Q9P243 (ZFAT_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein ZFAT Alternative name(s): Zinc finger gene in AITD susceptibility region Zinc finger protein 406 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1243 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May be involved in transcriptional regulation. Overexpression causes down-regulation of a number of genes involved in the immune response. Some genes are also up-regulated By similarity. |
| Subcellular location | |
| Tissue specificity | Isoform 1 is strongly expressed in placenta, spleen, kidney, testis and peripheral blood leukocytes. Expressed in CD4+ and CD8+ T-cells, CD19+ B-cells and CB14+ monocytes. Isoform 3 is strongly expressed in placenta, ovary, tonsil, CD19+ B-cells and CD14+ monocytes. Ref.1 |
| Sequence similarities | Contains 19 C2H2-type zinc fingers. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P243-1) Also known as: ZFAT-1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P243-2) Also known as: ZFAT-2; ZFAT-3; The sequence of this isoform differs from the canonical sequence as follows: 1-12: Missing. | ||||||
| Isoform 3 (identifier: Q9P243-3) Also known as: TR-ZFAT; The sequence of this isoform differs from the canonical sequence as follows: 1-12: Missing. 826-858: DKRSYSCPVCEKSFSEDRLIKSHIKTNHPEVSM → VSSKPKRQPRLPWVLIAFSSLCLYVGVSAAGQP 859-1243: Missing. | ||||||
| Isoform 4 (identifier: Q9P243-4) The sequence of this isoform differs from the canonical sequence as follows: 150-211: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1243 | 1243 | Zinc finger protein ZFAT | PRO_0000047566 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 12 – 35 | 24 | C2H2-type 1 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 116 – 141 | 26 | C2H2-type 2; degenerate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 271 – 293 | 23 | C2H2-type 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 299 – 321 | 23 | C2H2-type 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 326 – 349 | 24 | C2H2-type 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 354 – 377 | 24 | C2H2-type 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 404 – 426 | 23 | C2H2-type 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 432 – 454 | 23 | C2H2-type 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 458 – 481 | 24 | C2H2-type 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 742 – 764 | 23 | C2H2-type 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 770 – 793 | 24 | C2H2-type 11 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 798 – 822 | 25 | C2H2-type 12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 830 – 853 | 24 | C2H2-type 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 880 – 903 | 24 | C2H2-type 14; degenerate | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 909 – 931 | 23 | C2H2-type 15 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 937 – 959 | 23 | C2H2-type 16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 966 – 988 | 23 | C2H2-type 17 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 994 – 1017 | 24 | C2H2-type 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Zinc finger | 1041 – 1064 | 24 | C2H2-type 19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 12 | 12 | Missing in isoform 2 and isoform 3. | VSP_016959 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 150 – 211 | 62 | Missing in isoform 4. | VSP_045461 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 826 – 858 | 33 | DKRSY…PEVSM → VSSKPKRQPRLPWVLIAFSS LCLYVGVSAAGQP in isoform 3. | VSP_034938 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 859 – 1243 | 385 | Missing in isoform 3. | VSP_034939 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 64 | 1 | G → R. Ref.1 Ref.3 Corresponds to variant rs17778003 [ dbSNP | Ensembl ]. | VAR_024840 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 102 | 1 | P → S. Ref.1 Corresponds to variant rs12541381 [ dbSNP | Ensembl ]. | VAR_045815 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 672 | 1 | R → K. Corresponds to variant rs35003767 [ dbSNP | Ensembl ]. | VAR_052819 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 274 – 276 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 279 – 282 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 283 – 293 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 298 – 300 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 302 – 305 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 307 – 310 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 311 – 321 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 357 – 359 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 366 – 375 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 407 – 409 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 412 – 415 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 416 – 423 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 424 – 426 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 769 – 771 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 773 – 776 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 778 – 780 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 782 – 792 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 801 – 804 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 808 – 810 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 812 – 822 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 833 – 836 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 842 – 852 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 883 – 886 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 894 – 904 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 908 – 910 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 912 – 915 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 917 – 919 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 921 – 930 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 940 – 942 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 949 – 959 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "SNPs in the promoter of a B cell-specific antisense transcript, SAS-ZFAT, determine susceptibility to autoimmune thyroid disease." Shirasawa S., Harada H., Furugaki K., Akamizu T., Ishikawa N., Ito K., Ito K., Tamai H., Kuma K., Kubota S., Hiratani H., Tsuchiya T., Baba I., Ishikawa M., Tanaka M., Sakai K., Aoki M., Yamamoto K., Sasazuki T. Hum. Mol. Genet. 13:2221-2231(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY, VARIANTS ARG-64 AND SER-102. |
| [2] | "DNA sequence and analysis of human chromosome 8." Nusbaum C., Mikkelsen T.S., Zody M.C., Asakawa S., Taudien S., Garber M., Kodira C.D., Schueler M.G., Shimizu A., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Allen N.R., Anderson S., Asakawa T. Lander E.S.Nature 439:331-335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4), VARIANTS ARG-64 AND SER_102. Tissue: Brain, Placenta and Skin. |
| [4] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 140-1243 (ISOFORM 1). Tissue: Brain. |
| [5] | RIKEN structural genomics initiative (RSGI) Submitted (MAR-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 269-325; 352-381; 398-430; 768-826; 828-857 AND 878-963. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AB167738 mRNA. Translation: BAD12567.1. AB167739 mRNA. Translation: BAD12568.1. AB167740 mRNA. Translation: BAD12569.1. AB167741 mRNA. Translation: BAD12570.1. AC015599 Genomic DNA. No translation available. AC087045 Genomic DNA. No translation available. AC135075 Genomic DNA. No translation available. BC025423 mRNA. Translation: AAH25423.1. BC046180 mRNA. Translation: AAH46180.1. BC101766 mRNA. Translation: AAI01767.1. BC101768 mRNA. Translation: AAI01769.1. BC143519 mRNA. Translation: AAI43520.1. AB040918 mRNA. Translation: BAA96009.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00418220. IPI00657655. IPI00956293. IPI00982757. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001025110.2. NM_001029939.3. NP_001167628.1. NM_001174157.1. NP_065914.2. NM_020863.3. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.446172. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9P243. 2 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000367069. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 85681862. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000377838; ENSP00000367069; ENSG00000066827. ENST00000520214; ENSP00000428483; ENSG00000066827. ENST00000520727; ENSP00000427831; ENSG00000066827. ENST00000523399; ENSP00000429091; ENSG00000066827. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 57623. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:57623. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc003yun.3. human. uc003yur.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 57623. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC08M135561. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:19899. ZFAT. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA020989. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 610931. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA162409638. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | COG5048. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG065928. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | GHLKVHV. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG49ZXNF. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_ZFAT. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000066827. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 3.30.160.60. 8 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00355. ZnF_C2H2. 19 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS00028. ZINC_FINGER_C2H2_1. 10 hits. PS50157. ZINC_FINGER_C2H2_2. 13 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | ZFAT. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9P243. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 57623. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 64310. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | ZFAT_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P243 Secondary accession number(s): B7ZL15 Q86X64 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
