Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine zipper protein 4

Gene

LUZP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Export adapter involved in mRNA nuclear export in cancer cells. Binds and enhances the RNA-binding activity of the nuclear RNA export factor NXF1. Can restore mRNA export function in cells compromised by loss of mRNA export adapters (PubMed:25662211).1 Publication

Caution

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRNA-binding
Biological processmRNA transport, Transport

Enzyme and pathway databases

ReactomeiR-HSA-109688 Cleavage of Growing Transcript in the Termination Region
R-HSA-159236 Transport of Mature mRNA derived from an Intron-Containing Transcript
R-HSA-72187 mRNA 3'-end processing

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine zipper protein 4
Alternative name(s):
Cancer/testis antigen 28
Short name:
CT-28
Short name:
CT28
Tumor antigen HOM-TES-85
Gene namesi
Name:LUZP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000102021.10
HGNCiHGNC:24971 LUZP4
MIMi300616 gene
neXtProtiNX_Q9P127

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi51213
OpenTargetsiENSG00000102021
PharmGKBiPA134920076

Polymorphism and mutation databases

BioMutaiLUZP4
DMDMi74753106

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002886491 – 313Leucine zipper protein 4Add BLAST313

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei234PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9P127
PeptideAtlasiQ9P127
PRIDEiQ9P127

PTM databases

iPTMnetiQ9P127
PhosphoSitePlusiQ9P127

Expressioni

Tissue specificityi

Expressed specifically in testis. Also expressed in a wide variety of cancer types, but particularly high levels of expression observed in melanoma cells.2 Publications

Gene expression databases

BgeeiENSG00000102021
CleanExiHS_LUZP4
ExpressionAtlasiQ9P127 baseline and differential
GenevisibleiQ9P127 HS

Organism-specific databases

HPAiHPA046436
HPA051999

Interactioni

Subunit structurei

Interacts NXF1, NXF2, THOC1, THOC5, DDX39B/UAP56 and SRRT.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi11938391 interactors.
IntActiQ9P127 20 interactors.
STRINGi9606.ENSP00000360988

Structurei

3D structure databases

ProteinModelPortaliQ9P127
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 119Interaction with DDX39B/UAP561 PublicationAdd BLAST119
Regioni51 – 80Arg-rich; required for RNA-binding1 PublicationAdd BLAST30
Regioni178 – 236RS-containing His-rich (RS-H); necessary for nuclear localization1 PublicationAdd BLAST59
Regioni238 – 287Leucine-zipper; required for RNA-binding and for its relocalization to the cytoplasm during cell division1 PublicationAdd BLAST50
Regioni241 – 313Interaction with NXF11 PublicationAdd BLAST73

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi22 – 40UAP56-binding motif (UBM); required for proper nuclear localization1 PublicationAdd BLAST19

Phylogenomic databases

eggNOGiENOG410IY7Q Eukaryota
ENOG410Z9DE LUCA
GeneTreeiENSGT00390000002455
HOGENOMiHOG000065721
HOVERGENiHBG101724
InParanoidiQ9P127
OMAiSERSHGH
OrthoDBiEOG091G0QN2
PhylomeDBiQ9P127
TreeFamiTF350091

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P127-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASFRKLTLS EKVPPNHPSR KKVNFLDMSL DDIIIYKELE GTNAEEEKNK
60 70 80 90 100
RQNHSKKESP SRQQSKAHRH RHRRGYSRCR SNSEEGNHDK KPSQKPSGFK
110 120 130 140 150
SGQHPLNGQP LIEQEKCSDN YEAQAEKNQG QSEGNQHQSE GNPDKSEESQ
160 170 180 190 200
GQPEENHHSE RSRNHLERSL SQSDRSQGQL KRHHPQYERS HGQYKRSHGQ
210 220 230 240 250
SERSHGHSER SHGHSERSHG HSERSHGHSK RSRSQGDLVD TQSDLIATQR
260 270 280 290 300
DLIATQKDLI ATQRDLIATQ RDLIVTQRDL VATERDLINQ SGRSHGQSER
310
HQRYSTGKNT ITT
Length:313
Mass (Da):35,937
Last modified:October 1, 2000 - v1
Checksum:iE041911D9BA1DC8B
GO
Isoform 2 (identifier: Q9P127-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MASFRKLTLSEKVPPNHPSRKKVNFLDMSLDD → MLKKKRIKDRTIVKRNRLQDSNQKLIDIAIGE
     33-114: Missing.

Note: No experimental confirmation available.
Show »
Length:231
Mass (Da):26,534
Checksum:i26605DE787405609
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05114614P → S. Corresponds to variant dbSNP:rs10482480Ensembl.1
Natural variantiVAR_051147306T → A. Corresponds to variant dbSNP:rs35314601Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0539261 – 32MASFR…MSLDD → MLKKKRIKDRTIVKRNRLQD SNQKLIDIAIGE in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_05392733 – 114Missing in isoform 2. 1 PublicationAdd BLAST82

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124430 mRNA Translation: AAF28870.1
AK093369 mRNA Translation: BAG52698.1
AL109751 Genomic DNA Translation: CAC09922.1
BC128134 mRNA Translation: AAI28135.1
CCDSiCCDS14567.1 [Q9P127-1]
RefSeqiNP_001305769.1, NM_001318840.1 [Q9P127-2]
NP_057467.1, NM_016383.4 [Q9P127-1]
UniGeneiHs.242183

Genome annotation databases

EnsembliENST00000371920; ENSP00000360988; ENSG00000102021 [Q9P127-1]
GeneIDi51213
KEGGihsa:51213
UCSCiuc004eqa.4 human [Q9P127-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLUZP4_HUMAN
AccessioniPrimary (citable) accession number: Q9P127
Secondary accession number(s): B3KSD6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: October 1, 2000
Last modified: December 20, 2017
This is version 99 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome