SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P203

- BTBD7_HUMAN

UniProt

Q9P203 - BTBD7_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
BTB/POZ domain-containing protein 7
Gene
BTBD7, KIAA1525
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as a mediator of epithelial dynamics and organ branching by promoting cleft progression. Induced following accumulation of fibronectin in forming clefts, leading to local expression of the cell-scattering SNAIL2 and suppression of E-cadherin levels, thereby altering cell morphology and reducing cell-cell adhesion. This stimulates cell separation at the base of forming clefts by local, dynamic intercellular gap formation and promotes cleft progression By similarity.

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. regulation of branching involved in salivary gland morphogenesis Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
BTB/POZ domain-containing protein 7
Gene namesi
Name:BTBD7
Synonyms:KIAA1525
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:18269. BTBD7.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134938971.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed
Chaini2 – 11321131BTB/POZ domain-containing protein 7
PRO_0000186215Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Lipidationi2 – 21N-myristoyl glycine1 Publication

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

MaxQBiQ9P203.
PaxDbiQ9P203.
PRIDEiQ9P203.

PTM databases

PhosphoSiteiQ9P203.

Expressioni

Gene expression databases

ArrayExpressiQ9P203.
BgeeiQ9P203.
CleanExiHS_BTBD7.
GenevestigatoriQ9P203.

Organism-specific databases

HPAiHPA049926.

Interactioni

Protein-protein interaction databases

BioGridi120847. 3 interactions.
STRINGi9606.ENSP00000335615.

Structurei

3D structure databases

ProteinModelPortaliQ9P203.
SMRiQ9P203. Positions 124-213.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini142 – 21170BTB 1
Add
BLAST
Domaini247 – 34195BTB 2
Add
BLAST
Domaini413 – 47967BACK
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi756 – 82570Pro-rich
Add
BLAST
Compositional biasi849 – 8568Poly-Ala

Sequence similaritiesi

Contains 2 BTB (POZ) domains.

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG293531.
HOVERGENiHBG058828.
InParanoidiQ9P203.
KOiK10479.
OMAiNMLAQGC.
OrthoDBiEOG7XWPNJ.
PhylomeDBiQ9P203.
TreeFamiTF316112.

Family and domain databases

Gene3Di3.30.710.10. 2 hits.
InterProiIPR011705. BACK.
IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
[Graphical view]
PfamiPF07707. BACK. 1 hit.
PF00651. BTB. 2 hits.
[Graphical view]
SMARTiSM00875. BACK. 1 hit.
SM00225. BTB. 2 hits.
[Graphical view]
SUPFAMiSSF54695. SSF54695. 3 hits.
PROSITEiPS50097. BTB. 2 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P203-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MGANASNYPH SCSPRVGGNS QAQQTFIGTS SYSQQGYGCE SKLYSLDHGH     50
EKPQDKKKRT SGLATLKKKF IKRRKSNRSA DHAKQMRELL SGWDVRDVNA 100
LVEEYEGTSA LKELSLQASL ARPEARTLQK DMADLYEYKY CTDVDLIFQE 150
TCFPVHRAIL AARCPFFKTL LSSSPEYGAE IIMDINTAGI DMPMFSALLH 200
YLYTGEFGME DSRFQNVDIL VQLSEEFGTP NSLDVDMRGL FDYMCYYDVV 250
LSFSSDSELV EAFGGNQNCL DEELKAHKAV ISARSPFFRN LLQRRIRTGE 300
EITDRTLRTP TRIILDESII PKKYATVILH CMYTDVVDLS VLHCSPSVGS 350
LSEVQALVAG KPNMTRAEEA MELYHIALFL EFNMLAQGCE DIIAESISLD 400
TLIAILKWSS HPYGSKWVHR QALHFLCEEF SQVMTSDVFY ELSKDHLLTA 450
IQSDYLQASE QDILKYLIKW GEHQLMKRIA DREPNLLSGT AHSVNKRGVK 500
RRDLDMEELR EILSSLLPFV RIEHILPINS EVLSDAMKRG LISTPPSDML 550
PTTEGGKSNA WLRQKNAGIY VRPRLFSPYV EEAKSVLDEM MVEQTDLVRL 600
RMVRMSNVPD TLYMVNNAVP QCCHMISHQQ ISSNQSSPPS VVANEIPVPR 650
LLIMKDMVRR LQELRHTEQV QRAYALNCGE GATVSYEIQI RVLREFGLAD 700
AAAELLQNPH KFFPDERFGD ESPLLTMRQP GRCRVNSTPP AETMFTDLDS 750
FVAFHPPLPP PPPPYHPPAT PIHNQLKAGW KQRPPSQHPS RSFSYPCNHS 800
LFHSRTAPKA GPPPVYLPSV KAAPPDCTST AGLGRQTVAA AAATTTSTAT 850
AAAAAASEKQ VRTQPVLNDL MPDIAVGVST LSLKDRRLPE LAVDTELSQS 900
VSEAGPGPPQ HLSCIPQRHT HTSRKKHTLE QKTDTRENPQ EYPDFYDFSN 950
AACRPSTPAL SRRTPSPSQG GYFGPDLYSH NKASPSGLKS AYLPGQTSPK 1000
KQEEARREYP LSPDGHLHRQ KNEPIHLDVV EQPPQRSDFP LAAPENASTG 1050
PAHVRGRTAV ETDLTFGLTP NRPSLSACSS EAPEERSGRR LADSESLGHG 1100
AQRNTDLERE DSISRGRRSP SKPDFLYKKS AL 1132
Length:1,132
Mass (Da):126,368
Last modified:June 7, 2005 - v3
Checksum:i5C8AA7A8834AD588
GO
Isoform 3 (identifier: Q9P203-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     388-410: GCEDIIAESISLDTLIAILKWSS → EETTVIRPACAAELSNSCLLPQS
     411-1132: Missing.

Show »
Length:410
Mass (Da):46,043
Checksum:iAF393D8C00740623
GO
Isoform 5 (identifier: Q9P203-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-351: Missing.
     352-387: SEVQALVAGKPNMTRAEEAMELYHIALFLEFNMLAQ → MAGGAGAGADGGAGGGGGGGDGSGPSGSSSGGRSLR

Show »
Length:781
Mass (Da):85,546
Checksum:iE876A2E8B17EEEA2
GO

Sequence cautioni

The sequence BAB13946.1 differs from that shown. Reason: Probable cloning artifact.
The sequence CAH10736.1 differs from that shown. Reason: Probable cloning artifact.
The sequence BAA96049.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAB13946.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 351351Missing in isoform 5.
VSP_041481Add
BLAST
Alternative sequencei352 – 38736SEVQA…NMLAQ → MAGGAGAGADGGAGGGGGGG DGSGPSGSSSGGRSLR in isoform 5.
VSP_041482Add
BLAST
Alternative sequencei388 – 41023GCEDI…LKWSS → EETTVIRPACAAELSNSCLL PQS in isoform 3.
VSP_041483Add
BLAST
Alternative sequencei411 – 1132722Missing in isoform 3.
VSP_041487Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti313 – 3131I → V in BAB13946. 1 Publication
Sequence conflicti408 – 4081W → R in BAB13946. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB040958 mRNA. Translation: BAA96049.2. Different initiation.
AK001510 mRNA. Translation: BAA91730.1.
AK021953 mRNA. Translation: BAB13946.1. Sequence problems.
AK291422 mRNA. Translation: BAF84111.1.
AL122023 Genomic DNA. No translation available.
AL132838 Genomic DNA. No translation available.
BC047071 mRNA. Translation: AAH47071.1.
AL049394 mRNA. Translation: CAH10736.1. Sequence problems.
BX248762 mRNA. Translation: CAD66569.1.
CCDSiCCDS32146.1. [Q9P203-1]
CCDS32147.1. [Q9P203-3]
PIRiJC7757.
RefSeqiNP_001002860.2. NM_001002860.3. [Q9P203-1]
NP_001276062.1. NM_001289133.1. [Q9P203-5]
NP_060637.1. NM_018167.4. [Q9P203-3]
XP_006720258.1. XM_006720195.1. [Q9P203-1]
XP_006725229.1. XM_006725166.1. [Q9P203-1]
UniGeneiHs.525549.

