Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein ZFAT

Gene

ZFAT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation. Overexpression causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 35C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri116 – 141C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST26
Zinc fingeri271 – 293C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri299 – 321C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri326 – 349C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri354 – 377C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri404 – 426C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri432 – 454C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri458 – 481C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri742 – 764C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri770 – 793C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri798 – 822C2H2-type 12PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri830 – 853C2H2-type 13PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri880 – 903C2H2-type 14; degeneratePROSITE-ProRule annotationAdd BLAST24
Zinc fingeri909 – 931C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri937 – 959C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri966 – 988C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri994 – 1017C2H2-type 18PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1041 – 1064C2H2-type 19PROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000066827-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein ZFAT
Alternative name(s):
Zinc finger gene in AITD susceptibility region
Zinc finger protein 406
Gene namesi
Name:ZFAT
Synonyms:KIAA1485, ZFAT1, ZNF406
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 8

Organism-specific databases

HGNCiHGNC:19899. ZFAT.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi57623.
MalaCardsiZFAT.
OpenTargetsiENSG00000066827.
PharmGKBiPA162409638.

Polymorphism and mutation databases

BioMutaiZFAT.
DMDMi85681862.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000475661 – 1243Zinc finger protein ZFATAdd BLAST1243

Proteomic databases

EPDiQ9P243.
MaxQBiQ9P243.
PaxDbiQ9P243.
PeptideAtlasiQ9P243.
PRIDEiQ9P243.

PTM databases

iPTMnetiQ9P243.
PhosphoSitePlusiQ9P243.

Expressioni

Tissue specificityi

Isoform 1 is strongly expressed in placenta, spleen, kidney, testis and peripheral blood leukocytes. Expressed in CD4+ and CD8+ T-cells, CD19+ B-cells and CB14+ monocytes. Isoform 3 is strongly expressed in placenta, ovary, tonsil, CD19+ B-cells and CD14+ monocytes.1 Publication

Gene expression databases

BgeeiENSG00000066827.
CleanExiHS_ZFAT.
ExpressionAtlasiQ9P243. baseline and differential.
GenevisibleiQ9P243. HS.

Organism-specific databases

HPAiHPA020989.
HPA063592.

Interactioni

Protein-protein interaction databases

BioGridi121669. 2 interactors.
IntActiQ9P243. 3 interactors.
STRINGi9606.ENSP00000367069.

Structurei

Secondary structure

11243
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni274 – 276Combined sources3
Beta strandi279 – 282Combined sources4
Helixi283 – 293Combined sources11
Beta strandi298 – 300Combined sources3
Beta strandi302 – 305Combined sources4
Beta strandi307 – 310Combined sources4
Helixi311 – 321Combined sources11
Beta strandi329 – 331Combined sources3
Beta strandi334 – 336Combined sources3
Helixi338 – 347Combined sources10
Turni357 – 359Combined sources3
Beta strandi362 – 365Combined sources4
Helixi366 – 375Combined sources10
Beta strandi407 – 409Combined sources3
Beta strandi412 – 415Combined sources4
Helixi416 – 423Combined sources8
Turni424 – 426Combined sources3
Beta strandi769 – 771Combined sources3
Beta strandi773 – 776Combined sources4
Beta strandi778 – 780Combined sources3
Helixi782 – 792Combined sources11
Beta strandi801 – 804Combined sources4
Beta strandi808 – 810Combined sources3
Helixi812 – 822Combined sources11
Turni833 – 836Combined sources4
Beta strandi838 – 841Combined sources4
Helixi842 – 852Combined sources11
Helixi854 – 856Combined sources3
Beta strandi883 – 886Combined sources4
Helixi894 – 904Combined sources11
Beta strandi908 – 910Combined sources3
Beta strandi912 – 915Combined sources4
Beta strandi917 – 919Combined sources3
Helixi921 – 930Combined sources10
Turni940 – 942Combined sources3
Beta strandi945 – 948Combined sources4
Helixi949 – 959Combined sources11

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ELMNMR-A768-797[»]
2ELNNMR-A796-826[»]
2ELONMR-A828-857[»]
2ELPNMR-A878-907[»]
2ELQNMR-A907-935[»]
2ELRNMR-A935-963[»]
2ELSNMR-A269-297[»]
2ELTNMR-A297-325[»]
2ELUNMR-A352-381[»]
2ELVNMR-A402-430[»]
2RSHNMR-A324-353[»]
2RSINMR-A297-381[»]
2RSJNMR-A269-353[»]
2RUTNMR-A269-297[»]
2RUUNMR-A297-325[»]
2RUVNMR-A323-353[»]
2RUWNMR-A352-381[»]
2RUXNMR-A402-430[»]
2RUYNMR-A768-797[»]
2RUZNMR-A796-826[»]
2RV0NMR-A828-857[»]
2RV1NMR-A878-907[»]
2RV2NMR-A907-935[»]
2RV3NMR-A935-963[»]
2RV6NMR-A269-353[»]
2RV7NMR-A297-381[»]
ProteinModelPortaliQ9P243.
SMRiQ9P243.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9P243.

Family & Domainsi

Sequence similaritiesi

Contains 19 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri12 – 35C2H2-type 1PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri116 – 141C2H2-type 2; degeneratePROSITE-ProRule annotationAdd BLAST26
Zinc fingeri271 – 293C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri299 – 321C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri326 – 349C2H2-type 5PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri354 – 377C2H2-type 6PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri404 – 426C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri432 – 454C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri458 – 481C2H2-type 9PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri742 – 764C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri770 – 793C2H2-type 11PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri798 – 822C2H2-type 12PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri830 – 853C2H2-type 13PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri880 – 903C2H2-type 14; degeneratePROSITE-ProRule annotationAdd BLAST24
Zinc fingeri909 – 931C2H2-type 15PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri937 – 959C2H2-type 16PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri966 – 988C2H2-type 17PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri994 – 1017C2H2-type 18PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri1041 – 1064C2H2-type 19PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129863.
HOGENOMiHOG000155776.
HOVERGENiHBG065928.
InParanoidiQ9P243.
OMAiTHQPDSC.
OrthoDBiEOG091G00PE.
PhylomeDBiQ9P243.
TreeFamiTF350017.

Family and domain databases

Gene3Di3.30.160.60. 10 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 19 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 10 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P243-1) [UniParc]FASTAAdd to basket
Also known as: ZFAT-1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METRAAENTA IFMCKCCNLF SPNQSELLSH VSEKHMEEGV NVDEIIIPLR
60 70 80 90 100
PLSTPEPPNS SKTGDEFLVM KRKRGRPKGS TKKSSTEEEL AENIVSPTED
110 120 130 140 150
SPLAPEEGNS LPPSSLECSK CCRKFSNTRQ LRKHICIIVL NLGEEEGEAG
160 170 180 190 200
NESDLELEKK CKEDDREKAS KRPRSQKTEK VQKISGKEAR QLSGAKKPII
210 220 230 240 250
SVVLTAHEAI PGATKIVPVE AGPPETGATN SETTSADLVP RRGYQEYAIQ
260 270 280 290 300
QTPYEQPMKS SRLGPTQLKI FTCEYCNKVF KFKHSLQAHL RIHTNEKPYK
310 320 330 340 350
CPQCSYASAI KANLNVHLRK HTGEKFACDY CSFTCLSKGH LKVHIERVHK
360 370 380 390 400
KIKQHCRFCK KKYSDVKNLI KHIRDAHDPQ DKKVKEALDE LCLMTREGKR
410 420 430 440 450
QLLYDCHICE RKFKNELDRD RHMLVHGDKW PFACELCGHG ATKYQALELH
460 470 480 490 500
VRKHPFVYVC AVCRKKFVSS IRLRTHIKEV HGAAQEALVF TSSINQSFCL
510 520 530 540 550
LEPGGDIQQE ALGDQLQLVE EEFALQGVNA LKEEACPGDT QLEEGRKEPE
560 570 580 590 600
APGEMPAPAV HLASPQAEST ALPPCELETT VVSSSDLHSQ EVVSDDFLLK
610 620 630 640 650
NDTSSAEAHA APEKPPDMQH RSSVQTQGEV ITLLLSKAQS AGSDQESHGA
660 670 680 690 700
QSPLGEGQNM AVLSAGDPDP SRCLRSNPAE ASDLLPPVAG GGDTITHQPD
710 720 730 740 750
SCKAAPEHRS GITAFMKVLN SLQKKQMNTS LCERIRKVYG DLECEYCGKL
760 770 780 790 800
FWYQVHFDMH VRTHTREHLY YCSQCHYSSI TKNCLKRHVI QKHSNILLKC
810 820 830 840 850
PTDGCDYSTP DKYKLQAHLK VHTALDKRSY SCPVCEKSFS EDRLIKSHIK
860 870 880 890 900
TNHPEVSMST ISEVLGRRVQ LKGLIGKRAM KCPYCDFYFM KNGSDLQRHI
910 920 930 940 950
WAHEGVKPFK CSLCEYATRS KSNLKAHMNR HSTEKTHLCD MCGKKFKSKG
960 970 980 990 1000
TLKSHKLLHT ADGKQFKCTV CDYTAAQKPQ LLRHMEQHVS FKPFRCAHCH
1010 1020 1030 1040 1050
YSCNISGSLK RHYNRKHPNE EYANVGTGEL AAEVLIQQGG LKCPVCSFVY
1060 1070 1080 1090 1100
GTKWEFNRHL KNKHGLKVVE IDGDPKWETA TEAPEEPSTQ YLHITEAEED
1110 1120 1130 1140 1150
VQGTQAAVAA LQDLRYTSES GDRLDPTAVN ILQQIIELGA ETHDATALAS
1160 1170 1180 1190 1200
VVAMAPGTVT VVKQVTEEEP SSNHTVMIQE TVQQASVELA EQHHLVVSSD
1210 1220 1230 1240
DVEGIETVTV YTQGGEASEF IVYVQEAMQP VEEQAVEQPA QEL
Length:1,243
Mass (Da):139,034
Last modified:January 10, 2006 - v2
Checksum:iAF3E5339ED38D91C
GO
Isoform 2 (identifier: Q9P243-2) [UniParc]FASTAAdd to basket
Also known as: ZFAT-2, ZFAT-3

