Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P203

- BTBD7_HUMAN

UniProt

Q9P203 - BTBD7_HUMAN

Protein

BTB/POZ domain-containing protein 7

Gene

BTBD7

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 3 (07 Jun 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a mediator of epithelial dynamics and organ branching by promoting cleft progression. Induced following accumulation of fibronectin in forming clefts, leading to local expression of the cell-scattering SNAIL2 and suppression of E-cadherin levels, thereby altering cell morphology and reducing cell-cell adhesion. This stimulates cell separation at the base of forming clefts by local, dynamic intercellular gap formation and promotes cleft progression By similarity.By similarity

    GO - Biological processi

    1. multicellular organismal development Source: UniProtKB-KW
    2. regulation of branching involved in salivary gland morphogenesis Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    BTB/POZ domain-containing protein 7
    Gene namesi
    Name:BTBD7
    Synonyms:KIAA1525
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:18269. BTBD7.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134938971.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed
    Chaini2 – 11321131BTB/POZ domain-containing protein 7PRO_0000186215Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Lipidationi2 – 21N-myristoyl glycine1 Publication

    Keywords - PTMi

    Lipoprotein, Myristate

    Proteomic databases

    MaxQBiQ9P203.
    PaxDbiQ9P203.
    PRIDEiQ9P203.

    PTM databases

    PhosphoSiteiQ9P203.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9P203.
    BgeeiQ9P203.
    CleanExiHS_BTBD7.
    GenevestigatoriQ9P203.

    Organism-specific databases

    HPAiHPA049926.

    Interactioni

    Protein-protein interaction databases

    BioGridi120847. 3 interactions.
    STRINGi9606.ENSP00000335615.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9P203.
    SMRiQ9P203. Positions 124-213.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini142 – 21170BTB 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini247 – 34195BTB 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini413 – 47967BACKAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi756 – 82570Pro-richAdd
    BLAST
    Compositional biasi849 – 8568Poly-Ala

    Sequence similaritiesi

    Contains 2 BTB (POZ) domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG293531.
    HOVERGENiHBG058828.
    InParanoidiQ9P203.
    KOiK10479.
    OMAiNMLAQGC.
    OrthoDBiEOG7XWPNJ.
    PhylomeDBiQ9P203.
    TreeFamiTF316112.

    Family and domain databases

    Gene3Di3.30.710.10. 2 hits.
    InterProiIPR011705. BACK.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    [Graphical view]
    PfamiPF07707. BACK. 1 hit.
    PF00651. BTB. 2 hits.
    [Graphical view]
    SMARTiSM00875. BACK. 1 hit.
    SM00225. BTB. 2 hits.
    [Graphical view]
    SUPFAMiSSF54695. SSF54695. 3 hits.
    PROSITEiPS50097. BTB. 2 hits.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P203-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGANASNYPH SCSPRVGGNS QAQQTFIGTS SYSQQGYGCE SKLYSLDHGH     50
    EKPQDKKKRT SGLATLKKKF IKRRKSNRSA DHAKQMRELL SGWDVRDVNA 100
    LVEEYEGTSA LKELSLQASL ARPEARTLQK DMADLYEYKY CTDVDLIFQE 150
    TCFPVHRAIL AARCPFFKTL LSSSPEYGAE IIMDINTAGI DMPMFSALLH 200
    YLYTGEFGME DSRFQNVDIL VQLSEEFGTP NSLDVDMRGL FDYMCYYDVV 250
    LSFSSDSELV EAFGGNQNCL DEELKAHKAV ISARSPFFRN LLQRRIRTGE 300
    EITDRTLRTP TRIILDESII PKKYATVILH CMYTDVVDLS VLHCSPSVGS 350
    LSEVQALVAG KPNMTRAEEA MELYHIALFL EFNMLAQGCE DIIAESISLD 400
    TLIAILKWSS HPYGSKWVHR QALHFLCEEF SQVMTSDVFY ELSKDHLLTA 450
    IQSDYLQASE QDILKYLIKW GEHQLMKRIA DREPNLLSGT AHSVNKRGVK 500
    RRDLDMEELR EILSSLLPFV RIEHILPINS EVLSDAMKRG LISTPPSDML 550
    PTTEGGKSNA WLRQKNAGIY VRPRLFSPYV EEAKSVLDEM MVEQTDLVRL 600
    RMVRMSNVPD TLYMVNNAVP QCCHMISHQQ ISSNQSSPPS VVANEIPVPR 650
    LLIMKDMVRR LQELRHTEQV QRAYALNCGE GATVSYEIQI RVLREFGLAD 700
    AAAELLQNPH KFFPDERFGD ESPLLTMRQP GRCRVNSTPP AETMFTDLDS 750
    FVAFHPPLPP PPPPYHPPAT PIHNQLKAGW KQRPPSQHPS RSFSYPCNHS 800
    LFHSRTAPKA GPPPVYLPSV KAAPPDCTST AGLGRQTVAA AAATTTSTAT 850
    AAAAAASEKQ VRTQPVLNDL MPDIAVGVST LSLKDRRLPE LAVDTELSQS 900
    VSEAGPGPPQ HLSCIPQRHT HTSRKKHTLE QKTDTRENPQ EYPDFYDFSN 950
    AACRPSTPAL SRRTPSPSQG GYFGPDLYSH NKASPSGLKS AYLPGQTSPK 1000
    KQEEARREYP LSPDGHLHRQ KNEPIHLDVV EQPPQRSDFP LAAPENASTG 1050
    PAHVRGRTAV ETDLTFGLTP NRPSLSACSS EAPEERSGRR LADSESLGHG 1100
    AQRNTDLERE DSISRGRRSP SKPDFLYKKS AL 1132
    Length:1,132
    Mass (Da):126,368
    Last modified:June 7, 2005 - v3
    Checksum:i5C8AA7A8834AD588
    GO
    Isoform 3 (identifier: Q9P203-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         388-410: GCEDIIAESISLDTLIAILKWSS → EETTVIRPACAAELSNSCLLPQS
         411-1132: Missing.

    Show »
    Length:410
    Mass (Da):46,043
    Checksum:iAF393D8C00740623
    GO
    Isoform 5 (identifier: Q9P203-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-351: Missing.
         352-387: SEVQALVAGKPNMTRAEEAMELYHIALFLEFNMLAQ → MAGGAGAGADGGAGGGGGGGDGSGPSGSSSGGRSLR

    Show »
    Length:781
    Mass (Da):85,546
    Checksum:iE876A2E8B17EEEA2
    GO

    Sequence cautioni

    The sequence BAB13946.1 differs from that shown. Reason: Probable cloning artifact.
    The sequence CAH10736.1 differs from that shown. Reason: Probable cloning artifact.
    The sequence BAA96049.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAB13946.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti313 – 3131I → V in BAB13946. (PubMed:14702039)Curated
    Sequence conflicti408 – 4081W → R in BAB13946. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 351351Missing in isoform 5. 2 PublicationsVSP_041481Add
    BLAST
    Alternative sequencei352 – 38736SEVQA…NMLAQ → MAGGAGAGADGGAGGGGGGG DGSGPSGSSSGGRSLR in isoform 5. 2 PublicationsVSP_041482Add
    BLAST
    Alternative sequencei388 – 41023GCEDI…LKWSS → EETTVIRPACAAELSNSCLL PQS in isoform 3. 2 PublicationsVSP_041483Add
    BLAST
    Alternative sequencei411 – 1132722Missing in isoform 3. 2 PublicationsVSP_041487Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB040958 mRNA. Translation: BAA96049.2. Different initiation.
    AK001510 mRNA. Translation: BAA91730.1.
    AK021953 mRNA. Translation: BAB13946.1. Sequence problems.
    AK291422 mRNA. Translation: BAF84111.1.
    AL122023 Genomic DNA. No translation available.
    AL132838 Genomic DNA. No translation available.
    BC047071 mRNA. Translation: AAH47071.1.
    AL049394 mRNA. Translation: CAH10736.1. Sequence problems.
    BX248762 mRNA. Translation: CAD66569.1.
    CCDSiCCDS32146.1. [Q9P203-1]
    CCDS32147.1. [Q9P203-3]
    PIRiJC7757.
    RefSeqiNP_001002860.2. NM_001002860.3. [Q9P203-1]
    NP_001276062.1. NM_001289133.1. [Q9P203-5]
    NP_060637.1. NM_018167.4. [Q9P203-3]
    XP_006720258.1. XM_006720195.1. [Q9P203-1]
    XP_006725229.1. XM_006725166.1. [Q9P203-1]
    UniGeneiHs.525549.

    Genome annotation databases

    EnsembliENST00000298896; ENSP00000298896; ENSG00000011114. [Q9P203-3]
    ENST00000334746; ENSP00000335615; ENSG00000011114. [Q9P203-1]
    ENST00000554565; ENSP00000451010; ENSG00000011114. [Q9P203-5]
    GeneIDi55727.
    KEGGihsa:55727.
    UCSCiuc001ybo.3. human. [Q9P203-1]
    uc001ybp.3. human. [Q9P203-5]
    uc001ybq.4. human. [Q9P203-3]

    Polymorphism databases

    DMDMi67460591.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB040958 mRNA. Translation: BAA96049.2 . Different initiation.
    AK001510 mRNA. Translation: BAA91730.1 .
    AK021953 mRNA. Translation: BAB13946.1 . Sequence problems.
    AK291422 mRNA. Translation: BAF84111.1 .
    AL122023 Genomic DNA. No translation available.
    AL132838 Genomic DNA. No translation available.
    BC047071 mRNA. Translation: AAH47071.1 .
    AL049394 mRNA. Translation: CAH10736.1 . Sequence problems.
    BX248762 mRNA. Translation: CAD66569.1 .
    CCDSi CCDS32146.1. [Q9P203-1 ]
    CCDS32147.1. [Q9P203-3 ]
    PIRi JC7757.
    RefSeqi NP_001002860.2. NM_001002860.3. [Q9P203-1 ]
    NP_001276062.1. NM_001289133.1. [Q9P203-5 ]
    NP_060637.1. NM_018167.4. [Q9P203-3 ]
    XP_006720258.1. XM_006720195.1. [Q9P203-1 ]
    XP_006725229.1. XM_006725166.1. [Q9P203-1 ]
    UniGenei Hs.525549.

    3D structure databases

    ProteinModelPortali Q9P203.
    SMRi Q9P203. Positions 124-213.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120847. 3 interactions.
    STRINGi 9606.ENSP00000335615.

    PTM databases

    PhosphoSitei Q9P203.

    Polymorphism databases

    DMDMi 67460591.

    Proteomic databases

    MaxQBi Q9P203.
    PaxDbi Q9P203.
    PRIDEi Q9P203.

    Protocols and materials databases

    DNASUi 55727.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000298896 ; ENSP00000298896 ; ENSG00000011114 . [Q9P203-3 ]
    ENST00000334746 ; ENSP00000335615 ; ENSG00000011114 . [Q9P203-1 ]
    ENST00000554565 ; ENSP00000451010 ; ENSG00000011114 . [Q9P203-5 ]
    GeneIDi 55727.
    KEGGi hsa:55727.
    UCSCi uc001ybo.3. human. [Q9P203-1 ]
    uc001ybp.3. human. [Q9P203-5 ]
    uc001ybq.4. human. [Q9P203-3 ]

    Organism-specific databases

    CTDi 55727.
    GeneCardsi GC14M093703.
    HGNCi HGNC:18269. BTBD7.
    HPAi HPA049926.
    MIMi 610386. gene.
    neXtProti NX_Q9P203.
    PharmGKBi PA134938971.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG293531.
    HOVERGENi HBG058828.
    InParanoidi Q9P203.
    KOi K10479.
    OMAi NMLAQGC.
    OrthoDBi EOG7XWPNJ.
    PhylomeDBi Q9P203.
    TreeFami TF316112.

    Miscellaneous databases

    ChiTaRSi BTBD7. human.
    GenomeRNAii 55727.
    NextBioi 60639.
    PROi Q9P203.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9P203.
    Bgeei Q9P203.
    CleanExi HS_BTBD7.
    Genevestigatori Q9P203.

    Family and domain databases

    Gene3Di 3.30.710.10. 2 hits.
    InterProi IPR011705. BACK.
    IPR000210. BTB/POZ-like.
    IPR011333. BTB/POZ_fold.
    IPR013069. BTB_POZ.
    [Graphical view ]
    Pfami PF07707. BACK. 1 hit.
    PF00651. BTB. 2 hits.
    [Graphical view ]
    SMARTi SM00875. BACK. 1 hit.
    SM00225. BTB. 2 hits.
    [Graphical view ]
    SUPFAMi SSF54695. SSF54695. 3 hits.
    PROSITEi PS50097. BTB. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 135-536 (ISOFORM 1).
      Tissue: Brain.
    3. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Testis.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 457-536 (ISOFORM 1).
      Tissue: Amygdala.
    6. "Full-length cDNA libraries and normalization."
      Li W.B., Gruber C., Jessee J., Polayes D.
      Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-938 (ISOFORM 5).
      Tissue: Neuroblastoma.
    7. "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system."
      Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T.
      Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: MYRISTOYLATION AT GLY-2.

    Entry informationi

    Entry nameiBTBD7_HUMAN
    AccessioniPrimary (citable) accession number: Q9P203
    Secondary accession number(s): A8K5V7
    , Q69Z05, Q7Z308, Q86TS0, Q9HAA4, Q9NVM0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 7, 2005
    Last sequence update: June 7, 2005
    Last modified: October 1, 2014
    This is version 98 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3