
[Graphical view ]
PROSITEi PS00028. ZINC_FINGER_C2H2_1. 10 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "SNPs in the promoter of a B cell-specific antisense transcript, SAS-ZFAT, determine susceptibility to autoimmune thyroid disease."
    Shirasawa S., Harada H., Furugaki K., Akamizu T., Ishikawa N., Ito K., Ito K., Tamai H., Kuma K., Kubota S., Hiratani H., Tsuchiya T., Baba I., Ishikawa M., Tanaka M., Sakai K., Aoki M., Yamamoto K., Sasazuki T.
    Hum. Mol. Genet. 13:2221-2231(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY, VARIANTS ARG-64 AND SER-102.
  2. "DNA sequence and analysis of human chromosome 8."
    Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
    , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
    Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANTS ARG-64 AND SER_102.
    Tissue: Brain, Placenta and Skin.
  4. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 140-1243 (ISOFORM 1).
    Tissue: Brain.
  5. RIKEN structural genomics initiative (RSGI)
    Submitted (MAR-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 269-325; 352-381; 398-430; 768-826; 828-857 AND 878-963.

Entry informationi

Entry nameiZFAT_HUMAN
AccessioniPrimary (citable) accession number: Q9P243
Secondary accession number(s): B7ZL15
, E9PER3, Q3MIM5, Q6PJ01, Q75PJ6, Q75PJ7, Q75PJ9, Q86X64
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: January 10, 2006
Last modified: July 9, 2014
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi