Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9P206 (K1522_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 81. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Uncharacterized protein KIAA1522
Gene names
Name:KIAA1522
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1035 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence caution

The sequence BAA96046.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
Polymorphism
   PTMLipoprotein
Myristate
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9P206-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9P206-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MVVFVGRRLPALLGLFKKK → MAARAPPAAP...KAKRAKGKGR
Isoform 3 (identifier: Q9P206-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MVVFVGRRLPALLGLFKKK → MGNSHHKRKAPSGPRVRSFWRFGRSAKRPA
Note: Initiator Met-1 is removed. Contains a N-myristoyl glycine at position 2.
Isoform 4 (identifier: Q9P206-4)

The sequence of this isoform differs from the canonical sequence as follows:
     137-1028: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 10351035Uncharacterized protein KIAA1522
PRO_0000311246

Regions

Compositional bias154 – 1607Poly-Arg
Compositional bias319 – 431113Ser-rich
Compositional bias438 – 997560Pro-rich

Amino acid modifications

Modified residue1451Phosphoserine Ref.13
Modified residue2151Phosphoserine Ref.9 Ref.11
Modified residue3391Phosphoserine Ref.7
Modified residue3421Phosphoserine Ref.7 Ref.13
Modified residue4041Phosphoserine By similarity
Modified residue5451Phosphoserine Ref.7 Ref.13 Ref.14
Modified residue5931Phosphothreonine Ref.9
Modified residue6121Phosphoserine By similarity
Modified residue6691Phosphoserine Ref.9 Ref.14
Modified residue6731Phosphoserine Ref.9
Modified residue8581Phosphoserine Ref.9 Ref.13
Modified residue8621Phosphoserine Ref.9 Ref.13
Modified residue8681Phosphoserine Ref.13
Modified residue9291Phosphoserine Ref.8 Ref.9 Ref.13
Modified residue9711Phosphoserine Ref.9 Ref.14
Modified residue9791Phosphoserine Ref.9 Ref.13 Ref.14

Natural variations

Alternative sequence1 – 1919MVVFV…LFKKK → MAARAPPAAPAAEEPGNPGG PPRRKKSRSGASGLRRAFSW LRGKRRKKKAAGAEGAEPAA PRAKKAEDKAKRAKGKGR in isoform 2.
VSP_040217
Alternative sequence1 – 1919MVVFV…LFKKK → MGNSHHKRKAPSGPRVRSFW RFGRSAKRPA in isoform 3.
VSP_041634
Alternative sequence137 – 1028892Missing in isoform 4.
VSP_043215
Natural variant571P → S.
Corresponds to variant rs11803515 [ dbSNP | Ensembl ].
VAR_037190
Natural variant1141S → P.
Corresponds to variant rs3737994 [ dbSNP | Ensembl ].
VAR_037191
Natural variant2321M → V.
Corresponds to variant rs12730560 [ dbSNP | Ensembl ].
VAR_037192
Natural variant3101L → I.
Corresponds to variant rs11582639 [ dbSNP | Ensembl ].
VAR_037193
Natural variant7701P → L.
Corresponds to variant rs581875 [ dbSNP | Ensembl ].
VAR_037194
Natural variant10211E → K.
Corresponds to variant rs675928 [ dbSNP | Ensembl ].
VAR_037195

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 13, 2007. Version 2.
Checksum: CE674245F15108CE

FASTA1,035107,095
        10         20         30         40         50         60 
MVVFVGRRLP ALLGLFKKKG SAKAENDKHL SVGPGQGPGS AVDEHQDNVF FPSGRPPHLE 

        70         80         90        100        110        120 
ELHTQAQEGL RSLQHQEKQK LNKGGWDHGD TQSIQSSRTG PDEDNISFCS QTTSYVAESS 

       130        140        150        160        170        180 
TAEDALSIRS EMIQRKGSTF RPHDSFPKSG KSGRRRRERR STVLGLPQHV QKELGLRNER 

       190        200        210        220        230        240 
EAPGTPRAPG ARDAVRIPTV DGRPRGTSGM GARVSLQALE AEAEAGAETE AMLQRHIDRV 

       250        260        270        280        290        300 
YRDDTFVGRS TGTRAPPLTR PMSLAVPGLT GGAGPAEPLS PAMSISPQAT YLSKLIPHAV 

       310        320        330        340        350        360 
LPPTVDVVAL GRCSLRTLSR CSLHSASPAS VRSLGRFSSV SSPQPRSRHP SSSSDTWSHS 

       370        380        390        400        410        420 
QSSDTIVSDG STLSSKGGSE GQPESSTASN SVVPPPQGGS GRGSPSGGST AEASDTLSIR 

       430        440        450        460        470        480 
SSGQLSGRSV SLRKLKRPPP PPRRTHSLHQ RGLAVPDGPL GLPPKPERKQ QPQLPRPPTT 

       490        500        510        520        530        540 
GGSEGAGAAP CPPNPANSWV PGLSPGGSRR PPRSPERTLS PSSGYSSQSG TPTLPPKGLA 

