Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein KIAA1522

Gene

KIAA1522

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein KIAA1522
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:29301. KIAA1522.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671612.

Polymorphism and mutation databases

BioMutaiKIAA1522.
DMDMi160395559.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10351035Uncharacterized protein KIAA1522PRO_0000311246Add
BLAST
Isoform 3 (identifier: Q9P206-3)
Initiator methionineiRemoved

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei93 – 931PhosphoserineCombined sources
Modified residuei138 – 1381PhosphoserineCombined sources
Modified residuei145 – 1451PhosphoserineCombined sources
Modified residuei161 – 1611PhosphoserineCombined sources
Modified residuei162 – 1621PhosphothreonineCombined sources
Modified residuei215 – 2151PhosphoserineCombined sources
Modified residuei322 – 3221PhosphoserineCombined sources
Modified residuei327 – 3271PhosphoserineCombined sources
Modified residuei330 – 3301PhosphoserineBy similarity
Modified residuei338 – 3381PhosphoserineCombined sources
Modified residuei339 – 3391PhosphoserineCombined sources
Modified residuei341 – 3411PhosphoserineCombined sources
Modified residuei342 – 3421PhosphoserineCombined sources
Modified residuei400 – 4001PhosphoserineCombined sources
Modified residuei404 – 4041PhosphoserineBy similarity
Modified residuei409 – 4091PhosphoserineBy similarity
Modified residuei531 – 5311PhosphothreonineBy similarity
Modified residuei545 – 5451PhosphoserineCombined sources
Modified residuei593 – 5931PhosphothreonineCombined sources
Modified residuei612 – 6121PhosphoserineBy similarity
Modified residuei669 – 6691PhosphoserineCombined sources
Modified residuei673 – 6731PhosphoserineCombined sources
Modified residuei858 – 8581PhosphoserineCombined sources
Modified residuei862 – 8621PhosphoserineCombined sources
Modified residuei868 – 8681PhosphoserineCombined sources
Modified residuei929 – 9291PhosphoserineCombined sources
Modified residuei959 – 9591PhosphoserineCombined sources
Modified residuei971 – 9711PhosphoserineCombined sources
Modified residuei979 – 9791PhosphoserineCombined sources
Isoform 3 (identifier: Q9P206-3)
Lipidationi2 – 21N-myristoyl glycine

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

EPDiQ9P206.
MaxQBiQ9P206.
PaxDbiQ9P206.
PeptideAtlasiQ9P206.
PRIDEiQ9P206.

PTM databases

iPTMnetiQ9P206.
PhosphoSiteiQ9P206.

Expressioni

Gene expression databases

BgeeiENSG00000162522.
CleanExiHS_KIAA1522.
GenevisibleiQ9P206. HS.

Organism-specific databases

HPAiHPA032050.
HPA032051.
HPA064839.

Interactioni

Protein-protein interaction databases

BioGridi121685. 20 interactions.
IntActiQ9P206. 16 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9P206.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi154 – 1607Poly-Arg
Compositional biasi319 – 431113Ser-richAdd
BLAST
Compositional biasi438 – 997560Pro-richAdd
BLAST

Phylogenomic databases

eggNOGiENOG410IMX5. Eukaryota.
ENOG410YI5V. LUCA.
GeneTreeiENSGT00440000038119.
HOGENOMiHOG000074189.
HOVERGENiHBG108037.
InParanoidiQ9P206.
OMAiAVLQCHI.
OrthoDBiEOG091G00L6.
PhylomeDBiQ9P206.
TreeFamiTF333323.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P206-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVVFVGRRLP ALLGLFKKKG SAKAENDKHL SVGPGQGPGS AVDEHQDNVF
60 70 80 90 100
FPSGRPPHLE ELHTQAQEGL RSLQHQEKQK LNKGGWDHGD TQSIQSSRTG
110 120 130 140 150
PDEDNISFCS QTTSYVAESS TAEDALSIRS EMIQRKGSTF RPHDSFPKSG
160 170 180 190 200
KSGRRRRERR STVLGLPQHV QKELGLRNER EAPGTPRAPG ARDAVRIPTV
210 220 230 240 250
DGRPRGTSGM GARVSLQALE AEAEAGAETE AMLQRHIDRV YRDDTFVGRS
260 270 280 290 300
TGTRAPPLTR PMSLAVPGLT GGAGPAEPLS PAMSISPQAT YLSKLIPHAV
310 320 330 340 350
LPPTVDVVAL GRCSLRTLSR CSLHSASPAS VRSLGRFSSV SSPQPRSRHP
360 370 380 390 400
SSSSDTWSHS QSSDTIVSDG STLSSKGGSE GQPESSTASN SVVPPPQGGS
410 420 430 440 450
GRGSPSGGST AEASDTLSIR SSGQLSGRSV SLRKLKRPPP PPRRTHSLHQ
460 470 480 490 500
RGLAVPDGPL GLPPKPERKQ QPQLPRPPTT GGSEGAGAAP CPPNPANSWV
510 520 530 540 550
PGLSPGGSRR PPRSPERTLS PSSGYSSQSG TPTLPPKGLA GPPASPGKAQ
560 570 580 590 600
PPKPERVTSL RSPGASVSSS LTSLCSSSSD PAPSDRSGPQ ILTPLGDRFV
610 620 630 640 650
IPPHPKVPAP FSPPPSKPRS PNPAAPALAA PAVVPGPVST TDASPQSPPT
660 670 680 690 700
PQTTLTPLQE SPVISKDQSP PPSPPPSYHP PPPPTKKPEV VVEAPSASET
710 720 730 740 750
AEEPLQDPNW PPPPPPAPEE QDLSMADFPP PEEAFFSVAS PEPAGPSGSP
760 770 780 790 800
ELVSSPAASS SSATALQIQP PGSPDPPPAP PAPAPASSAP GHVAKLPQKE
810 820 830 840 850
PVGCSKGGGP PREDVGAPLV TPSLLQMVRL RSVGAPGGAP TPALGPSAPQ
860 870 880 890 900
KPLRRALSGR ASPVPAPSSG LHAAVRLKAC SLAASEGLSS AQPNGPPEAE
910 920 930 940 950
PRPPQSPAST ASFIFSKGSR KLQLERPVSP ETQADLQRNL VAELRSISEQ
960 970 980 990 1000
RPPQAPKKSP KAPPPVARKP SVGVPPPASP SYPRAEPLTA PPTNGLPHTQ
1010 1020 1030
DRTKRELAEN GGVLQLVGPE EKMGLPGSDS QKELA
Length:1,035
Mass (Da):107,095
Last modified:November 13, 2007 - v2
Checksum:iCE674245F15108CE
GO
Isoform 2 (identifier: Q9P206-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MVVFVGRRLPALLGLFKKK → MAARAPPAAP...KAKRAKGKGR

Show »
Length:1,094
Mass (Da):113,062
Checksum:i214DF1694FAB0174
GO
Isoform 3 (identifier: Q9P206-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MVVFVGRRLPALLGLFKKK → MGNSHHKRKAPSGPRVRSFWRFGRSAKRPA

Show »
Length:1,046
Mass (Da):108,385
Checksum:iA7DE212FF521F3A9
GO
Isoform 4 (identifier: Q9P206-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-1028: Missing.

Show »
Length:143
Mass (Da):15,682
Checksum:i243512E893E0151D
GO

Sequence cautioni

The sequence BAA96046 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti57 – 571P → S.
Corresponds to variant rs11803515 [ dbSNP | Ensembl ].
VAR_037190
Natural varianti114 – 1141S → P.
Corresponds to variant rs3737994 [ dbSNP | Ensembl ].
VAR_037191
Natural varianti232 – 2321M → V.
Corresponds to variant rs12730560 [ dbSNP | Ensembl ].
VAR_037192
Natural varianti310 – 3101L → I.
Corresponds to variant rs11582639 [ dbSNP | Ensembl ].
VAR_037193
Natural varianti770 – 7701P → L.
Corresponds to variant rs581875 [ dbSNP | Ensembl ].
VAR_037194
Natural varianti1021 – 10211E → K.
Corresponds to variant rs675928 [ dbSNP | Ensembl ].
VAR_037195