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: Missing.

Show »
Length:1,231
Mass (Da):137,698
Checksum:iC4BA114EEC3AF2A6
GO
Isoform 3 (identifier: Q9P243-3) [UniParc]FASTAAdd to basket
Also known as: TR-ZFAT

The sequence of this isoform differs from the canonical sequence as follows:
     1-12: Missing.
     826-858: DKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSM → VSSKPKRQPRLPWVLIAFSSLCLYVGVSAAGQP
     859-1243: Missing.

Show »
Length:846
Mass (Da):94,437
Checksum:iDD3B6FD75DEEF958
GO
Isoform 4 (identifier: Q9P243-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     150-211: Missing.

Note: No experimental confirmation available.
Show »
Length:1,181
Mass (Da):132,137
Checksum:i8CC03D90ACB3DD3B
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02484064G → R.2 PublicationsCorresponds to variant rs17778003dbSNPEnsembl.1
Natural variantiVAR_045815102P → S.1 PublicationCorresponds to variant rs12541381dbSNPEnsembl.1
Natural variantiVAR_052819672R → K.Corresponds to variant rs35003767dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0169591 – 12Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_045461150 – 211Missing in isoform 4. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_034938826 – 858DKRSY…PEVSM → VSSKPKRQPRLPWVLIAFSS LCLYVGVSAAGQP in isoform 3. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_034939859 – 1243Missing in isoform 3. 1 PublicationAdd BLAST385

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB167738 mRNA. Translation: BAD12567.1.
AB167739 mRNA. Translation: BAD12568.1.
AB167740 mRNA. Translation: BAD12569.1.
AB167741 mRNA. Translation: BAD12570.1.
AC015599 Genomic DNA. No translation available.
AC087045 Genomic DNA. No translation available.
AC135075 Genomic DNA. No translation available.
BC025423 mRNA. Translation: AAH25423.1.
BC046180 mRNA. Translation: AAH46180.1.
BC101766 mRNA. Translation: AAI01767.1.
BC101768 mRNA. Translation: AAI01769.1.
BC143519 mRNA. Translation: AAI43520.1.
AB040918 mRNA. Translation: BAA96009.1.
CCDSiCCDS43768.2. [Q9P243-2]
CCDS47924.1. [Q9P243-1]
CCDS55276.1. [Q9P243-4]
RefSeqiNP_001025110.2. NM_001029939.3. [Q9P243-2]
NP_001167628.1. NM_001174157.1. [Q9P243-4]
NP_001276323.1. NM_001289394.1. [Q9P243-2]
NP_065914.2. NM_020863.3. [Q9P243-1]
XP_011515505.1. XM_011517203.1. [Q9P243-2]
UniGeneiHs.446172.

Genome annotation databases

EnsembliENST00000377838; ENSP00000367069; ENSG00000066827. [Q9P243-1]
ENST00000520214; ENSP00000428483; ENSG00000066827. [Q9P243-2]
ENST00000520727; ENSP00000427831; ENSG00000066827. [Q9P243-2]
ENST00000523399; ENSP00000429091; ENSG00000066827. [Q9P243-4]
GeneIDi57623.
KEGGihsa:57623.
UCSCiuc003yun.4. human. [Q9P243-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB167738 mRNA. Translation: BAD12567.1.
AB167739 mRNA. Translation: BAD12568.1.
AB167740 mRNA. Translation: BAD12569.1.
AB167741 mRNA. Translation: BAD12570.1.
AC015599 Genomic DNA. No translation available.
AC087045 Genomic DNA. No translation available.
AC135075 Genomic DNA. No translation available.
BC025423 mRNA. Translation: AAH25423.1.
BC046180 mRNA. Translation: AAH46180.1.
BC101766 mRNA. Translation: AAI01767.1.
BC101768 mRNA. Translation: AAI01769.1.
BC143519 mRNA. Translation: AAI43520.1.
AB040918 mRNA. Translation: BAA96009.1.
CCDSiCCDS43768.2. [Q9P243-2]
CCDS47924.1. [Q9P243-1]
CCDS55276.1. [Q9P243-4]
RefSeqiNP_001025110.2. NM_001029939.3. [Q9P243-2]
NP_001167628.1. NM_001174157.1. [Q9P243-4]
NP_001276323.1. NM_001289394.1. [Q9P243-2]
NP_065914.2. NM_020863.3. [Q9P243-1]
XP_011515505.1. XM_011517203.1. [Q9P243-2]
UniGeneiHs.446172.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ELMNMR-A768-797[»]
2ELNNMR-A796-826[»]
2ELONMR-A828-857[»]
2ELPNMR-A878-907[»]
2ELQNMR-A907-935[»]
2ELRNMR-A935-963[»]
2ELSNMR-A269-297[»]
2ELTNMR-A297-325[»]
2ELUNMR-A352-381[»]
2ELVNMR-A402-430[»]
2RSHNMR-A324-353[»]
2RSINMR-A297-381[»]
2RSJNMR-A269-353[»]
2RUTNMR-A269-297[»]
2RUUNMR-A297-325[»]
2RUVNMR-A323-353[»]
2RUWNMR-A352-381[»]
2RUXNMR-A402-430[»]
2RUYNMR-A768-797[»]
2RUZNMR-A796-826[»]
2RV0NMR-A828-857[»]
2RV1NMR-A878-907[»]
2RV2NMR-A907-935[»]
2RV3NMR-A935-963[»]
2RV6NMR-A269-353[»]
2RV7NMR-A297-381[»]
ProteinModelPortaliQ9P243.
SMRiQ9P243.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121669. 2 interactors.
IntActiQ9P243. 3 interactors.
STRINGi9606.ENSP00000367069.

PTM databases

iPTMnetiQ9P243.
PhosphoSitePlusiQ9P243.

Polymorphism and mutation databases

BioMutaiZFAT.
DMDMi85681862.

Proteomic databases

EPDiQ9P243.
MaxQBiQ9P243.
PaxDbiQ9P243.
PeptideAtlasiQ9P243.
PRIDEiQ9P243.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377838; ENSP00000367069; ENSG00000066827. [Q9P243-1]
ENST00000520214; ENSP00000428483; ENSG00000066827. [Q9P243-2]
ENST00000520727; ENSP00000427831; ENSG00000066827. [Q9P243-2]
ENST00000523399; ENSP00000429091; ENSG00000066827. [Q9P243-4]
GeneIDi57623.
KEGGihsa:57623.
UCSCiuc003yun.4. human. [Q9P243-1]

Organism-specific databases

CTDi57623.
DisGeNETi57623.
GeneCardsiZFAT.
HGNCiHGNC:19899. ZFAT.
HPAiHPA020989.
HPA063592.
MalaCardsiZFAT.
MIMi610931. gene.
neXtProtiNX_Q9P243.
OpenTargetsiENSG00000066827.
PharmGKBiPA162409638.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129863.
HOGENOMiHOG000155776.
HOVERGENiHBG065928.
InParanoidiQ9P243.
OMAiTHQPDSC.
OrthoDBiEOG091G00PE.
PhylomeDBiQ9P243.
TreeFamiTF350017.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000066827-MONOMER.

Miscellaneous databases

ChiTaRSiZFAT. human.
EvolutionaryTraceiQ9P243.
GenomeRNAii57623.
PROiQ9P243.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000066827.
CleanExiHS_ZFAT.
ExpressionAtlasiQ9P243. baseline and differential.
GenevisibleiQ9P243. HS.

Family and domain databases

Gene3Di3.30.160.60. 10 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 19 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 10 hits.
PS50157. ZINC_FINGER_C2H2_2. 13 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZFAT_HUMAN
AccessioniPrimary (citable) accession number: Q9P243
Secondary accession number(s): B7ZL15
, E9PER3, Q3MIM5, Q6PJ01, Q75PJ6, Q75PJ7, Q75PJ9, Q86X64
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2003
Last sequence update: January 10, 2006
Last modified: November 30, 2016
This is version 144 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.