       550        560        570        580        590        600 
GPPASPGKAQ PPKPERVTSL RSPGASVSSS LTSLCSSSSD PAPSDRSGPQ ILTPLGDRFV 

       610        620        630        640        650        660 
IPPHPKVPAP FSPPPSKPRS PNPAAPALAA PAVVPGPVST TDASPQSPPT PQTTLTPLQE 

       670        680        690        700        710        720 
SPVISKDQSP PPSPPPSYHP PPPPTKKPEV VVEAPSASET AEEPLQDPNW PPPPPPAPEE 

       730        740        750        760        770        780 
QDLSMADFPP PEEAFFSVAS PEPAGPSGSP ELVSSPAASS SSATALQIQP PGSPDPPPAP 

       790        800        810        820        830        840 
PAPAPASSAP GHVAKLPQKE PVGCSKGGGP PREDVGAPLV TPSLLQMVRL RSVGAPGGAP 

       850        860        870        880        890        900 
TPALGPSAPQ KPLRRALSGR ASPVPAPSSG LHAAVRLKAC SLAASEGLSS AQPNGPPEAE 

       910        920        930        940        950        960 
PRPPQSPAST ASFIFSKGSR KLQLERPVSP ETQADLQRNL VAELRSISEQ RPPQAPKKSP 

       970        980        990       1000       1010       1020 
KAPPPVARKP SVGVPPPASP SYPRAEPLTA PPTNGLPHTQ DRTKRELAEN GGVLQLVGPE 

      1030 
EKMGLPGSDS QKELA 

« Hide

Isoform 2 [UniParc].

Checksum: 214DF1694FAB0174
Show »

FASTA1,094113,062
Isoform 3 [UniParc].

Checksum: A7DE212FF521F3A9
Show »

FASTA1,046108,385
Isoform 4 [UniParc].

Checksum: 243512E893E0151D
Show »

FASTA14315,682

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
Tissue: Teratocarcinoma.
[3]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-77 (ISOFORM 2).
[5]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 709-1035 (ISOFORM 1).
Tissue: Mammary cancer.
[6]"Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-339; SER-342 AND SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[8]"Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-929, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215; THR-593; SER-669; SER-673; SER-858; SER-862; SER-929; SER-971 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[11]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[12]"Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system."
Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T.
Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: MYRISTOYLATION AT GLY-2 (ISOFORM 3).
[13]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-145; SER-342; SER-545; SER-858; SER-862; SER-868; SER-929 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[14]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545; SER-669; SER-971 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB040955 mRNA. Translation: BAA96046.1. Different initiation.
AK298965 mRNA. Translation: BAG61060.1.
AC114489 Genomic DNA. No translation available.
AI587184 mRNA. No translation available.
AL713671 mRNA. Translation: CAD28477.2.
RefSeqNP_001185901.1. NM_001198972.1.
NP_001185902.1. NM_001198973.1.
NP_065939.2. NM_020888.2.
UniGeneHs.591502.

3D structure databases

ProteinModelPortalQ9P206.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121685. 5 interactions.
IntActQ9P206. 3 interactions.
STRING9606.ENSP00000383851.

PTM databases

PhosphoSiteQ9P206.

Polymorphism databases

DMDM160395559.

Proteomic databases

PaxDbQ9P206.
PRIDEQ9P206.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000294521; ENSP00000294521; ENSG00000162522. [Q9P206-4]
ENST00000373480; ENSP00000362579; ENSG00000162522. [Q9P206-1]
ENST00000373481; ENSP00000362580; ENSG00000162522. [Q9P206-3]
ENST00000401073; ENSP00000383851; ENSG00000162522. [Q9P206-2]
GeneID57648.
KEGGhsa:57648.
UCSCuc001bvu.1. human. [Q9P206-2]
uc001bvv.2. human. [Q9P206-1]
uc010ohm.1. human. [Q9P206-3]
uc010ohn.1. human. [Q9P206-4]

Organism-specific databases

CTD57648.
GeneCardsGC01P033207.
HGNCHGNC:29301. KIAA1522.
HPAHPA032050.
HPA032051.
neXtProtNX_Q9P206.
PharmGKBPA142671612.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG76260.
HOGENOMHOG000074189.
HOVERGENHBG108037.
OMAPPLTRPM.
OrthoDBEOG7QRQTM.
PhylomeDBQ9P206.
TreeFamTF333323.

Gene expression databases

BgeeQ9P206.
CleanExHS_KIAA1522.
GenevestigatorQ9P206.

Family and domain databases

ProtoNetSearch...

Other

ChiTaRSKIAA1522. human.
GenomeRNAi57648.
NextBio64386.

Entry information

Entry nameK1522_HUMAN
AccessionPrimary (citable) accession number: Q9P206
Secondary accession number(s): B4DQU8 expand/collapse secondary AC list , B5MDY0, C9JH84, Q8TCQ0
Entry history
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: April 16, 2014
This is version 81 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM