SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P1Z2

- CACO1_HUMAN

UniProt

Q9P1Z2 - CACO1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Calcium-binding and coiled-coil domain-containing protein 1
Gene
CALCOCO1, KIAA1536, PP13275, UNQ2436/PRO4996
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2. During ER-activation acts synergistically in combination with other NCOA2-binding proteins, such as EP300, CREBBP and CARM1. Involved in the transcriptional activation of target genes in the Wnt/CTNNB1 pathway. Functions as a secondary coactivator in LEF1-mediated transcriptional activation via its interaction with CTNNB1. Coactivator function for nuclear receptors and LEF1/CTNNB1 involves differential utilization of two different activation regions By similarity.1 Publication
Seems to enhance inorganic pyrphosphatase thus activating phosphogluomutase (PMG). Probably functions as component of the calphoglin complex, which is involved in linking cellular metabolism (phosphate and glucose metabolism) with other core functions including protein synthesis and degradation, calcium signaling and cell growth.1 Publication

GO - Molecular functioni

  1. armadillo repeat domain binding Source: UniProtKB
  2. beta-catenin binding Source: AgBase
  3. chromatin binding Source: Ensembl
  4. ligand-dependent nuclear receptor transcription coactivator activity Source: AgBase
  5. protein C-terminus binding Source: UniProtKB
  6. protein binding Source: UniProtKB
  7. sequence-specific DNA binding Source: AgBase
  8. transcription coactivator activity Source: UniProtKB
  9. transcription cofactor activity Source: UniProtKB
  10. transcription regulatory region DNA binding Source: UniProtKB

GO - Biological processi

  1. Wnt signaling pathway Source: UniProtKB-KW
  2. intracellular steroid hormone receptor signaling pathway Source: HGNC
  3. positive regulation of transcription from RNA polymerase II promoter Source: Ensembl
  4. positive regulation of transcription, DNA-templated Source: UniProtKB
  5. signal transduction Source: HGNC
  6. transcription, DNA-templated Source: HGNC
Complete GO annotation...

Keywords - Biological processi

Wnt signaling pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-binding and coiled-coil domain-containing protein 1
Alternative name(s):
Calphoglin
Coiled-coil coactivator protein
Sarcoma antigen NY-SAR-3
Gene namesi
Synonyms:KIAA1536
ORF Names:PP13275, UNQ2436/PRO4996
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:29306. CALCOCO1.

Subcellular locationi

Cytoplasm. Nucleus
Note: Shuttles between nucleus and cytoplasm By similarity.

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. intracellular membrane-bounded organelle Source: HPA
  3. nuclear chromatin Source: Ensembl
  4. nucleus Source: LIFEdb
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA128394699.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 691691Calcium-binding and coiled-coil domain-containing protein 1
PRO_0000308899Add
BLAST

Proteomic databases

MaxQBiQ9P1Z2.
PaxDbiQ9P1Z2.
PRIDEiQ9P1Z2.

Miscellaneous databases

PMAP-CutDBQ9P1Z2.

Expressioni

Gene expression databases

ArrayExpressiQ9P1Z2.
BgeeiQ9P1Z2.
CleanExiHS_CALCOCO1.
GenevestigatoriQ9P1Z2.

Organism-specific databases

HPAiHPA038313.
HPA038314.

Interactioni

Subunit structurei

Part of a calphoglin complex consisting of CALCOCO1, PPA1 and PGM. Interacts with the bHLH-PAS domains of GRIP1, AHR and ARNT. Interacts with CTNNB1 via both its N- and C-terminal regions. Interacts with EP300 By similarity.1 Publication

Protein-protein interaction databases

BioGridi121692. 17 interactions.
DIPiDIP-47322N.
IntActiQ9P1Z2. 18 interactions.
MINTiMINT-1399261.
STRINGi9606.ENSP00000262059.

Structurei

3D structure databases

ProteinModelPortaliQ9P1Z2.
SMRiQ9P1Z2. Positions 15-128, 654-680.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 190190N-terminal AD (CTNNB1 binding site) By similarity
Add
BLAST
Regioni1 – 3030p300 KIX-binding By similarity
Add
BLAST
Regioni501 – 691191C-terminal AD (CTNNB1 binding site) By similarity
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili145 – 20561 Reviewed prediction
Add
BLAST
Coiled coili232 – 339108 Reviewed prediction
Add
BLAST
Coiled coili417 – 51498 Reviewed prediction
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi367 – 3726Poly-Ala

Domaini

The C-terminal activation region (AD) is used for downstream signaling. Seems to be essential for coactivator function with nuclear receptors and with the aryl hydrocarbon receptor By similarity.
The N-terminal activation region (AD) is necessary and sufficient for synergistic activation of LEF1-mediated transcription by CTNNB1. Contains a EP3000 binding region which is important for synergistic cooperation By similarity.
Recruitment by nuclear receptors is accomplished by the interaction of the coiled-coiled domain with p160 coactivators By similarity.

Sequence similaritiesi

Belongs to the CALCOCO family.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG114876.
HOVERGENiHBG107573.
InParanoidiQ9P1Z2.
OMAiYDMASGF.
OrthoDBiEOG7RRF8H.
PhylomeDBiQ9P1Z2.
TreeFamiTF329501.

Family and domain databases

InterProiIPR012852. CoCoA.
[Graphical view]
PfamiPF07888. CALCOCO1. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P1Z2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEESPLSRAP SRGGVNFLNV ARTYIPNTKV ECHYTLPPGT MPSASDWIGI    50
FKVEAACVRD YHTFVWSSVP ESTTDGSPIH TSVQFQASYL PKPGAQLYQF 100
RYVNRQGQVC GQSPPFQFRE PRPMDELVTL EEADGGSDIL LVVPKATVLQ 150
NQLDESQQER NDLMQLKLQL EGQVTELRSR VQELERALAT ARQEHTELME 200
QYKGISRSHG EITEERDILS RQQGDHVARI LELEDDIQTI SEKVLTKEVE 250
LDRLRDTVKA LTREQEKLLG QLKEVQADKE QSEAELQVAQ QENHHLNLDL 300
KEAKSWQEEQ SAQAQRLKDK VAQMKDTLGQ AQQRVAELEP LKEQLRGAQE 350
LAASSQQKAT LLGEELASAA AARDRTIAEL HRSRLEVAEV NGRLAELGLH 400
LKEEKCQWSK ERAGLLQSVE AEKDKILKLS AEILRLEKAV QEERTQNQVF 450
KTELAREKDS SLVQLSESKR ELTELRSALR VLQKEKEQLQ EEKQELLEYM 500
RKLEARLEKV ADEKWNEDAT TEDEEAAVGL SCPAALTDSE DESPEDMRLP 550
PYGLCERGDP GSSPAGPREA SPLVVISQPA PISPHLSGPA EDSSSDSEAE 600
DEKSVLMAAV QSGGEEANLL LPELGSAFYD MASGFTVGTL SETSTGGPAT 650
PTWKECPICK ERFPAESDKD ALEDHMDGHF FFSTQDPFTF E 691
Length:691
Mass (Da):77,336
Last modified:October 23, 2007 - v2
Checksum:i06A4C6BAB896759F
GO
Isoform 2 (identifier: Q9P1Z2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     633-691: SGFTVGTLSETSTGGPATPTWKECPICKERFPAESDKDALEDHMDGHFFFSTQDPFTFE → R

Show »
Length:633
Mass (Da):70,978
Checksum:i44493B60B4E3BBF1
GO
Isoform 3 (identifier: Q9P1Z2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     598-598: Missing.

Note: No experimental confirmation available.

Show »
Length:690
Mass (Da):77,207
Checksum:iB9369254792722D2
GO
Isoform 4 (identifier: Q9P1Z2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     87-119: Missing.
     287-338: Missing.

Note: No experimental confirmation available.

Show »
Length:606
Mass (Da):67,542
Checksum:i1166472275D9A569
GO

Sequence cautioni

The sequence BAA96060.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti393 – 3931R → K.1 Publication
Corresponds to variant rs3741659 [ dbSNP | Ensembl ].
VAR_036881

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei87 – 11933Missing in isoform 4.
VSP_041471Add
BLAST
Alternative sequencei287 – 33852Missing in isoform 4.
VSP_041472Add
BLAST
Alternative sequencei598 – 5981Missing in isoform 3.
VSP_029052
Alternative sequencei633 – 69159SGFTV…PFTFE → R in isoform 2.
VSP_029053Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti381 – 3811H → R in BAG53720. 1 Publication
Sequence conflicti486 – 4861K → R in CAG38598. 1 Publication
Sequence conflicti660 – 6601K → E in CAG38598. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY563137 mRNA. Translation: AAT68474.1.
AB040969 mRNA. Translation: BAA96060.1. Different initiation.
AL136895 mRNA. Translation: CAB66829.1.
AY358397 mRNA. Translation: AAQ88763.1.
AK122773 mRNA. Translation: BAG53720.1.
AK027881 mRNA. Translation: BAB55428.1.
AF370415 mRNA. Translation: AAQ15251.1.
CR533567 mRNA. Translation: CAG38598.1.
CH471054 Genomic DNA. Translation: EAW96728.1.
BC003177 mRNA. Translation: AAH03177.1.
AY211909 mRNA. Translation: AAO65163.1.
CCDSiCCDS44908.1. [Q9P1Z2-4]
CCDS8864.1. [Q9P1Z2-1]
RefSeqiNP_001137154.1. NM_001143682.1. [Q9P1Z2-4]
NP_065949.1. NM_020898.2. [Q9P1Z2-1]
UniGeneiHs.156667.

Genome annotation databases

EnsembliENST00000262059; ENSP00000262059; ENSG00000012822. [Q9P1Z2-3]
ENST00000430117; ENSP00000397189; ENSG00000012822. [Q9P1Z2-4]
ENST00000548263; ENSP00000447647; ENSG00000012822. [Q9P1Z2-2]
ENST00000550804; ENSP00000449960; ENSG00000012822. [Q9P1Z2-1]
GeneIDi57658.
KEGGihsa:57658.
UCSCiuc001sef.3. human. [Q9P1Z2-1]
uc001seg.3. human. [Q9P1Z2-4]
uc001seh.2. human. [Q9P1Z2-2]
uc009znd.3. human. [Q9P1Z2-3]

Polymorphism databases

DMDMi160017736.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY563137 mRNA. Translation: AAT68474.1 .
AB040969 mRNA. Translation: BAA96060.1 . Different initiation.
AL136895 mRNA. Translation: CAB66829.1 .
AY358397 mRNA. Translation: AAQ88763.1 .
AK122773 mRNA. Translation: BAG53720.1 .
AK027881 mRNA. Translation: BAB55428.1 .
AF370415 mRNA. Translation: AAQ15251.1 .
CR533567 mRNA. Translation: CAG38598.1 .
CH471054 Genomic DNA. Translation: EAW96728.1 .
BC003177 mRNA. Translation: AAH03177.1 .
AY211909 mRNA. Translation: AAO65163.1 .
CCDSi CCDS44908.1. [Q9P1Z2-4 ]
CCDS8864.1. [Q9P1Z2-1 ]
RefSeqi NP_001137154.1. NM_001143682.1. [Q9P1Z2-4 ]
NP_065949.1. NM_020898.2. [Q9P1Z2-1 ]
UniGenei Hs.156667.

3D structure databases

ProteinModelPortali Q9P1Z2.
SMRi Q9P1Z2. Positions 15-128, 654-680.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121692. 17 interactions.
DIPi DIP-47322N.
IntActi Q9P1Z2. 18 interactions.
MINTi MINT-1399261.
STRINGi 9606.ENSP00000262059.

Polymorphism databases

DMDMi 160017736.

Proteomic databases

MaxQBi Q9P1Z2.
PaxDbi Q9P1Z2.
PRIDEi Q9P1Z2.

Protocols and materials databases

DNASUi 57658.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000262059 ; ENSP00000262059 ; ENSG00000012822 . [Q9P1Z2-3 ]
ENST00000430117 ; ENSP00000397189 ; ENSG00000012822 . [Q9P1Z2-4 ]
ENST00000548263 ; ENSP00000447647 ; ENSG00000012822 . [Q9P1Z2-2 ]
ENST00000550804 ; ENSP00000449960 ; ENSG00000012822 . [Q9P1Z2-1 ]
GeneIDi 57658.
KEGGi hsa:57658.
UCSCi uc001sef.3. human. [Q9P1Z2-1 ]
uc001seg.3. human. [Q9P1Z2-4 ]
uc001seh.2. human. [Q9P1Z2-2 ]
uc009znd.3. human. [Q9P1Z2-3 ]

Organism-specific databases

CTDi 57658.
GeneCardsi GC12M054105.
H-InvDB HIX0129676.
HGNCi HGNC:29306. CALCOCO1.
HPAi HPA038313.
HPA038314.
neXtProti NX_Q9P1Z2.
PharmGKBi PA128394699.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG114876.
HOVERGENi HBG107573.
InParanoidi Q9P1Z2.
OMAi YDMASGF.
OrthoDBi EOG7RRF8H.
PhylomeDBi Q9P1Z2.
TreeFami TF329501.

Miscellaneous databases

GeneWikii CALCOCO1.
GenomeRNAii 57658.
NextBioi 64417.
PMAP-CutDB Q9P1Z2.
PROi Q9P1Z2.

Gene expression databases

ArrayExpressi Q9P1Z2.
Bgeei Q9P1Z2.
CleanExi HS_CALCOCO1.
Genevestigatori Q9P1Z2.

Family and domain databases

InterProi IPR012852. CoCoA.
[Graphical view ]
Pfami PF07888. CALCOCO1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cellular signaling mediated by calphoglin-induced activation of IPP and PGM."
    Takahashi K., Inuzuka M., Ingi T.
    Biochem. Biophys. Res. Commun. 325:203-214(2004)
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, INTERACTION WITH PHOSPHOGLUCOMUTASE AND PPA1.
  2. "Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:143-150(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4), VARIANT LYS-393.
    Tissue: Spleen and Thyroid.
  6. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  8. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  10. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 147-455.

Entry informationi

Entry nameiCACO1_HUMAN
AccessioniPrimary (citable) accession number: Q9P1Z2
Secondary accession number(s): B3KVA8
, Q6FI59, Q71RC3, Q86WF8, Q96JU3, Q9H090
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 23, 2007
Last sequence update: October 23, 2007
Last modified: July 9, 2014
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi