Q9P1Z2 (CACO1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium-binding and coiled-coil domain-containing protein 1 Alternative name(s): Calphoglin Coiled-coil coactivator protein Sarcoma antigen NY-SAR-3 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 691 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. Involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. Functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions By similarity. Ref.1 Seems to enhance inorganic pyrphosphatase thus activating phosphogluomutase (PMG). Probably functions as component of the calphoglin complex, which is involved in linking cellular metabolism (phosphate and glucose metabolism) with other core functions including protein synthesis and degradation, calcium signaling and cell growth. Ref.1 |
| Subunit structure | Part of a calphoglin complex consisting of CALCOCO1, PPA1 and PGM. Interacts with the bHLH-PAS domains of GRIP1, AHR and ARNT. Interacts with CTNNB1 via both its N- and C-terminal regions. Interacts with EP300 By similarity. Ref.1 |
| Subcellular location | Cytoplasm. Nucleus. Note: Shuttles between nucleus and cytoplasm By similarity. |
| Domain | The C-terminal activation region (AD) is used for downstream signaling. Seems to be essential for coactivator function with nuclear receptors and with the aryl hydrocarbon receptor By similarity. The N-terminal activation region (AD) is necessary and sufficient for synergistic activation of LEF1-mediated transcription by CTNNB1. Contains a EP3000 binding region which is important for synergistic cooperation By similarity. Recruitment by nuclear receptors is accomplished by the interaction of the coiled-coiled domain with p160 coactivators By similarity. |
| Sequence similarities | Belongs to the CALCOCO family. |
| Sequence caution | The sequence BAA96060.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P1Z2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P1Z2-2) The sequence of this isoform differs from the canonical sequence as follows: 633-691: SGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE → R | ||||||
| Isoform 3 (identifier: Q9P1Z2-3) The sequence of this isoform differs from the canonical sequence as follows: 598-598: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9P1Z2-4) The sequence of this isoform differs from the canonical sequence as follows: 87-119: Missing. 287-338: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 691 | 691 | Calcium-binding and coiled-coil domain-containing protein 1 | PRO_0000308899 | |||||
Regions | |||||||||
| Region | 1 – 190 | 190 | N-terminal AD (CTNNB1 binding site) By similarity | ||||||
| Region | 1 – 30 | 30 | p300 KIX-binding By similarity | ||||||
| Region | 501 – 691 | 191 | C-terminal AD (CTNNB1 binding site) By similarity | ||||||
| Coiled coil | 145 – 205 | 61 | Potential | ||||||
| Coiled coil | 232 – 339 | 108 | Potential | ||||||
| Coiled coil | 417 – 514 | 98 | Potential | ||||||
| Compositional bias | 367 – 372 | 6 | Poly-Ala | ||||||
Amino acid modifications | |||||||||
| Modified residue | 563 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 87 – 119 | 33 | Missing in isoform 4. | VSP_041471 | |||||
| Alternative sequence | 287 – 338 | 52 | Missing in isoform 4. | VSP_041472 | |||||
| Alternative sequence | 598 | 1 | Missing in isoform 3. | VSP_029052 | |||||
| Alternative sequence | 633 – 691 | 59 | SGFTV…PFTFE → R in isoform 2. | VSP_029053 | |||||
| Natural variant | 393 | 1 | R → K. Ref.5 Corresponds to variant rs3741659 [ dbSNP | Ensembl ]. | VAR_036881 | |||||
Experimental info | |||||||||
| Sequence conflict | 381 | 1 | H → R in BAG53720. Ref.5 | ||||||
| Sequence conflict | 486 | 1 | K → R in CAG38598. Ref.7 | ||||||
| Sequence conflict | 660 | 1 | K → E in CAG38598. Ref.7 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cellular signaling mediated by calphoglin-induced activation of IPP and PGM." Takahashi K., Inuzuka M., Ingi T. Biochem. Biophys. Res. Commun. 325:203-214(2004) Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH PHOSPHOGLUCOMUTASE AND PPA1. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [4] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT LYS-393. Tissue: Spleen and Thyroid. |
| [6] | "Large-scale cDNA transfection screening for genes related to cancer development and progression." Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X. Gu J.Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [7] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [10] | "Immunomic analysis of human sarcoma." Lee S.-Y., Obata Y., Yoshida M., Stockert E., Williamson B., Jungbluth A.A., Chen Y.-T., Old L.J., Scanlan M.J. Proc. Natl. Acad. Sci. U.S.A. 100:2651-2656(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 147-455. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY563137 mRNA. Translation: AAT68474.1. AB040969 mRNA. Translation: BAA96060.1. Different initiation. AL136895 mRNA. Translation: CAB66829.1. AY358397 mRNA. Translation: AAQ88763.1. AK122773 mRNA. Translation: BAG53720.1. AK027881 mRNA. Translation: BAB55428.1. AF370415 mRNA. Translation: AAQ15251.1. CR533567 mRNA. Translation: CAG38598.1. CH471054 Genomic DNA. Translation: EAW96728.1. BC003177 mRNA. Translation: AAH03177.1. AY211909 mRNA. Translation: AAO65163.1. |
| IPI | IPI00011232. IPI00788619. IPI00794512. IPI00902761. |
| RefSeq | NP_001137154.1. NM_001143682.1. NP_065949.1. NM_020898.2. |
| UniGene | Hs.156667. |
3D structure databases | |
| ProteinModelPortal | Q9P1Z2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-47322N. |
| IntAct | Q9P1Z2. 18 interactions. |
| MINT | MINT-1399261. |
| STRING | 9606.ENSP00000262059. |
Polymorphism databases | |
| DMDM | 160017736. |
Proteomic databases | |
| PaxDb | Q9P1Z2. |
| PRIDE | Q9P1Z2. |
Protocols and materials databases | |
| DNASU | 57658. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262059; ENSP00000262059; ENSG00000012822. ENST00000430117; ENSP00000397189; ENSG00000012822. ENST00000548263; ENSP00000447647; ENSG00000012822. ENST00000550804; ENSP00000449960; ENSG00000012822. |
| GeneID | 57658. |
| KEGG | hsa:57658. |
| UCSC | uc001sef.3. human. uc001seh.2. human. uc009znd.3. human. |
Organism-specific databases | |
| CTD | 57658. |
| GeneCards | GC12M054105. |
| H-InvDB | HIX0129676. |
| HGNC | HGNC:29306. CALCOCO1. |
| HPA | HPA038313. HPA038314. |
| neXtProt | NX_Q9P1Z2. |
| PharmGKB | PA128394699. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG114876. |
| HOVERGEN | HBG107573. |
| InParanoid | Q9P1Z2. |
| OMA | YDMASGF. |
| OrthoDB | EOG4NZTTD. |
| PhylomeDB | Q9P1Z2. |
Gene expression databases | |
| ArrayExpress | Q9P1Z2. |
| Bgee | Q9P1Z2. |
| CleanEx | HS_CALCOCO1. |
| Genevestigator | Q9P1Z2. |
Family and domain databases | |
| InterPro | IPR012852. CoCoA. [Graphical view] |
| Pfam | PF07888. CALCOCO1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 57658. |
| NextBio | 64417. |
| PMAP-CutDB | Q9P1Z2. |
Entry information
| Entry name | CACO1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P1Z2 Secondary accession number(s): B3KVA8 Q9H090 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