Genome annotation databases

EnsembliENST00000298896; ENSP00000298896; ENSG00000011114. [Q9P203-3]
ENST00000334746; ENSP00000335615; ENSG00000011114. [Q9P203-1]
ENST00000554565; ENSP00000451010; ENSG00000011114. [Q9P203-5]
GeneIDi55727.
KEGGihsa:55727.
UCSCiuc001ybo.3. human. [Q9P203-1]
uc001ybp.3. human. [Q9P203-5]
uc001ybq.4. human. [Q9P203-3]

Polymorphism databases

DMDMi67460591.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB040958 mRNA. Translation: BAA96049.2 . Different initiation.
AK001510 mRNA. Translation: BAA91730.1 .
AK021953 mRNA. Translation: BAB13946.1 . Sequence problems.
AK291422 mRNA. Translation: BAF84111.1 .
AL122023 Genomic DNA. No translation available.
AL132838 Genomic DNA. No translation available.
BC047071 mRNA. Translation: AAH47071.1 .
AL049394 mRNA. Translation: CAH10736.1 . Sequence problems.
BX248762 mRNA. Translation: CAD66569.1 .
CCDSi CCDS32146.1. [Q9P203-1 ]
CCDS32147.1. [Q9P203-3 ]
PIRi JC7757.
RefSeqi NP_001002860.2. NM_001002860.3. [Q9P203-1 ]
NP_001276062.1. NM_001289133.1. [Q9P203-5 ]
NP_060637.1. NM_018167.4. [Q9P203-3 ]
XP_006720258.1. XM_006720195.1. [Q9P203-1 ]
XP_006725229.1. XM_006725166.1. [Q9P203-1 ]
UniGenei Hs.525549.

3D structure databases

ProteinModelPortali Q9P203.
SMRi Q9P203. Positions 124-213.
ModBasei Search...

Protein-protein interaction databases

BioGridi 120847. 3 interactions.
STRINGi 9606.ENSP00000335615.

PTM databases

PhosphoSitei Q9P203.

Polymorphism databases

DMDMi 67460591.

Proteomic databases

MaxQBi Q9P203.
PaxDbi Q9P203.
PRIDEi Q9P203.

Protocols and materials databases

DNASUi 55727.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000298896 ; ENSP00000298896 ; ENSG00000011114 . [Q9P203-3 ]
ENST00000334746 ; ENSP00000335615 ; ENSG00000011114 . [Q9P203-1 ]
ENST00000554565 ; ENSP00000451010 ; ENSG00000011114 . [Q9P203-5 ]
GeneIDi 55727.
KEGGi hsa:55727.
UCSCi uc001ybo.3. human. [Q9P203-1 ]
uc001ybp.3. human. [Q9P203-5 ]
uc001ybq.4. human. [Q9P203-3 ]

Organism-specific databases

CTDi 55727.
GeneCardsi GC14M093703.
HGNCi HGNC:18269. BTBD7.
HPAi HPA049926.
MIMi 610386. gene.
neXtProti NX_Q9P203.
PharmGKBi PA134938971.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG293531.
HOVERGENi HBG058828.
InParanoidi Q9P203.
KOi K10479.
OMAi NMLAQGC.
OrthoDBi EOG7XWPNJ.
PhylomeDBi Q9P203.
TreeFami TF316112.

Miscellaneous databases

ChiTaRSi BTBD7. human.
GenomeRNAii 55727.
NextBioi 60639.
PROi Q9P203.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9P203.
Bgeei Q9P203.
CleanExi HS_BTBD7.
Genevestigatori Q9P203.

Family and domain databases

Gene3Di 3.30.710.10. 2 hits.
InterProi IPR011705. BACK.
IPR000210. BTB/POZ-like.
IPR011333. BTB/POZ_fold.
IPR013069. BTB_POZ.
[Graphical view ]
Pfami PF07707. BACK. 1 hit.
PF00651. BTB. 2 hits.
[Graphical view ]
SMARTi SM00875. BACK. 1 hit.
SM00225. BTB. 2 hits.
[Graphical view ]
SUPFAMi SSF54695. SSF54695. 3 hits.
PROSITEi PS50097. BTB. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 5), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 135-536 (ISOFORM 1).
    Tissue: Brain.
  3. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 457-536 (ISOFORM 1).
    Tissue: Amygdala.
  6. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (FEB-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-938 (ISOFORM 5).
    Tissue: Neuroblastoma.
  7. "Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system."
    Suzuki T., Moriya K., Nagatoshi K., Ota Y., Ezure T., Ando E., Tsunasawa S., Utsumi T.
    Proteomics 10:1780-1793(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: MYRISTOYLATION AT GLY-2.

Entry informationi

Entry nameiBTBD7_HUMAN
AccessioniPrimary (citable) accession number: Q9P203
Secondary accession number(s): A8K5V7
, Q69Z05, Q7Z308, Q86TS0, Q9HAA4, Q9NVM0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 7, 2005
Last sequence update: June 7, 2005
Last modified: July 9, 2014
This is version 97 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi