Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P243

- ZFAT_HUMAN

UniProt

Q9P243 - ZFAT_HUMAN

Protein

Zinc finger protein ZFAT

Gene

ZFAT

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 120 (01 Oct 2014)
      Sequence version 2 (10 Jan 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May be involved in transcriptional regulation. Overexpression causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri12 – 3524C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri116 – 14126C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri271 – 29323C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri299 – 32123C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri326 – 34924C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri354 – 37724C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri404 – 42623C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri432 – 45423C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri458 – 48124C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri742 – 76423C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri770 – 79324C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri798 – 82225C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri830 – 85324C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri880 – 90324C2H2-type 14; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri909 – 93123C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri937 – 95923C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri966 – 98823C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri994 – 101724C2H2-type 18PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1041 – 106424C2H2-type 19PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW
    2. metal ion binding Source: UniProtKB-KW
    3. RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription Source: Ensembl

    GO - Biological processi

    1. hematopoietic progenitor cell differentiation Source: Ensembl
    2. spongiotrophoblast layer development Source: Ensembl

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc finger protein ZFAT
    Alternative name(s):
    Zinc finger gene in AITD susceptibility region
    Zinc finger protein 406
    Gene namesi
    Name:ZFAT
    Synonyms:KIAA1485, ZFAT1, ZNF406
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:19899. ZFAT.

    Subcellular locationi

    Nucleus By similarity. Cytoplasmcytosol By similarity

    GO - Cellular componenti

    1. cytosol Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162409638.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12431243Zinc finger protein ZFATPRO_0000047566Add
    BLAST

    Proteomic databases

    MaxQBiQ9P243.
    PaxDbiQ9P243.
    PRIDEiQ9P243.

    PTM databases

    PhosphoSiteiQ9P243.

    Expressioni

    Tissue specificityi

    Isoform 1 is strongly expressed in placenta, spleen, kidney, testis and peripheral blood leukocytes. Expressed in CD4+ and CD8+ T-cells, CD19+ B-cells and CB14+ monocytes. Isoform 3 is strongly expressed in placenta, ovary, tonsil, CD19+ B-cells and CD14+ monocytes.1 Publication

    Gene expression databases

    ArrayExpressiQ9P243.
    BgeeiQ9P243.
    CleanExiHS_ZFAT.
    GenevestigatoriQ9P243.

    Organism-specific databases

    HPAiHPA020989.

    Interactioni

    Protein-protein interaction databases

    BioGridi121669. 1 interaction.
    IntActiQ9P243. 2 interactions.
    STRINGi9606.ENSP00000367069.

    Structurei

    Secondary structure

    1
    1243
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni274 – 2763
    Beta strandi279 – 2824
    Helixi283 – 29311
    Beta strandi298 – 3003
    Beta strandi302 – 3054
    Beta strandi307 – 3104
    Helixi311 – 32111
    Beta strandi329 – 3313
    Beta strandi334 – 3363
    Helixi338 – 34710
    Turni357 – 3593
    Beta strandi362 – 3654
    Helixi366 – 37510
    Beta strandi407 – 4093
    Beta strandi412 – 4154
    Helixi416 – 4238
    Turni424 – 4263
    Beta strandi769 – 7713
    Beta strandi773 – 7764
    Beta strandi778 – 7803
    Helixi782 – 79211
    Beta strandi801 – 8044
    Beta strandi808 – 8103
    Helixi812 – 82211
    Turni833 – 8364
    Helixi842 – 85211
    Beta strandi883 – 8864
    Helixi894 – 90411
    Beta strandi908 – 9103
    Beta strandi912 – 9154
    Beta strandi917 – 9193
    Helixi921 – 93010
    Turni940 – 9423
    Helixi949 – 95911

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2ELMNMR-A768-797[»]
    2ELNNMR-A796-826[»]
    2ELONMR-A828-857[»]
    2ELPNMR-A878-907[»]
    2ELQNMR-A907-935[»]
    2ELRNMR-A935-963[»]
    2ELSNMR-A269-297[»]
    2ELTNMR-A297-325[»]
    2ELUNMR-A352-381[»]
    2ELVNMR-A402-430[»]
    2RSHNMR-A324-353[»]
    2RSINMR-A297-381[»]
    2RSJNMR-A269-353[»]
    ProteinModelPortaliQ9P243.
    SMRiQ9P243. Positions 269-485, 743-1064.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9P243.

    Family & Domainsi

    Sequence similaritiesi

    Contains 19 C2H2-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri12 – 3524C2H2-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri116 – 14126C2H2-type 2; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri271 – 29323C2H2-type 3PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri299 – 32123C2H2-type 4PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri326 – 34924C2H2-type 5PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri354 – 37724C2H2-type 6PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri404 – 42623C2H2-type 7PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri432 – 45423C2H2-type 8PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri458 – 48124C2H2-type 9PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri742 – 76423C2H2-type 10PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri770 – 79324C2H2-type 11PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri798 – 82225C2H2-type 12PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri830 – 85324C2H2-type 13PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri880 – 90324C2H2-type 14; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri909 – 93123C2H2-type 15PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri937 – 95923C2H2-type 16PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri966 – 98823C2H2-type 17PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri994 – 101724C2H2-type 18PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1041 – 106424C2H2-type 19PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiCOG5048.
    HOVERGENiHBG065928.
    InParanoidiQ9P243.
    OMAiHMEQHVS.
    PhylomeDBiQ9P243.
    TreeFamiTF350017.

    Family and domain databases

    Gene3Di3.30.160.60. 8 hits.
    InterProiIPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view]
    PfamiPF00096. zf-C2H2. 3 hits.
    [Graphical view]
    SMARTiSM00355. ZnF_C2H2. 19 hits.
    [Graphical view]
    PROSITEiPS00028. ZINC_FINGER_C2H2_1. 10 hits.
    PS50157. ZINC_FINGER_C2H2_2. 13 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P243-1) [UniParc]FASTAAdd to Basket

    Also known as: ZFAT-1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    METRAAENTA IFMCKCCNLF SPNQSELLSH VSEKHMEEGV NVDEIIIPLR     50
    PLSTPEPPNS SKTGDEFLVM KRKRGRPKGS TKKSSTEEEL AENIVSPTED 100
    SPLAPEEGNS LPPSSLECSK CCRKFSNTRQ LRKHICIIVL NLGEEEGEAG 150
    NESDLELEKK CKEDDREKAS KRPRSQKTEK VQKISGKEAR QLSGAKKPII 200
    SVVLTAHEAI PGATKIVPVE AGPPETGATN SETTSADLVP RRGYQEYAIQ 250
    QTPYEQPMKS SRLGPTQLKI FTCEYCNKVF KFKHSLQAHL RIHTNEKPYK 300
    CPQCSYASAI KANLNVHLRK HTGEKFACDY CSFTCLSKGH LKVHIERVHK 350
    KIKQHCRFCK KKYSDVKNLI KHIRDAHDPQ DKKVKEALDE LCLMTREGKR 400
    QLLYDCHICE RKFKNELDRD RHMLVHGDKW PFACELCGHG ATKYQALELH 450
    VRKHPFVYVC AVCRKKFVSS IRLRTHIKEV HGAAQEALVF TSSINQSFCL 500
    LEPGGDIQQE ALGDQLQLVE EEFALQGVNA LKEEACPGDT QLEEGRKEPE 550
    APGEMPAPAV HLASPQAEST ALPPCELETT VVSSSDLHSQ EVVSDDFLLK 600
    NDTSSAEAHA APEKPPDMQH RSSVQTQGEV ITLLLSKAQS AGSDQESHGA 650
    QSPLGEGQNM AVLSAGDPDP SRCLRSNPAE ASDLLPPVAG GGDTITHQPD 700
    SCKAAPEHRS GITAFMKVLN SLQKKQMNTS LCERIRKVYG DLECEYCGKL 750
    FWYQVHFDMH VRTHTREHLY YCSQCHYSSI TKNCLKRHVI QKHSNILLKC 800
    PTDGCDYSTP DKYKLQAHLK VHTALDKRSY SCPVCEKSFS EDRLIKSHIK 850
    TNHPEVSMST ISEVLGRRVQ LKGLIGKRAM KCPYCDFYFM KNGSDLQRHI 900
    WAHEGVKPFK CSLCEYATRS KSNLKAHMNR HSTEKTHLCD MCGKKFKSKG 950
    TLKSHKLLHT ADGKQFKCTV CDYTAAQKPQ LLRHMEQHVS FKPFRCAHCH 1000
    YSCNISGSLK RHYNRKHPNE EYANVGTGEL AAEVLIQQGG LKCPVCSFVY 1050
    GTKWEFNRHL KNKHGLKVVE IDGDPKWETA TEAPEEPSTQ YLHITEAEED 1100
    VQGTQAAVAA LQDLRYTSES GDRLDPTAVN ILQQIIELGA ETHDATALAS 1150
    VVAMAPGTVT VVKQVTEEEP SSNHTVMIQE TVQQASVELA EQHHLVVSSD 1200
    DVEGIETVTV YTQGGEASEF IVYVQEAMQP VEEQAVEQPA QEL 1243
    Length:1,243
    Mass (Da):139,034
    Last modified:January 10, 2006 - v2
    Checksum:iAF3E5339ED38D91C
    GO
    Isoform 2 (identifier: Q9P243-2) [UniParc]FASTAAdd to Basket

    Also known as: ZFAT-2, ZFAT-3

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: Missing.

    Show »
    Length:1,231
    Mass (Da):137,698
    Checksum:iC4BA114EEC3AF2A6
    GO
    Isoform 3 (identifier: Q9P243-3) [UniParc]FASTAAdd to Basket

    Also known as: TR-ZFAT

    The sequence of this isoform differs from the canonical sequence as follows:
         1-12: Missing.
         826-858: DKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSM → VSSKPKRQPRLPWVLIAFSSLCLYVGVSAAGQP
         859-1243: Missing.

    Show »
    Length:846
    Mass (Da):94,437
    Checksum:iDD3B6FD75DEEF958
    GO
    Isoform 4 (identifier: Q9P243-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         150-211: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,181
    Mass (Da):132,137
    Checksum:i8CC03D90ACB3DD3B
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti64 – 641G → R.2 Publications
    Corresponds to variant rs17778003 [ dbSNP | Ensembl ].
    VAR_024840
    Natural varianti102 – 1021P → S.1 Publication
    Corresponds to variant rs12541381 [ dbSNP | Ensembl ].
    VAR_045815
    Natural varianti672 – 6721R → K.
    Corresponds to variant rs35003767 [ dbSNP | Ensembl ].
    VAR_052819

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1212Missing in isoform 2 and isoform 3. 1 PublicationVSP_016959Add
    BLAST
    Alternative sequencei150 – 21162Missing in isoform 4. 1 PublicationVSP_045461Add
    BLAST
    Alternative sequencei826 – 85833DKRSY…PEVSM → VSSKPKRQPRLPWVLIAFSS LCLYVGVSAAGQP in isoform 3. 1 PublicationVSP_034938Add
    BLAST
    Alternative sequencei859 – 1243385Missing in isoform 3. 1 PublicationVSP_034939Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB167738 mRNA. Translation: BAD12567.1.
    AB167739 mRNA. Translation: BAD12568.1.
    AB167740 mRNA. Translation: BAD12569.1.
    AB167741 mRNA. Translation: BAD12570.1.
    AC015599 Genomic DNA. No translation available.
    AC087045 Genomic DNA. No translation available.
    AC135075 Genomic DNA. No translation available.
    BC025423 mRNA. Translation: AAH25423.1.
    BC046180 mRNA. Translation: AAH46180.1.
    BC101766 mRNA. Translation: AAI01767.1.
    BC101768 mRNA. Translation: AAI01769.1.
    BC143519 mRNA. Translation: AAI43520.1.
    AB040918 mRNA. Translation: BAA96009.1.
    CCDSiCCDS43768.2. [Q9P243-2]
    CCDS47924.1. [Q9P243-1]
    CCDS55276.1. [Q9P243-4]
    RefSeqiNP_001025110.2. NM_001029939.3. [Q9P243-2]
    NP_001167628.1. NM_001174157.1. [Q9P243-4]
    NP_001276323.1. NM_001289394.1. [Q9P243-2]
    NP_065914.2. NM_020863.3. [Q9P243-1]
    UniGeneiHs.446172.

    Genome annotation databases

    EnsembliENST00000377838; ENSP00000367069; ENSG00000066827. [Q9P243-1]
    ENST00000520214; ENSP00000428483; ENSG00000066827. [Q9P243-2]
    ENST00000520727; ENSP00000427831; ENSG00000066827. [Q9P243-2]
    ENST00000523399; ENSP00000429091; ENSG00000066827. [Q9P243-4]
    GeneIDi57623.
    KEGGihsa:57623.
    UCSCiuc003yun.3. human. [Q9P243-1]
    uc003yur.3. human. [Q9P243-3]

    Polymorphism databases

    DMDMi85681862.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB167738 mRNA. Translation: BAD12567.1 .
    AB167739 mRNA. Translation: BAD12568.1 .
    AB167740 mRNA. Translation: BAD12569.1 .
    AB167741 mRNA. Translation: BAD12570.1 .
    AC015599 Genomic DNA. No translation available.
    AC087045 Genomic DNA. No translation available.
    AC135075 Genomic DNA. No translation available.
    BC025423 mRNA. Translation: AAH25423.1 .
    BC046180 mRNA. Translation: AAH46180.1 .
    BC101766 mRNA. Translation: AAI01767.1 .
    BC101768 mRNA. Translation: AAI01769.1 .
    BC143519 mRNA. Translation: AAI43520.1 .
    AB040918 mRNA. Translation: BAA96009.1 .
    CCDSi CCDS43768.2. [Q9P243-2 ]
    CCDS47924.1. [Q9P243-1 ]
    CCDS55276.1. [Q9P243-4 ]
    RefSeqi NP_001025110.2. NM_001029939.3. [Q9P243-2 ]
    NP_001167628.1. NM_001174157.1. [Q9P243-4 ]
    NP_001276323.1. NM_001289394.1. [Q9P243-2 ]
    NP_065914.2. NM_020863.3. [Q9P243-1 ]
    UniGenei Hs.446172.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2ELM NMR - A 768-797 [» ]
    2ELN NMR - A 796-826 [» ]
    2ELO NMR - A 828-857 [» ]
    2ELP NMR - A 878-907 [» ]
    2ELQ NMR - A 907-935 [» ]
    2ELR NMR - A 935-963 [» ]
    2ELS NMR - A 269-297 [» ]
    2ELT NMR - A 297-325 [» ]
    2ELU NMR - A 352-381 [» ]
    2ELV NMR - A 402-430 [» ]
    2RSH NMR - A 324-353 [» ]
    2RSI NMR - A 297-381 [» ]
    2RSJ NMR - A 269-353 [» ]
    ProteinModelPortali Q9P243.
    SMRi Q9P243. Positions 269-485, 743-1064.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121669. 1 interaction.
    IntActi Q9P243. 2 interactions.
    STRINGi 9606.ENSP00000367069.

    PTM databases

    PhosphoSitei Q9P243.

    Polymorphism databases

    DMDMi 85681862.

    Proteomic databases

    MaxQBi Q9P243.
    PaxDbi Q9P243.
    PRIDEi Q9P243.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000377838 ; ENSP00000367069 ; ENSG00000066827 . [Q9P243-1 ]
    ENST00000520214 ; ENSP00000428483 ; ENSG00000066827 . [Q9P243-2 ]
    ENST00000520727 ; ENSP00000427831 ; ENSG00000066827 . [Q9P243-2 ]
    ENST00000523399 ; ENSP00000429091 ; ENSG00000066827 . [Q9P243-4 ]
    GeneIDi 57623.
    KEGGi hsa:57623.
    UCSCi uc003yun.3. human. [Q9P243-1 ]
    uc003yur.3. human. [Q9P243-3 ]

    Organism-specific databases

    CTDi 57623.
    GeneCardsi GC08M135561.
    HGNCi HGNC:19899. ZFAT.
    HPAi HPA020989.
    MIMi 610931. gene.
    neXtProti NX_Q9P243.
    PharmGKBi PA162409638.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5048.
    HOVERGENi HBG065928.
    InParanoidi Q9P243.
    OMAi HMEQHVS.
    PhylomeDBi Q9P243.
    TreeFami TF350017.

    Miscellaneous databases

    ChiTaRSi ZFAT. human.
    EvolutionaryTracei Q9P243.
    GenomeRNAii 57623.
    NextBioi 64310.
    PROi Q9P243.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9P243.
    Bgeei Q9P243.
    CleanExi HS_ZFAT.
    Genevestigatori Q9P243.

    Family and domain databases

    Gene3Di 3.30.160.60. 8 hits.
    InterProi IPR007087. Znf_C2H2.
    IPR015880. Znf_C2H2-like.
    IPR013087. Znf_C2H2/integrase_DNA-bd.
    [Graphical view ]
    Pfami PF00096. zf-C2H2. 3 hits.
    [Graphical view ]
    SMARTi SM00355. ZnF_C2H2. 19 hits.
    [Graphical view ]
    PROSITEi PS00028. ZINC_FINGER_C2H2_1. 10 hits.
    PS50157. ZINC_FINGER_C2H2_2. 13 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "SNPs in the promoter of a B cell-specific antisense transcript, SAS-ZFAT, determine susceptibility to autoimmune thyroid disease."
      Shirasawa S., Harada H., Furugaki K., Akamizu T., Ishikawa N., Ito K., Ito K., Tamai H., Kuma K., Kubota S., Hiratani H., Tsuchiya T., Baba I., Ishikawa M., Tanaka M., Sakai K., Aoki M., Yamamoto K., Sasazuki T.
      Hum. Mol. Genet. 13:2221-2231(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY, VARIANTS ARG-64 AND SER-102.
    2. "DNA sequence and analysis of human chromosome 8."
      Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T.
      , Blechschmidt K., Bloom T., Borowsky M.L., Butler J., Cook A., Corum B., DeArellano K., DeCaprio D., Dooley K.T., Dorris L. III, Engels R., Gloeckner G., Hafez N., Hagopian D.S., Hall J.L., Ishikawa S.K., Jaffe D.B., Kamat A., Kudoh J., Lehmann R., Lokitsang T., Macdonald P., Major J.E., Matthews C.D., Mauceli E., Menzel U., Mihalev A.H., Minoshima S., Murayama Y., Naylor J.W., Nicol R., Nguyen C., O'Leary S.B., O'Neill K., Parker S.C.J., Polley A., Raymond C.K., Reichwald K., Rodriguez J., Sasaki T., Schilhabel M., Siddiqui R., Smith C.L., Sneddon T.P., Talamas J.A., Tenzin P., Topham K., Venkataraman V., Wen G., Yamazaki S., Young S.K., Zeng Q., Zimmer A.R., Rosenthal A., Birren B.W., Platzer M., Shimizu N., Lander E.S.
      Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANTS ARG-64 AND SER_102.
      Tissue: Brain, Placenta and Skin.
    4. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 140-1243 (ISOFORM 1).
      Tissue: Brain.
    5. RIKEN structural genomics initiative (RSGI)
      Submitted (MAR-2007) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 269-325; 352-381; 398-430; 768-826; 828-857 AND 878-963.

    Entry informationi

    Entry nameiZFAT_HUMAN
    AccessioniPrimary (citable) accession number: Q9P243
    Secondary accession number(s): B7ZL15
    , E9PER3, Q3MIM5, Q6PJ01, Q75PJ6, Q75PJ7, Q75PJ9, Q86X64
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 19, 2003
    Last sequence update: January 10, 2006
    Last modified: October 1, 2014
    This is version 120 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3