Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P206

- K1522_HUMAN

UniProt

Q9P206 - K1522_HUMAN

Protein

Uncharacterized protein KIAA1522

Gene

KIAA1522

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 84 (01 Oct 2014)
      Sequence version 2 (13 Nov 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Uncharacterized protein KIAA1522
    Gene namesi
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:29301. KIAA1522.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671612.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 10351035Uncharacterized protein KIAA1522PRO_0000311246Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei145 – 1451Phosphoserine1 Publication
    Modified residuei215 – 2151Phosphoserine2 Publications
    Modified residuei339 – 3391Phosphoserine1 Publication
    Modified residuei342 – 3421Phosphoserine2 Publications
    Modified residuei404 – 4041PhosphoserineBy similarity
    Modified residuei545 – 5451Phosphoserine3 Publications
    Modified residuei593 – 5931Phosphothreonine1 Publication
    Modified residuei612 – 6121PhosphoserineBy similarity
    Modified residuei669 – 6691Phosphoserine2 Publications
    Modified residuei673 – 6731Phosphoserine1 Publication
    Modified residuei858 – 8581Phosphoserine2 Publications
    Modified residuei862 – 8621Phosphoserine2 Publications
    Modified residuei868 – 8681Phosphoserine1 Publication
    Modified residuei929 – 9291Phosphoserine3 Publications
    Modified residuei971 – 9711Phosphoserine2 Publications
    Modified residuei979 – 9791Phosphoserine3 Publications

    Keywords - PTMi

    Lipoprotein, Myristate, Phosphoprotein

    Proteomic databases

    MaxQBiQ9P206.
    PaxDbiQ9P206.
    PRIDEiQ9P206.

    PTM databases

    PhosphoSiteiQ9P206.

    Expressioni

    Gene expression databases

    BgeeiQ9P206.
    CleanExiHS_KIAA1522.
    GenevestigatoriQ9P206.

    Organism-specific databases

    HPAiHPA032050.
    HPA032051.

    Interactioni

    Protein-protein interaction databases

    BioGridi121685. 6 interactions.
    IntActiQ9P206. 3 interactions.
    STRINGi9606.ENSP00000383851.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9P206.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi154 – 1607Poly-Arg
    Compositional biasi319 – 431113Ser-richAdd
    BLAST
    Compositional biasi438 – 997560Pro-richAdd
    BLAST

    Phylogenomic databases

    eggNOGiNOG76260.
    HOGENOMiHOG000074189.
    HOVERGENiHBG108037.
    OMAiPPLTRPM.
    OrthoDBiEOG7QRQTM.
    PhylomeDBiQ9P206.
    TreeFamiTF333323.

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P206-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVVFVGRRLP ALLGLFKKKG SAKAENDKHL SVGPGQGPGS AVDEHQDNVF     50
    FPSGRPPHLE ELHTQAQEGL RSLQHQEKQK LNKGGWDHGD TQSIQSSRTG 100
    PDEDNISFCS QTTSYVAESS TAEDALSIRS EMIQRKGSTF RPHDSFPKSG 150
    KSGRRRRERR STVLGLPQHV QKELGLRNER EAPGTPRAPG ARDAVRIPTV 200
    DGRPRGTSGM GARVSLQALE AEAEAGAETE AMLQRHIDRV YRDDTFVGRS 250
    TGTRAPPLTR PMSLAVPGLT GGAGPAEPLS PAMSISPQAT YLSKLIPHAV 300
    LPPTVDVVAL GRCSLRTLSR CSLHSASPAS VRSLGRFSSV SSPQPRSRHP 350
    SSSSDTWSHS QSSDTIVSDG STLSSKGGSE GQPESSTASN SVVPPPQGGS 400
    GRGSPSGGST AEASDTLSIR SSGQLSGRSV SLRKLKRPPP PPRRTHSLHQ 450
    RGLAVPDGPL GLPPKPERKQ QPQLPRPPTT GGSEGAGAAP CPPNPANSWV 500
    PGLSPGGSRR PPRSPERTLS PSSGYSSQSG TPTLPPKGLA GPPASPGKAQ 550
    PPKPERVTSL RSPGASVSSS LTSLCSSSSD PAPSDRSGPQ ILTPLGDRFV 600
    IPPHPKVPAP FSPPPSKPRS PNPAAPALAA PAVVPGPVST TDASPQSPPT 650
    PQTTLTPLQE SPVISKDQSP PPSPPPSYHP PPPPTKKPEV VVEAPSASET 700
    AEEPLQDPNW PPPPPPAPEE QDLSMADFPP PEEAFFSVAS PEPAGPSGSP 750
    ELVSSPAASS SSATALQIQP PGSPDPPPAP PAPAPASSAP GHVAKLPQKE 800
    PVGCSKGGGP PREDVGAPLV TPSLLQMVRL RSVGAPGGAP TPALGPSAPQ 850
    KPLRRALSGR ASPVPAPSSG LHAAVRLKAC SLAASEGLSS AQPNGPPEAE 900
    PRPPQSPAST ASFIFSKGSR KLQLERPVSP ETQADLQRNL VAELRSISEQ 950
    RPPQAPKKSP KAPPPVARKP SVGVPPPASP SYPRAEPLTA PPTNGLPHTQ 1000
    DRTKRELAEN GGVLQLVGPE EKMGLPGSDS QKELA 1035
    Length:1,035
    Mass (Da):107,095
    Last modified:November 13, 2007 - v2
    Checksum:iCE674245F15108CE
    GO
    Isoform 2 (identifier: Q9P206-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-19: MVVFVGRRLPALLGLFKKK → MAARAPPAAP...KAKRAKGKGR

    Show »
    Length:1,094
    Mass (Da):113,062
    Checksum:i214DF1694FAB0174
    GO
    Isoform 3 (identifier: Q9P206-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-19: MVVFVGRRLPALLGLFKKK → MGNSHHKRKAPSGPRVRSFWRFGRSAKRPA

    Note: Initiator Met-1 is removed. Contains a N-myristoyl glycine at position 2.

    Show »
    Length:1,046
    Mass (Da):108,385
    Checksum:iA7DE212FF521F3A9
    GO
    Isoform 4 (identifier: Q9P206-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         137-1028: Missing.

    Show »
    Length:143
    Mass (Da):15,682
    Checksum:i243512E893E0151D
    GO

    Sequence cautioni

    The sequence BAA96046.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti57 – 571P → S.
    Corresponds to variant rs11803515 [ dbSNP | Ensembl ].
    VAR_037190
    Natural varianti114 – 1141S → P.
    Corresponds to variant rs3737994 [ dbSNP | Ensembl ].
    VAR_037191
    Natural varianti232 – 2321M → V.
    Corresponds to variant rs12730560 [ dbSNP | Ensembl ].
    VAR_037192
    Natural varianti310 – 3101L → I.
    Corresponds to variant rs11582639 [ dbSNP | Ensembl ].
    VAR_037193
    Natural varianti770 – 7701P → L.
    Corresponds to variant rs581875 [ dbSNP | Ensembl ].
    VAR_037194
    Natural varianti1021 – 10211E → K.
    Corresponds to variant rs675928 [ dbSNP | Ensembl ].
    VAR_037195

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 1919MVVFV…LFKKK → MAARAPPAAPAAEEPGNPGG PPRRKKSRSGASGLRRAFSW LRGKRRKKKAAGAEGAEPAA PRAKKAEDKAKRAKGKGR in isoform 2. 1 PublicationVSP_040217Add
    BLAST
    Alternative sequencei1 – 1919MVVFV…LFKKK → MGNSHHKRKAPSGPRVRSFW RFGRSAKRPA in isoform 3. CuratedVSP_041634Add
    BLAST
    Alternative sequencei137 – 1028892Missing in isoform 4. 1 PublicationVSP_043215Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB040955 mRNA. Translation: BAA96046.1. Different initiation.
    AK298965 mRNA. Translation: BAG61060.1.
    AC114489 Genomic DNA. No translation available.
    AI587184 mRNA. No translation available.
    AL713671 mRNA. Translation: CAD28477.2.
    CCDSiCCDS41298.1. [Q9P206-2]
    CCDS55588.1. [Q9P206-1]
    CCDS55589.1. [Q9P206-4]
    RefSeqiNP_001185901.1. NM_001198972.1. [Q9P206-1]
    NP_001185902.1. NM_001198973.1. [Q9P206-4]
    NP_065939.2. NM_020888.2. [Q9P206-2]
    XP_006710854.1. XM_006710791.1. [Q9P206-3]
    UniGeneiHs.591502.

    Genome annotation databases

    EnsembliENST00000294521; ENSP00000294521; ENSG00000162522. [Q9P206-4]
    ENST00000373480; ENSP00000362579; ENSG00000162522. [Q9P206-1]
    ENST00000373481; ENSP00000362580; ENSG00000162522. [Q9P206-3]
    ENST00000401073; ENSP00000383851; ENSG00000162522. [Q9P206-2]
    GeneIDi57648.
    KEGGihsa:57648.
    UCSCiuc001bvu.1. human. [Q9P206-2]
    uc001bvv.2. human. [Q9P206-1]
    uc010ohm.1. human. [Q9P206-3]
    uc010ohn.1. human. [Q9P206-4]

    Polymorphism databases

    DMDMi160395559.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB040955 mRNA. Translation: BAA96046.1 . Different initiation.
    AK298965 mRNA. Translation: BAG61060.1 .
    AC114489 Genomic DNA. No translation available.
    AI587184 mRNA. No translation available.
    AL713671 mRNA. Translation: CAD28477.2 .
    CCDSi CCDS41298.1. [Q9P206-2 ]
    CCDS55588.1. [Q9P206-1 ]
    CCDS55589.1. [Q9P206-4 ]
    RefSeqi NP_001185901.1. NM_001198972.1. [Q9P206-1 ]
    NP_001185902.1. NM_001198973.1. [Q9P206-4 ]
    NP_065939.2. NM_020888.2. [Q9P206-2 ]
    XP_006710854.1. XM_006710791.1. [Q9P206-3 ]
    UniGenei Hs.591502.

    3D structure databases

    ProteinModelPortali Q9P206.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121685. 6 interactions.
    IntActi Q9P206. 3 interactions.
    STRINGi 9606.ENSP00000383851.

    PTM databases

    PhosphoSitei Q9P206.

    Polymorphism databases

    DMDMi 160395559.

    Proteomic databases

    MaxQBi Q9P206.
    PaxDbi Q9P206.
    PRIDEi Q9P206.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000294521 ; ENSP00000294521 ; ENSG00000162522 . [Q9P206-4 ]
    ENST00000373480 ; ENSP00000362579 ; ENSG00000162522 . [Q9P206-1 ]
    ENST00000373481 ; ENSP00000362580 ; ENSG00000162522 . [Q9P206-3 ]
    ENST00000401073 ; ENSP00000383851 ; ENSG00000162522 . [Q9P206-2 ]
    GeneIDi 57648.
    KEGGi hsa:57648.
    UCSCi uc001bvu.1. human. [Q9P206-2 ]
    uc001bvv.2. human. [Q9P206-1 ]
    uc010ohm.1. human. [Q9P206-3 ]
    uc010ohn.1. human. [Q9P206-4 ]

    Organism-specific databases

    CTDi 57648.
    GeneCardsi GC01P033207.
    HGNCi HGNC:29301. KIAA1522.
    HPAi HPA032050.
    HPA032051.
    neXtProti NX_Q9P206.
    PharmGKBi PA142671612.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG76260.
    HOGENOMi HOG000074189.
    HOVERGENi HBG108037.
    OMAi PPLTRPM.
    OrthoDBi EOG7QRQTM.
    PhylomeDBi Q9P206.
    TreeFami TF333323.

    Miscellaneous databases

    ChiTaRSi KIAA1522. human.
    GenomeRNAii 57648.
    NextBioi 64386.

    Gene expression databases

    Bgeei Q9P206.
    CleanExi HS_KIAA1522.
    Genevestigatori Q9P206.

    Family and domain databases

    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Teratocarcinoma.
    3. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-77 (ISOFORM 2).
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 709-1035 (ISOFORM 1).
      Tissue: Mammary cancer.
    6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
      Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
      Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-339; SER-342 AND SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    8. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
      Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
      J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-929, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215; THR-593; SER-669; SER-673; SER-858; SER-862; SER-929; SER-971 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    12. "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system."
      Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T.
      Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: MYRISTOYLATION AT GLY-2 (ISOFORM 3).
    13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-145; SER-342; SER-545; SER-858; SER-862; SER-868; SER-929 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545; SER-669; SER-971 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiK1522_HUMAN
    AccessioniPrimary (citable) accession number: Q9P206
    Secondary accession number(s): B4DQU8
    , B5MDY0, C9JH84, Q8TCQ0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 13, 2007
    Last sequence update: November 13, 2007
    Last modified: October 1, 2014
    This is version 84 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations

    External Data

    Dasty 3