Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P206

- K1522_HUMAN

UniProt

Q9P206 - K1522_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Uncharacterized protein KIAA1522

Gene

KIAA1522

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein KIAA1522
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:29301. KIAA1522.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671612.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10351035Uncharacterized protein KIAA1522PRO_0000311246Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei145 – 1451Phosphoserine1 Publication
Modified residuei215 – 2151Phosphoserine2 Publications
Modified residuei339 – 3391Phosphoserine1 Publication
Modified residuei342 – 3421Phosphoserine2 Publications
Modified residuei404 – 4041PhosphoserineBy similarity
Modified residuei545 – 5451Phosphoserine3 Publications
Modified residuei593 – 5931Phosphothreonine1 Publication
Modified residuei612 – 6121PhosphoserineBy similarity
Modified residuei669 – 6691Phosphoserine2 Publications
Modified residuei673 – 6731Phosphoserine1 Publication
Modified residuei858 – 8581Phosphoserine2 Publications
Modified residuei862 – 8621Phosphoserine2 Publications
Modified residuei868 – 8681Phosphoserine1 Publication
Modified residuei929 – 9291Phosphoserine3 Publications
Modified residuei971 – 9711Phosphoserine2 Publications
Modified residuei979 – 9791Phosphoserine3 Publications

Keywords - PTMi

Lipoprotein, Myristate, Phosphoprotein

Proteomic databases

MaxQBiQ9P206.
PaxDbiQ9P206.
PRIDEiQ9P206.

PTM databases

PhosphoSiteiQ9P206.

Expressioni

Gene expression databases

BgeeiQ9P206.
CleanExiHS_KIAA1522.
GenevestigatoriQ9P206.

Organism-specific databases

HPAiHPA032050.
HPA032051.

Interactioni

Protein-protein interaction databases

BioGridi121685. 8 interactions.
IntActiQ9P206. 3 interactions.
STRINGi9606.ENSP00000383851.

Structurei

3D structure databases

ProteinModelPortaliQ9P206.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi154 – 1607Poly-Arg
Compositional biasi319 – 431113Ser-richAdd
BLAST
Compositional biasi438 – 997560Pro-richAdd
BLAST

Phylogenomic databases

eggNOGiNOG76260.
GeneTreeiENSGT00440000038119.
HOGENOMiHOG000074189.
HOVERGENiHBG108037.
InParanoidiQ9P206.
OMAiPPLTRPM.
OrthoDBiEOG7QRQTM.
PhylomeDBiQ9P206.
TreeFamiTF333323.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P206-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVVFVGRRLP ALLGLFKKKG SAKAENDKHL SVGPGQGPGS AVDEHQDNVF
60 70 80 90 100
FPSGRPPHLE ELHTQAQEGL RSLQHQEKQK LNKGGWDHGD TQSIQSSRTG
110 120 130 140 150
PDEDNISFCS QTTSYVAESS TAEDALSIRS EMIQRKGSTF RPHDSFPKSG
160 170 180 190 200
KSGRRRRERR STVLGLPQHV QKELGLRNER EAPGTPRAPG ARDAVRIPTV
210 220 230 240 250
DGRPRGTSGM GARVSLQALE AEAEAGAETE AMLQRHIDRV YRDDTFVGRS
260 270 280 290 300
TGTRAPPLTR PMSLAVPGLT GGAGPAEPLS PAMSISPQAT YLSKLIPHAV
310 320 330 340 350
LPPTVDVVAL GRCSLRTLSR CSLHSASPAS VRSLGRFSSV SSPQPRSRHP
360 370 380 390 400
SSSSDTWSHS QSSDTIVSDG STLSSKGGSE GQPESSTASN SVVPPPQGGS
410 420 430 440 450
GRGSPSGGST AEASDTLSIR SSGQLSGRSV SLRKLKRPPP PPRRTHSLHQ
460 470 480 490 500
RGLAVPDGPL GLPPKPERKQ QPQLPRPPTT GGSEGAGAAP CPPNPANSWV
510 520 530 540 550
PGLSPGGSRR PPRSPERTLS PSSGYSSQSG TPTLPPKGLA GPPASPGKAQ
560 570 580 590 600
PPKPERVTSL RSPGASVSSS LTSLCSSSSD PAPSDRSGPQ ILTPLGDRFV
610 620 630 640 650
IPPHPKVPAP FSPPPSKPRS PNPAAPALAA PAVVPGPVST TDASPQSPPT
660 670 680 690 700
PQTTLTPLQE SPVISKDQSP PPSPPPSYHP PPPPTKKPEV VVEAPSASET
710 720 730 740 750
AEEPLQDPNW PPPPPPAPEE QDLSMADFPP PEEAFFSVAS PEPAGPSGSP
760 770 780 790 800
ELVSSPAASS SSATALQIQP PGSPDPPPAP PAPAPASSAP GHVAKLPQKE
810 820 830 840 850
PVGCSKGGGP PREDVGAPLV TPSLLQMVRL RSVGAPGGAP TPALGPSAPQ
860 870 880 890 900
KPLRRALSGR ASPVPAPSSG LHAAVRLKAC SLAASEGLSS AQPNGPPEAE
910 920 930 940 950
PRPPQSPAST ASFIFSKGSR KLQLERPVSP ETQADLQRNL VAELRSISEQ
960 970 980 990 1000
RPPQAPKKSP KAPPPVARKP SVGVPPPASP SYPRAEPLTA PPTNGLPHTQ
1010 1020 1030
DRTKRELAEN GGVLQLVGPE EKMGLPGSDS QKELA
Length:1,035
Mass (Da):107,095
Last modified:November 13, 2007 - v2
Checksum:iCE674245F15108CE
GO
Isoform 2 (identifier: Q9P206-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MVVFVGRRLPALLGLFKKK → MAARAPPAAP...KAKRAKGKGR

Show »
Length:1,094
Mass (Da):113,062
Checksum:i214DF1694FAB0174
GO
Isoform 3 (identifier: Q9P206-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-19: MVVFVGRRLPALLGLFKKK → MGNSHHKRKAPSGPRVRSFWRFGRSAKRPA

Note: Initiator Met-1 is removed. Contains a N-myristoyl glycine at position 2.

Show »
Length:1,046
Mass (Da):108,385
Checksum:iA7DE212FF521F3A9
GO
Isoform 4 (identifier: Q9P206-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     137-1028: Missing.

Show »
Length:143
Mass (Da):15,682
Checksum:i243512E893E0151D
GO

Sequence cautioni

The sequence BAA96046.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti57 – 571P → S.
Corresponds to variant rs11803515 [ dbSNP | Ensembl ].
VAR_037190
Natural varianti114 – 1141S → P.
Corresponds to variant rs3737994 [ dbSNP | Ensembl ].
VAR_037191
Natural varianti232 – 2321M → V.
Corresponds to variant rs12730560 [ dbSNP | Ensembl ].
VAR_037192
Natural varianti310 – 3101L → I.
Corresponds to variant rs11582639 [ dbSNP | Ensembl ].
VAR_037193
Natural varianti770 – 7701P → L.
Corresponds to variant rs581875 [ dbSNP | Ensembl ].
VAR_037194
Natural varianti1021 – 10211E → K.
Corresponds to variant rs675928 [ dbSNP | Ensembl ].
VAR_037195

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1919MVVFV…LFKKK → MAARAPPAAPAAEEPGNPGG PPRRKKSRSGASGLRRAFSW LRGKRRKKKAAGAEGAEPAA PRAKKAEDKAKRAKGKGR in isoform 2. 1 PublicationVSP_040217Add
BLAST
Alternative sequencei1 – 1919MVVFV…LFKKK → MGNSHHKRKAPSGPRVRSFW RFGRSAKRPA in isoform 3. CuratedVSP_041634Add
BLAST
Alternative sequencei137 – 1028892Missing in isoform 4. 1 PublicationVSP_043215Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040955 mRNA. Translation: BAA96046.1. Different initiation.
AK298965 mRNA. Translation: BAG61060.1.
AC114489 Genomic DNA. No translation available.
AI587184 mRNA. No translation available.
AL713671 mRNA. Translation: CAD28477.2.
CCDSiCCDS41298.1. [Q9P206-2]
CCDS55588.1. [Q9P206-1]
CCDS55589.1. [Q9P206-4]
RefSeqiNP_001185901.1. NM_001198972.1. [Q9P206-1]
NP_001185902.1. NM_001198973.1. [Q9P206-4]
NP_065939.2. NM_020888.2. [Q9P206-2]
XP_006710854.1. XM_006710791.1. [Q9P206-3]
UniGeneiHs.591502.

Genome annotation databases

EnsembliENST00000294521; ENSP00000294521; ENSG00000162522. [Q9P206-4]
ENST00000373480; ENSP00000362579; ENSG00000162522. [Q9P206-1]
ENST00000373481; ENSP00000362580; ENSG00000162522. [Q9P206-3]
ENST00000401073; ENSP00000383851; ENSG00000162522. [Q9P206-2]
GeneIDi57648.
KEGGihsa:57648.
UCSCiuc001bvu.1. human. [Q9P206-2]
uc001bvv.2. human. [Q9P206-1]
uc010ohm.1. human. [Q9P206-3]
uc010ohn.1. human. [Q9P206-4]

Polymorphism databases

DMDMi160395559.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB040955 mRNA. Translation: BAA96046.1 . Different initiation.
AK298965 mRNA. Translation: BAG61060.1 .
AC114489 Genomic DNA. No translation available.
AI587184 mRNA. No translation available.
AL713671 mRNA. Translation: CAD28477.2 .
CCDSi CCDS41298.1. [Q9P206-2 ]
CCDS55588.1. [Q9P206-1 ]
CCDS55589.1. [Q9P206-4 ]
RefSeqi NP_001185901.1. NM_001198972.1. [Q9P206-1 ]
NP_001185902.1. NM_001198973.1. [Q9P206-4 ]
NP_065939.2. NM_020888.2. [Q9P206-2 ]
XP_006710854.1. XM_006710791.1. [Q9P206-3 ]
UniGenei Hs.591502.

3D structure databases

ProteinModelPortali Q9P206.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121685. 8 interactions.
IntActi Q9P206. 3 interactions.
STRINGi 9606.ENSP00000383851.

PTM databases

PhosphoSitei Q9P206.

Polymorphism databases

DMDMi 160395559.

Proteomic databases

MaxQBi Q9P206.
PaxDbi Q9P206.
PRIDEi Q9P206.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000294521 ; ENSP00000294521 ; ENSG00000162522 . [Q9P206-4 ]
ENST00000373480 ; ENSP00000362579 ; ENSG00000162522 . [Q9P206-1 ]
ENST00000373481 ; ENSP00000362580 ; ENSG00000162522 . [Q9P206-3 ]
ENST00000401073 ; ENSP00000383851 ; ENSG00000162522 . [Q9P206-2 ]
GeneIDi 57648.
KEGGi hsa:57648.
UCSCi uc001bvu.1. human. [Q9P206-2 ]
uc001bvv.2. human. [Q9P206-1 ]
uc010ohm.1. human. [Q9P206-3 ]
uc010ohn.1. human. [Q9P206-4 ]

Organism-specific databases

CTDi 57648.
GeneCardsi GC01P033207.
HGNCi HGNC:29301. KIAA1522.
HPAi HPA032050.
HPA032051.
neXtProti NX_Q9P206.
PharmGKBi PA142671612.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG76260.
GeneTreei ENSGT00440000038119.
HOGENOMi HOG000074189.
HOVERGENi HBG108037.
InParanoidi Q9P206.
OMAi PPLTRPM.
OrthoDBi EOG7QRQTM.
PhylomeDBi Q9P206.
TreeFami TF333323.

Miscellaneous databases

ChiTaRSi KIAA1522. human.
GenomeRNAii 57648.
NextBioi 64386.

Gene expression databases

Bgeei Q9P206.
CleanExi HS_KIAA1522.
Genevestigatori Q9P206.

Family and domain databases

ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Teratocarcinoma.
  3. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-77 (ISOFORM 2).
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 709-1035 (ISOFORM 1).
    Tissue: Mammary cancer.
  6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "A probability-based approach for high-throughput protein phosphorylation analysis and site localization."
    Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P.
    Nat. Biotechnol. 24:1285-1292(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-339; SER-342 AND SER-545, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-929, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215; THR-593; SER-669; SER-673; SER-858; SER-862; SER-929; SER-971 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-215, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  12. "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system."
    Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T.
    Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: MYRISTOYLATION AT GLY-2 (ISOFORM 3).
  13. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-145; SER-342; SER-545; SER-858; SER-862; SER-868; SER-929 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  14. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-545; SER-669; SER-971 AND SER-979, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiK1522_HUMAN
AccessioniPrimary (citable) accession number: Q9P206
Secondary accession number(s): B4DQU8
, B5MDY0, C9JH84, Q8TCQ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: October 29, 2014
This is version 85 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

External Data

Dasty 3