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1919MVVFV…LFKKK → MAARAPPAAPAAEEPGNPGG PPRRKKSRSGASGLRRAFSW LRGKRRKKKAAGAEGAEPAA PRAKKAEDKAKRAKGKGR in isoform 2. 1 PublicationVSP_040217Add
BLAST
Alternative sequencei1 – 1919MVVFV…LFKKK → MGNSHHKRKAPSGPRVRSFW RFGRSAKRPA in isoform 3. CuratedVSP_041634Add
BLAST
Alternative sequencei137 – 1028892Missing in isoform 4. 1 PublicationVSP_043215Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040955 mRNA. Translation: BAA96046.1. Different initiation.
AK298965 mRNA. Translation: BAG61060.1.
AC114489 Genomic DNA. No translation available.
AI587184 mRNA. No translation available.
AL713671 mRNA. Translation: CAD28477.2.
CCDSiCCDS41298.1. [Q9P206-2]
CCDS55588.1. [Q9P206-1]
CCDS55589.1. [Q9P206-4]
RefSeqiNP_001185901.1. NM_001198972.1. [Q9P206-1]
NP_001185902.1. NM_001198973.1. [Q9P206-4]
NP_065939.2. NM_020888.2. [Q9P206-2]
XP_006710854.1. XM_006710791.3. [Q9P206-3]
UniGeneiHs.591502.

Genome annotation databases

EnsembliENST00000294521; ENSP00000294521; ENSG00000162522. [Q9P206-4]
ENST00000373480; ENSP00000362579; ENSG00000162522. [Q9P206-1]
ENST00000373481; ENSP00000362580; ENSG00000162522. [Q9P206-3]
ENST00000401073; ENSP00000383851; ENSG00000162522. [Q9P206-2]
GeneIDi57648.
KEGGihsa:57648.
UCSCiuc001bvu.2. human. [Q9P206-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040955 mRNA. Translation: BAA96046.1. Different initiation.
AK298965 mRNA. Translation: BAG61060.1.
AC114489 Genomic DNA. No translation available.
AI587184 mRNA. No translation available.
AL713671 mRNA. Translation: CAD28477.2.
CCDSiCCDS41298.1. [Q9P206-2]
CCDS55588.1. [Q9P206-1]
CCDS55589.1. [Q9P206-4]
RefSeqiNP_001185901.1. NM_001198972.1. [Q9P206-1]
NP_001185902.1. NM_001198973.1. [Q9P206-4]
NP_065939.2. NM_020888.2. [Q9P206-2]
XP_006710854.1. XM_006710791.3. [Q9P206-3]
UniGeneiHs.591502.

3D structure databases

ProteinModelPortaliQ9P206.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121685. 20 interactions.
IntActiQ9P206. 16 interactions.

PTM databases

iPTMnetiQ9P206.
PhosphoSiteiQ9P206.

Polymorphism and mutation databases

BioMutaiKIAA1522.
DMDMi160395559.

Proteomic databases

EPDiQ9P206.
MaxQBiQ9P206.
PaxDbiQ9P206.
PeptideAtlasiQ9P206.
PRIDEiQ9P206.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294521; ENSP00000294521; ENSG00000162522. [Q9P206-4]
ENST00000373480; ENSP00000362579; ENSG00000162522. [Q9P206-1]
ENST00000373481; ENSP00000362580; ENSG00000162522. [Q9P206-3]
ENST00000401073; ENSP00000383851; ENSG00000162522. [Q9P206-2]
GeneIDi57648.
KEGGihsa:57648.
UCSCiuc001bvu.2. human. [Q9P206-1]

Organism-specific databases

CTDi57648.
GeneCardsiKIAA1522.
HGNCiHGNC:29301. KIAA1522.
HPAiHPA032050.
HPA032051.
HPA064839.
neXtProtiNX_Q9P206.
PharmGKBiPA142671612.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMX5. Eukaryota.
ENOG410YI5V. LUCA.
GeneTreeiENSGT00440000038119.
HOGENOMiHOG000074189.
HOVERGENiHBG108037.
InParanoidiQ9P206.
OMAiAVLQCHI.
OrthoDBiEOG091G00L6.
PhylomeDBiQ9P206.
TreeFamiTF333323.

Miscellaneous databases

ChiTaRSiKIAA1522. human.
GenomeRNAii57648.
PROiQ9P206.

Gene expression databases

BgeeiENSG00000162522.
CleanExiHS_KIAA1522.
GenevisibleiQ9P206. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiK1522_HUMAN
AccessioniPrimary (citable) accession number: Q9P206
Secondary accession number(s): B4DQU8
, B5MDY0, C9JH84, Q8TCQ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: September 7, 2016
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.