Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine zipper protein 4

Gene

LUZP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Export adapter involved in mRNA nuclear export. Binds mRNA which is thought to be transferred to the NXF1-NXT1 heterodimer for export (TAP/NFX1 pathway). Binds NXF1, enhances its RNA-binding activity and is required for its localization to the nuclear rim. Associates with the TREX complex via its interaction with the TREX components THOC1, THOC5 and DDX39B/UAP56. Capable of complementing knockdown of ALYREF/THOC4 and partially complementing a double ALYREF/UIF knockdown in vivo. Required for the growth of the melanoma cell line MeWo (PubMed:25662211).1 Publication

GO - Molecular functioni

  • poly(A) RNA binding Source: UniProtKB
  • single-stranded DNA binding Source: UniProtKB
  • single-stranded RNA binding Source: UniProtKB

GO - Biological processi

  • cell growth Source: UniProtKB
  • mRNA export from nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

mRNA transport, Transport

Keywords - Ligandi

RNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-109688. Cleavage of Growing Transcript in the Termination Region.
R-HSA-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-HSA-72187. mRNA 3'-end processing.

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine zipper protein 4
Alternative name(s):
Cancer/testis antigen 28
Short name:
CT-28
Short name:
CT28
Tumor antigen HOM-TES-85
Gene namesi
Name:LUZP4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:24971. LUZP4.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134920076.

Polymorphism and mutation databases

BioMutaiLUZP4.
DMDMi74753106.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 313313Leucine zipper protein 4PRO_0000288649Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei234 – 2341PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ9P127.
PeptideAtlasiQ9P127.
PRIDEiQ9P127.

PTM databases

iPTMnetiQ9P127.
PhosphoSiteiQ9P127.

Expressioni

Tissue specificityi

Expressed specifically in testis. Also expressed in a wide variety of cancer types, but particularly high levels of expression observed in melanoma cells.2 Publications

Gene expression databases

BgeeiENSG00000102021.
CleanExiHS_LUZP4.
ExpressionAtlasiQ9P127. baseline and differential.
GenevisibleiQ9P127. HS.

Organism-specific databases

HPAiHPA046436.
HPA051999.

Interactioni

Subunit structurei

Interacts NXF1, NXF2, THOC1, THOC5, DDX39B/UAP56 and SRRT.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
APPBP2Q926243EBI-10198848,EBI-743771
CLK2P497603EBI-10198848,EBI-750020
EMDP504023EBI-10198848,EBI-489887
FOSQ6FG413EBI-10198848,EBI-10198738
FOSL2P154083EBI-10198848,EBI-3893419
KRTAP10-5P603703EBI-10198848,EBI-10172150
KRTAP10-8P604103EBI-10198848,EBI-10171774
KRTAP10-9P604113EBI-10198848,EBI-10172052
RCOR3Q9P2K33EBI-10198848,EBI-743428
SRPK2P783623EBI-10198848,EBI-593303
TLK1Q9UKI83EBI-10198848,EBI-740492

Protein-protein interaction databases

BioGridi119383. 91 interactions.
IntActiQ9P127. 11 interactions.
STRINGi9606.ENSP00000360988.

Structurei

3D structure databases

ProteinModelPortaliQ9P127.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 119119Interaction with DDX39B/UAP561 PublicationAdd
BLAST
Regioni51 – 8030Arg-rich; required for RNA-binding1 PublicationAdd
BLAST
Regioni178 – 23659RS-containing His-rich (RS-H); necessary for nuclear localization1 PublicationAdd
BLAST
Regioni238 – 28750Leucine-zipper; required for RNA-binding and for its relocalization to the cytoplasm during cell division1 PublicationAdd
BLAST
Regioni241 – 31373Interaction with NXF11 PublicationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi22 – 4019UAP56-binding motif (UBM); required for proper nuclear localization1 PublicationAdd
BLAST

Phylogenomic databases

eggNOGiENOG410IY7Q. Eukaryota.
ENOG410Z9DE. LUCA.
GeneTreeiENSGT00390000002455.
HOGENOMiHOG000065721.
HOVERGENiHBG101724.
InParanoidiQ9P127.
OMAiSERSHGH.
OrthoDBiEOG091G0QN2.
PhylomeDBiQ9P127.
TreeFamiTF350091.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P127-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASFRKLTLS EKVPPNHPSR KKVNFLDMSL DDIIIYKELE GTNAEEEKNK
60 70 80 90 100
RQNHSKKESP SRQQSKAHRH RHRRGYSRCR SNSEEGNHDK KPSQKPSGFK
110 120 130 140 150
SGQHPLNGQP LIEQEKCSDN YEAQAEKNQG QSEGNQHQSE GNPDKSEESQ
160 170 180 190 200
GQPEENHHSE RSRNHLERSL SQSDRSQGQL KRHHPQYERS HGQYKRSHGQ
210 220 230 240 250
SERSHGHSER SHGHSERSHG HSERSHGHSK RSRSQGDLVD TQSDLIATQR
260 270 280 290 300
DLIATQKDLI ATQRDLIATQ RDLIVTQRDL VATERDLINQ SGRSHGQSER
310
HQRYSTGKNT ITT
Length:313
Mass (Da):35,937
Last modified:October 1, 2000 - v1
Checksum:iE041911D9BA1DC8B
GO
Isoform 2 (identifier: Q9P127-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MASFRKLTLSEKVPPNHPSRKKVNFLDMSLDD → MLKKKRIKDRTIVKRNRLQDSNQKLIDIAIGE
     33-114: Missing.

Note: No experimental confirmation available.
Show »
Length:231
Mass (Da):26,534
Checksum:i26605DE787405609
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti14 – 141P → S.
Corresponds to variant rs10482480 [ dbSNP | Ensembl ].
VAR_051146
Natural varianti306 – 3061T → A.
Corresponds to variant rs35314601 [ dbSNP | Ensembl ].
VAR_051147

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3232MASFR…MSLDD → MLKKKRIKDRTIVKRNRLQD SNQKLIDIAIGE in isoform 2. 1 PublicationVSP_053926Add
BLAST
Alternative sequencei33 – 11482Missing in isoform 2. 1 PublicationVSP_053927Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124430 mRNA. Translation: AAF28870.1.
AK093369 mRNA. Translation: BAG52698.1.
AL109751 Genomic DNA. Translation: CAC09922.1.
BC128134 mRNA. Translation: AAI28135.1.
CCDSiCCDS14567.1. [Q9P127-1]
RefSeqiNP_001305769.1. NM_001318840.1. [Q9P127-2]
NP_057467.1. NM_016383.4. [Q9P127-1]
UniGeneiHs.242183.

Genome annotation databases

EnsembliENST00000371920; ENSP00000360988; ENSG00000102021. [Q9P127-1]
GeneIDi51213.
KEGGihsa:51213.
UCSCiuc004eqa.4. human. [Q9P127-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF124430 mRNA. Translation: AAF28870.1.
AK093369 mRNA. Translation: BAG52698.1.
AL109751 Genomic DNA. Translation: CAC09922.1.
BC128134 mRNA. Translation: AAI28135.1.
CCDSiCCDS14567.1. [Q9P127-1]
RefSeqiNP_001305769.1. NM_001318840.1. [Q9P127-2]
NP_057467.1. NM_016383.4. [Q9P127-1]
UniGeneiHs.242183.

3D structure databases

ProteinModelPortaliQ9P127.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119383. 91 interactions.
IntActiQ9P127. 11 interactions.
STRINGi9606.ENSP00000360988.

PTM databases

iPTMnetiQ9P127.
PhosphoSiteiQ9P127.

Polymorphism and mutation databases

BioMutaiLUZP4.
DMDMi74753106.

Proteomic databases

PaxDbiQ9P127.
PeptideAtlasiQ9P127.
PRIDEiQ9P127.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371920; ENSP00000360988; ENSG00000102021. [Q9P127-1]
GeneIDi51213.
KEGGihsa:51213.
UCSCiuc004eqa.4. human. [Q9P127-1]

Organism-specific databases

CTDi51213.
GeneCardsiLUZP4.
HGNCiHGNC:24971. LUZP4.
HPAiHPA046436.
HPA051999.
MIMi300616. gene.
neXtProtiNX_Q9P127.
PharmGKBiPA134920076.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IY7Q. Eukaryota.
ENOG410Z9DE. LUCA.
GeneTreeiENSGT00390000002455.
HOGENOMiHOG000065721.
HOVERGENiHBG101724.
InParanoidiQ9P127.
OMAiSERSHGH.
OrthoDBiEOG091G0QN2.
PhylomeDBiQ9P127.
TreeFamiTF350091.

Enzyme and pathway databases

ReactomeiR-HSA-109688. Cleavage of Growing Transcript in the Termination Region.
R-HSA-159236. Transport of Mature mRNA derived from an Intron-Containing Transcript.
R-HSA-72187. mRNA 3'-end processing.

Miscellaneous databases

GenomeRNAii51213.
PROiQ9P127.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000102021.
CleanExiHS_LUZP4.
ExpressionAtlasiQ9P127. baseline and differential.
GenevisibleiQ9P127. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiLUZP4_HUMAN
AccessioniPrimary (citable) accession number: Q9P127
Secondary accession number(s): B3KSD6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: October 1, 2000
Last modified: September 7, 2016
This is version 92 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.