Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P1Z2

- CACO1_HUMAN

UniProt

Q9P1Z2 - CACO1_HUMAN

Protein

Calcium-binding and coiled-coil domain-containing protein 1

Gene

CALCOCO1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 2 (23 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. Involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. Functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions By similarity.By similarity
    Seems to enhance inorganic pyrphosphatase thus activating phosphogluomutase (PMG). Probably functions as component of the calphoglin complex, which is involved in linking cellular metabolism (phosphate and glucose metabolism) with other core functions including protein synthesis and degradation, calcium signaling and cell growth.1 Publication

    GO - Molecular functioni

    1. armadillo repeat domain binding Source: UniProtKB
    2. beta-catenin binding Source: AgBase
    3. chromatin binding Source: Ensembl
    4. ligand-dependent nuclear receptor transcription coactivator activity Source: AgBase
    5. protein binding Source: UniProtKB
    6. protein C-terminus binding Source: UniProtKB
    7. sequence-specific DNA binding Source: AgBase
    8. transcription coactivator activity Source: UniProtKB
    9. transcription cofactor activity Source: UniProtKB
    10. transcription regulatory region DNA binding Source: UniProtKB

    GO - Biological processi

    1. intracellular steroid hormone receptor signaling pathway Source: HGNC
    2. positive regulation of transcription, DNA-templated Source: UniProtKB
    3. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
    4. signal transduction Source: HGNC
    5. transcription, DNA-templated Source: HGNC
    6. Wnt signaling pathway Source: UniProtKB-KW

    Keywords - Biological processi

    Wnt signaling pathway

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calcium-binding and coiled-coil domain-containing protein 1
    Alternative name(s):
    Calphoglin
    Coiled-coil coactivator protein
    Sarcoma antigen NY-SAR-3
    Gene namesi
    Name:CALCOCO1
    Synonyms:KIAA1536
    ORF Names:PP13275, UNQ2436/PRO4996
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:29306. CALCOCO1.

    Subcellular locationi

    Cytoplasm. Nucleus
    Note: Shuttles between nucleus and cytoplasm.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. intracellular membrane-bounded organelle Source: HPA
    3. nuclear chromatin Source: Ensembl
    4. nucleus Source: LIFEdb

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA128394699.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 691691Calcium-binding and coiled-coil domain-containing protein 1PRO_0000308899Add
    BLAST

    Proteomic databases

    MaxQBiQ9P1Z2.
    PaxDbiQ9P1Z2.
    PRIDEiQ9P1Z2.

    Miscellaneous databases

    PMAP-CutDBQ9P1Z2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9P1Z2.
    BgeeiQ9P1Z2.
    CleanExiHS_CALCOCO1.
    GenevestigatoriQ9P1Z2.

    Organism-specific databases

    HPAiHPA038313.
    HPA038314.

    Interactioni

    Subunit structurei

    Part of a calphoglin complex consisting of CALCOCO1, PPA1 and PGM. Interacts with the bHLH-PAS domains of GRIP1, AHR and ARNT. Interacts with CTNNB1 via both its N- and C-terminal regions. Interacts with EP300 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi121692. 18 interactions.
    DIPiDIP-47322N.
    IntActiQ9P1Z2. 19 interactions.
    MINTiMINT-1399261.
    STRINGi9606.ENSP00000262059.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9P1Z2.
    SMRiQ9P1Z2. Positions 15-128, 654-680.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 190190N-terminal AD (CTNNB1 binding site)By similarityAdd
    BLAST
    Regioni1 – 3030p300 KIX-bindingBy similarityAdd
    BLAST
    Regioni501 – 691191C-terminal AD (CTNNB1 binding site)By similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili145 – 20561Sequence AnalysisAdd
    BLAST
    Coiled coili232 – 339108Sequence AnalysisAdd
    BLAST
    Coiled coili417 – 51498Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi367 – 3726Poly-Ala

    Domaini

    The C-terminal activation region (AD) is used for downstream signaling. Seems to be essential for coactivator function with nuclear receptors and with the aryl hydrocarbon receptor By similarity.By similarity
    The N-terminal activation region (AD) is necessary and sufficient for synergistic activation of LEF1-mediated transcription by CTNNB1. Contains a EP3000 binding region which is important for synergistic cooperation By similarity.By similarity
    Recruitment by nuclear receptors is accomplished by the interaction of the coiled-coiled domain with p160 coactivators.By similarity

    Sequence similaritiesi

    Belongs to the CALCOCO family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG114876.
    HOVERGENiHBG107573.
    InParanoidiQ9P1Z2.
    OMAiYDMASGF.
    OrthoDBiEOG7RRF8H.
    PhylomeDBiQ9P1Z2.
    TreeFamiTF329501.

    Family and domain databases

    InterProiIPR012852. CoCoA.
    [Graphical view]
    PfamiPF07888. CALCOCO1. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P1Z2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEESPLSRAP SRGGVNFLNV ARTYIPNTKV ECHYTLPPGT MPSASDWIGI    50
    FKVEAACVRD YHTFVWSSVP ESTTDGSPIH TSVQFQASYL PKPGAQLYQF 100
    RYVNRQGQVC GQSPPFQFRE PRPMDELVTL EEADGGSDIL LVVPKATVLQ 150
    NQLDESQQER NDLMQLKLQL EGQVTELRSR VQELERALAT ARQEHTELME 200
    QYKGISRSHG EITEERDILS RQQGDHVARI LELEDDIQTI SEKVLTKEVE 250
    LDRLRDTVKA LTREQEKLLG QLKEVQADKE QSEAELQVAQ QENHHLNLDL 300
    KEAKSWQEEQ SAQAQRLKDK VAQMKDTLGQ AQQRVAELEP LKEQLRGAQE 350
    LAASSQQKAT LLGEELASAA AARDRTIAEL HRSRLEVAEV NGRLAELGLH 400
    LKEEKCQWSK ERAGLLQSVE AEKDKILKLS AEILRLEKAV QEERTQNQVF 450
    KTELAREKDS SLVQLSESKR ELTELRSALR VLQKEKEQLQ EEKQELLEYM 500
    RKLEARLEKV ADEKWNEDAT TEDEEAAVGL SCPAALTDSE DESPEDMRLP 550
    PYGLCERGDP GSSPAGPREA SPLVVISQPA PISPHLSGPA EDSSSDSEAE 600
    DEKSVLMAAV QSGGEEANLL LPELGSAFYD MASGFTVGTL SETSTGGPAT 650
    PTWKECPICK ERFPAESDKD ALEDHMDGHF FFSTQDPFTF E 691
    Length:691
    Mass (Da):77,336
    Last modified:October 23, 2007 - v2
    Checksum:i06A4C6BAB896759F
    GO
    Isoform 2 (identifier: Q9P1Z2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         633-691: SGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE → R

    Show »
    Length:633
    Mass (Da):70,978
    Checksum:i44493B60B4E3BBF1
    GO
    Isoform 3 (identifier: Q9P1Z2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         598-598: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:690
    Mass (Da):77,207
    Checksum:iB9369254792722D2
    GO
    Isoform 4 (identifier: Q9P1Z2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         87-119: Missing.
         287-338: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:606
    Mass (Da):67,542
    Checksum:i1166472275D9A569
    GO

    Sequence cautioni

    The sequence BAA96060.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti381 – 3811H → R in BAG53720. (PubMed:14702039)Curated
    Sequence conflicti486 – 4861K → R in CAG38598. 1 PublicationCurated
    Sequence conflicti660 – 6601K → E in CAG38598. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti393 – 3931R → K.1 Publication
    Corresponds to variant rs3741659 [ dbSNP | Ensembl ].
    VAR_036881

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei87 – 11933Missing in isoform 4. 1 PublicationVSP_041471Add
    BLAST
    Alternative sequencei287 – 33852Missing in isoform 4. 1 PublicationVSP_041472Add
    BLAST
    Alternative sequencei598 – 5981Missing in isoform 3. 1 PublicationVSP_029052
    Alternative sequencei633 – 69159SGFTV…PFTFE → R in isoform 2. 2 PublicationsVSP_029053Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY563137 mRNA. Translation: AAT68474.1.
    AB040969 mRNA. Translation: BAA96060.1. Different initiation.
    AL136895 mRNA. Translation: CAB66829.1.
    AY358397 mRNA. Translation: AAQ88763.1.
    AK122773 mRNA. Translation: BAG53720.1.
    AK027881 mRNA. Translation: BAB55428.1.
    AF370415 mRNA. Translation: AAQ15251.1.
    CR533567 mRNA. Translation: CAG38598.1.
    CH471054 Genomic DNA. Translation: EAW96728.1.
    BC003177 mRNA. Translation: AAH03177.1.
    AY211909 mRNA. Translation: AAO65163.1.
    CCDSiCCDS44908.1. [Q9P1Z2-4]
    CCDS8864.1. [Q9P1Z2-1]
    RefSeqiNP_001137154.1. NM_001143682.1. [Q9P1Z2-4]
    NP_065949.1. NM_020898.2. [Q9P1Z2-1]
    UniGeneiHs.156667.

    Genome annotation databases

    EnsembliENST00000262059; ENSP00000262059; ENSG00000012822. [Q9P1Z2-3]
    ENST00000430117; ENSP00000397189; ENSG00000012822. [Q9P1Z2-4]
    ENST00000548263; ENSP00000447647; ENSG00000012822. [Q9P1Z2-2]
    ENST00000550804; ENSP00000449960; ENSG00000012822. [Q9P1Z2-1]
    GeneIDi57658.
    KEGGihsa:57658.
    UCSCiuc001sef.3. human. [Q9P1Z2-1]
    uc001seg.3. human. [Q9P1Z2-4]
    uc001seh.2. human. [Q9P1Z2-2]
    uc009znd.3. human. [Q9P1Z2-3]

    Polymorphism databases

    DMDMi160017736.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY563137 mRNA. Translation: AAT68474.1 .
    AB040969 mRNA. Translation: BAA96060.1 . Different initiation.
    AL136895 mRNA. Translation: CAB66829.1 .
    AY358397 mRNA. Translation: AAQ88763.1 .
    AK122773 mRNA. Translation: BAG53720.1 .
    AK027881 mRNA. Translation: BAB55428.1 .
    AF370415 mRNA. Translation: AAQ15251.1 .
    CR533567 mRNA. Translation: CAG38598.1 .
    CH471054 Genomic DNA. Translation: EAW96728.1 .
    BC003177 mRNA. Translation: AAH03177.1 .
    AY211909 mRNA. Translation: AAO65163.1 .
    CCDSi CCDS44908.1. [Q9P1Z2-4 ]
    CCDS8864.1. [Q9P1Z2-1 ]
    RefSeqi NP_001137154.1. NM_001143682.1. [Q9P1Z2-4 ]
    NP_065949.1. NM_020898.2. [Q9P1Z2-1 ]
    UniGenei Hs.156667.

    3D structure databases

    ProteinModelPortali Q9P1Z2.
    SMRi Q9P1Z2. Positions 15-128, 654-680.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121692. 18 interactions.
    DIPi DIP-47322N.
    IntActi Q9P1Z2. 19 interactions.
    MINTi MINT-1399261.
    STRINGi 9606.ENSP00000262059.

    Polymorphism databases

    DMDMi 160017736.

    Proteomic databases

    MaxQBi Q9P1Z2.
    PaxDbi Q9P1Z2.
    PRIDEi Q9P1Z2.

    Protocols and materials databases

    DNASUi 57658.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000262059 ; ENSP00000262059 ; ENSG00000012822 . [Q9P1Z2-3 ]
    ENST00000430117 ; ENSP00000397189 ; ENSG00000012822 . [Q9P1Z2-4 ]
    ENST00000548263 ; ENSP00000447647 ; ENSG00000012822 . [Q9P1Z2-2 ]
    ENST00000550804 ; ENSP00000449960 ; ENSG00000012822 . [Q9P1Z2-1 ]
    GeneIDi 57658.
    KEGGi hsa:57658.
    UCSCi uc001sef.3. human. [Q9P1Z2-1 ]
    uc001seg.3. human. [Q9P1Z2-4 ]
    uc001seh.2. human. [Q9P1Z2-2 ]
    uc009znd.3. human. [Q9P1Z2-3 ]

    Organism-specific databases

    CTDi 57658.
    GeneCardsi GC12M054105.
    H-InvDB HIX0129676.
    HGNCi HGNC:29306. CALCOCO1.
    HPAi HPA038313.
    HPA038314.
    neXtProti NX_Q9P1Z2.
    PharmGKBi PA128394699.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG114876.
    HOVERGENi HBG107573.
    InParanoidi Q9P1Z2.
    OMAi YDMASGF.
    OrthoDBi EOG7RRF8H.
    PhylomeDBi Q9P1Z2.
    TreeFami TF329501.

    Miscellaneous databases

    GeneWikii CALCOCO1.
    GenomeRNAii 57658.
    NextBioi 64417.
    PMAP-CutDB Q9P1Z2.
    PROi Q9P1Z2.

    Gene expression databases

    ArrayExpressi Q9P1Z2.
    Bgeei Q9P1Z2.
    CleanExi HS_CALCOCO1.
    Genevestigatori Q9P1Z2.

    Family and domain databases

    InterProi IPR012852. CoCoA.
    [Graphical view ]
    Pfami PF07888. CALCOCO1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cellular signaling mediated by calphoglin-induced activation of IPP and PGM."
      Takahashi K., Inuzuka M., Ingi T.
      Biochem. Biophys. Res. Commun. 325:203-214(2004)
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH PHOSPHOGLUCOMUTASE AND PPA1.
    2. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT LYS-393.
      Tissue: Spleen and Thyroid.
    6. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
      Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
      , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
      Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney.
    10. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 147-455.

    Entry informationi

    Entry nameiCACO1_HUMAN
    AccessioniPrimary (citable) accession number: Q9P1Z2
    Secondary accession number(s): B3KVA8
    , Q6FI59, Q71RC3, Q86WF8, Q96JU3, Q9H090
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 23, 2007
    Last sequence update: October 23, 2007
    Last modified: October 1, 2014
    This is version 90 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3