Q9P203 (BTBD7_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 87.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: BTB/POZ domain-containing protein 7 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1132 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Contains 2 BTB (POZ) domains. |
| Sequence caution | The sequence BAA96049.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAB13946.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB13946.1 differs from that shown. Reason: Probable cloning artifact. The sequence CAH10736.1 differs from that shown. Reason: Probable cloning artifact. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat |
| PTM | Lipoprotein Myristate Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P203-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 3 (identifier: Q9P203-3) The sequence of this isoform differs from the canonical sequence as follows: 388-410: GCEDIIAESISLDTLIAILKWSS → EETTVIRPACAAELSNSCLLPQS 411-1132: Missing. | ||||||
| Isoform 5 (identifier: Q9P203-5) The sequence of this isoform differs from the canonical sequence as follows: 1-351: Missing. 352-387: SEVQALVAGKPNMTRAEEAMELYHIALFLEFNMLAQ → MAGGAGAGADGGAGGGGGGGDGSGPSGSSSGGRSLR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1132 | 1132 | BTB/POZ domain-containing protein 7 | PRO_0000186215 | |||||
Regions | |||||||||
| Domain | 142 – 211 | 70 | BTB 1 | ||||||
| Domain | 247 – 341 | 95 | BTB 2 | ||||||
| Compositional bias | 756 – 825 | 70 | Pro-rich | ||||||
| Compositional bias | 849 – 856 | 8 | Poly-Ala | ||||||
Amino acid modifications | |||||||||
| Modified residue | 1119 | 1 | Phosphoserine By similarity | ||||||
| Lipidation | 2 | 1 | N-myristoyl glycine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 351 | 351 | Missing in isoform 5. | VSP_041481 | |||||
| Alternative sequence | 352 – 387 | 36 | SEVQA…NMLAQ → MAGGAGAGADGGAGGGGGGG DGSGPSGSSSGGRSLR in isoform 5. | VSP_041482 | |||||
| Alternative sequence | 388 – 410 | 23 | GCEDI…LKWSS → EETTVIRPACAAELSNSCLL PQS in isoform 3. | VSP_041483 | |||||
| Alternative sequence | 411 – 1132 | 722 | Missing in isoform 3. | VSP_041487 | |||||
Experimental info | |||||||||
| Sequence conflict | 313 | 1 | I → V in BAB13946. Ref.2 | ||||||
| Sequence conflict | 408 | 1 | W → R in BAB13946. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 135-536 (ISOFORM 1). Tissue: Brain. |
| [3] | "The DNA sequence and analysis of human chromosome 14." Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H. Weissenbach J.Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 457-536 (ISOFORM 1). Tissue: Amygdala. |
| [6] | "Full-length cDNA libraries and normalization." Li W.B., Gruber C., Jessee J., Polayes D. Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-938 (ISOFORM 5). Tissue: Neuroblastoma. |
| [7] | "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system." Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T. Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract] Cited for: MYRISTOYLATION AT GLY-2. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB040958 mRNA. Translation: BAA96049.2. Different initiation. AK001510 mRNA. Translation: BAA91730.1. AK021953 mRNA. Translation: BAB13946.1. Sequence problems. AK291422 mRNA. Translation: BAF84111.1. AL122023 Genomic DNA. No translation available. AL132838 Genomic DNA. No translation available. BC047071 mRNA. Translation: AAH47071.1. AL049394 mRNA. Translation: CAH10736.1. Sequence problems. BX248762 mRNA. Translation: CAD66569.1. |
| IPI | IPI00002061. IPI00018802. IPI00479933. |
| PIR | JC7757. |
| RefSeq | NP_001002860.2. NM_001002860.2. NP_060637.1. NM_018167.3. |
| UniGene | Hs.525549. |
3D structure databases | |
| ProteinModelPortal | Q9P203. |
| SMR | Q9P203. Positions 124-240. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000335615. |
PTM databases | |
| PhosphoSite | Q9P203. |
Polymorphism databases | |
| DMDM | 67460591. |
Proteomic databases | |
| PaxDb | Q9P203. |
| PRIDE | Q9P203. |
Protocols and materials databases | |
| DNASU | 55727. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000298896; ENSP00000298896; ENSG00000011114. ENST00000334746; ENSP00000335615; ENSG00000011114. ENST00000554565; ENSP00000451010; ENSG00000011114. |
| GeneID | 55727. |
| KEGG | hsa:55727. |
| UCSC | uc001ybo.3. human. uc001ybp.3. human. uc001ybq.4. human. |
Organism-specific databases | |
| CTD | 55727. |
| GeneCards | GC14M093703. |
| HGNC | HGNC:18269. BTBD7. |
| HPA | HPA049926. |
| MIM | 610386. gene. |
| neXtProt | NX_Q9P203. |
| PharmGKB | PA134938971. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG293531. |
| HOVERGEN | HBG058828. |
| InParanoid | Q9P203. |
| KO | K10479. |
| OMA | NMLAQGC. |
Gene expression databases | |
| ArrayExpress | Q9P203. |
| Bgee | Q9P203. |
| CleanEx | HS_BTBD7. |
| Genevestigator | Q9P203. |
| GermOnline | ENSG00000011114. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.30.710.10. 2 hits. |
| InterPro | IPR011705. BACK. IPR000210. BTB/POZ-like. IPR011333. BTB/POZ_fold. IPR013069. BTB_POZ. [Graphical view] |
| Pfam | PF07707. BACK. 1 hit. PF00651. BTB. 2 hits. [Graphical view] |
| SMART | SM00875. BACK. 1 hit. SM00225. BTB. 2 hits. [Graphical view] |
| SUPFAM | SSF54695. BTB/POZ_fold. 2 hits. |
| PROSITE | PS50097. BTB. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BTBD7. human. |
| GenomeRNAi | 55727. |
| NextBio | 60639. |
| SOURCE | Search... |
Entry information
| Entry name | BTBD7_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P203 Secondary accession number(s): A8K5V7 Q9NVM0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 14 Human chromosome 14: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
