Q9P206 (K1522_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 72.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uncharacterized protein KIAA1522 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1035 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence caution | The sequence BAA96046.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Lipoprotein Myristate Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P206-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P206-2) The sequence of this isoform differs from the canonical sequence as follows: 1-19: MVVFVGRRLPALLGLFKKK → MAARAPPAAP...KAKRAKGKGR | ||||||
| Isoform 3 (identifier: Q9P206-3) The sequence of this isoform differs from the canonical sequence as follows: 1-19: MVVFVGRRLPALLGLFKKK → MGNSHHKRKAPSGPRVRSFWRFGRSAKRPA | ||||||
| Note: Myristoylated at Gly-2. | ||||||
| Isoform 4 (identifier: Q9P206-4) The sequence of this isoform differs from the canonical sequence as follows: 137-1028: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1035 | 1035 | Uncharacterized protein KIAA1522 | PRO_0000311246 | |||||
Regions | |||||||||
| Compositional bias | 154 – 160 | 7 | Poly-Arg | ||||||
| Compositional bias | 319 – 431 | 113 | Ser-rich | ||||||
| Compositional bias | 438 – 997 | 560 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 110 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 145 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 215 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||
| Modified residue | 339 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 342 | 1 | Phosphoserine Ref.7 Ref.12 | ||||||
| Modified residue | 404 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 447 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 545 | 1 | Phosphoserine Ref.7 Ref.12 Ref.13 | ||||||
| Modified residue | 593 | 1 | Phosphothreonine Ref.9 | ||||||
| Modified residue | 669 | 1 | Phosphoserine Ref.9 Ref.13 | ||||||
| Modified residue | 673 | 1 | Phosphoserine Ref.9 | ||||||
| Modified residue | 858 | 1 | Phosphoserine Ref.9 Ref.12 | ||||||
| Modified residue | 862 | 1 | Phosphoserine Ref.9 Ref.12 | ||||||
| Modified residue | 868 | 1 | Phosphoserine Ref.12 | ||||||
| Modified residue | 906 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 929 | 1 | Phosphoserine Ref.8 Ref.9 Ref.12 | ||||||
| Modified residue | 971 | 1 | Phosphoserine Ref.9 Ref.13 | ||||||
| Modified residue | 979 | 1 | Phosphoserine Ref.9 Ref.12 Ref.13 | ||||||
| Modified residue | 981 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 19 | 19 | MVVFV…LFKKK → MAARAPPAAPAAEEPGNPGG PPRRKKSRSGASGLRRAFSW LRGKRRKKKAAGAEGAEPAA PRAKKAEDKAKRAKGKGR in isoform 2. | VSP_040217 | |||||
| Alternative sequence | 1 – 19 | 19 | MVVFV…LFKKK → MGNSHHKRKAPSGPRVRSFW RFGRSAKRPA in isoform 3. | VSP_041634 | |||||
| Alternative sequence | 137 – 1028 | 892 | Missing in isoform 4. | VSP_043215 | |||||
| Natural variant | 57 | 1 | P → S. Corresponds to variant rs11803515 [ dbSNP | Ensembl ]. | VAR_037190 | |||||
| Natural variant | 114 | 1 | S → P. Corresponds to variant rs3737994 [ dbSNP | Ensembl ]. | VAR_037191 | |||||
| Natural variant | 232 | 1 | M → V. Corresponds to variant rs12730560 [ dbSNP | Ensembl ]. | VAR_037192 | |||||
| Natural variant | 310 | 1 | L → I. Corresponds to variant rs11582639 [ dbSNP | Ensembl ]. | VAR_037193 | |||||
| Natural variant | 770 | 1 | P → L. Corresponds to variant rs581875 [ dbSNP | Ensembl ]. | VAR_037194 | |||||
| Natural variant | 1021 | 1 | E → K. Corresponds to variant rs675928 [ dbSNP | Ensembl ]. | VAR_037195 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Teratocarcinoma. |
| [3] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-77 (ISOFORM 2). |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 709-1035 (ISOFORM 1). Tissue: Mammary cancer. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [7] | "A probability-based approach for high-throughput protein phosphorylation analysis and site localization." Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-339; SER-342 AND SER-545, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [8] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-929, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215; THR-593; SER-669; SER-673; SER-858; SER-862; SER-929; SER-971 AND SER-979, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [11] | "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system." Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T. Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract] Cited for: MYRISTOYLATION AT GLY-2 (ISOFORM 3). |
| [12] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-145; SER-342; SER-545; SER-858; SER-862; SER-868; SER-929 AND SER-979, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545; SER-669; SER-971 AND SER-979, MASS SPECTROMETRY. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB040955 mRNA. Translation: BAA96046.1. Different initiation. AK298965 mRNA. Translation: BAG61060.1. AC114489 Genomic DNA. No translation available. AI587184 mRNA. No translation available. AL713671 mRNA. Translation: CAD28477.2. |
| IPI | IPI00001632. IPI00872465. IPI00936576. |
| RefSeq | NP_001185901.1. NM_001198972.1. NP_001185902.1. NM_001198973.1. NP_065939.2. NM_020888.2. |
| UniGene | Hs.591502. |
3D structure databases | |
| ProteinModelPortal | Q9P206. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9P206. 2 interactions. |
| STRING | 9606.ENSP00000383851. |
PTM databases | |
| PhosphoSite | Q9P206. |
Polymorphism databases | |
| DMDM | 160395559. |
Proteomic databases | |
| PaxDb | Q9P206. |
| PRIDE | Q9P206. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000294521; ENSP00000294521; ENSG00000162522. ENST00000373480; ENSP00000362579; ENSG00000162522. ENST00000373481; ENSP00000362580; ENSG00000162522. ENST00000401073; ENSP00000383851; ENSG00000162522. |
| GeneID | 57648. |
| KEGG | hsa:57648. |
| UCSC | uc001bvu.1. human. uc001bvv.2. human. uc010ohm.1. human. uc010ohn.1. human. |
Organism-specific databases | |
| CTD | 57648. |
| GeneCards | GC01P033207. |
| HGNC | HGNC:29301. KIAA1522. |
| HPA | HPA032050. |
| neXtProt | NX_Q9P206. |
| PharmGKB | PA142671612. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG76260. |
| HOGENOM | HOG000074189. |
| HOVERGEN | HBG108037. |
| OMA | KVPAPFS. |
| OrthoDB | EOG4CVG70. |
Gene expression databases | |
| Bgee | Q9P206. |
| CleanEx | HS_KIAA1522. |
| Genevestigator | Q9P206. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| ChiTaRS | KIAA1522. human. |
| GenomeRNAi | 57648. |
| NextBio | 64386. |
Entry information
| Entry name | K1522_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P206 Secondary accession number(s): B4DQU8 Q8TCQ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |

Clusters with
