SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9P0V9

- SEP10_HUMAN

UniProt

Q9P0V9 - SEP10_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Septin-10
Gene
SEPT10
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Filament-forming cytoskeletal GTPase. May play a role in cytokinesis Reviewed prediction.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei128 – 1281GTP; via amide nitrogen By similarity
Binding sitei263 – 2631GTP; via amide nitrogen and carbonyl oxygen By similarity
Binding sitei278 – 2781GTP By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi73 – 808GTP By similarity
Nucleotide bindingi209 – 2179GTP By similarity

GO - Molecular functioni

  1. GTP binding Source: UniProtKB-KW

GO - Biological processi

  1. cell cycle Source: UniProtKB-KW
  2. cell division Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Cell cycle, Cell division

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Septin-10
Gene namesi
Name:SEPT10
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:14349. SEPT10.

Subcellular locationi

Cytoplasm. Cytoplasmcytoskeleton By similarity
Note: Using a GFP-fusion protein, detected in the nucleus (1 Publication).1 Publication

GO - Cellular componenti

  1. septin complex Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134918683.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 454454Septin-10
PRO_0000173538Add
BLAST

Proteomic databases

MaxQBiQ9P0V9.
PaxDbiQ9P0V9.
PRIDEiQ9P0V9.

PTM databases

PhosphoSiteiQ9P0V9.

Expressioni

Tissue specificityi

Widely expressed. Abundantly expressed in heart and kidney, placenta, skeletal muscles, liver and lung, as well as various tumor cell lines.2 Publications

Gene expression databases

ArrayExpressiQ9P0V9.
BgeeiQ9P0V9.
CleanExiHS_SEPT10.
GenevestigatoriQ9P0V9.

Organism-specific databases

HPAiHPA056304.

Interactioni

Subunit structurei

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation By similarity.

Protein-protein interaction databases

BioGridi127339. 7 interactions.
IntActiQ9P0V9. 3 interactions.
MINTiMINT-6945309.
STRINGi9606.ENSP00000380824.

Structurei

3D structure databases

ProteinModelPortaliQ9P0V9.
SMRiQ9P0V9. Positions 65-331.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini63 – 329267Septin-type G
Add
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG5019.
HOGENOMiHOG000233586.
HOVERGENiHBG065093.
KOiK16940.
PhylomeDBiQ9P0V9.
TreeFamiTF101080.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR000038. Cell_div_GTP-bd.
IPR027417. P-loop_NTPase.
IPR016491. Septin.
[Graphical view]
PANTHERiPTHR18884. PTHR18884. 1 hit.
PfamiPF00735. Septin. 1 hit.
[Graphical view]
PIRSFiPIRSF006698. Septin. 1 hit.
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51719. G_SEPTIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9P0V9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MASSEVARHL LFQSHMATKT TCMSSQGSDD EQIKRENIRS LTMSGHVGFE    50
SLPDQLVNRS IQQGFCFNIL CVGETGIGKS TLIDTLFNTN FEDYESSHFC 100
PNVKLKAQTY ELQESNVQLK LTIVNTVGFG DQINKEESYQ PIVDYIDAQF 150
EAYLQEELKI KRSLFTYHDS RIHVCLYFIS PTGHSLKTLD LLTMKNLDSK 200
VNIIPVIAKA DTVSKTELQK FKIKLMSELV SNGVQIYQFP TDDDTIAKVN 250
AAMNGQLPFA VVGSMDEVKV GNKMVKARQY PWGVVQVENE NHCDFVKLRE 300
MLICTNMEDL REQTHTRHYE LYRRCKLEEM GFTDVGPENK PVSVQETYEA 350
KRHEFHGERQ RKEEEMKQMF VQRVKEKEAI LKEAERELQA KFEHLKRLHQ 400
EERMKLEEKR RLLEEEIIAF SKKKATSEIF HSQSFLATGS NLRKDKDRKN 450
SNFL 454
Length:454
Mass (Da):52,593
Last modified:October 23, 2007 - v2
Checksum:i95C8F7FAA266BC10
GO
Isoform 2 (identifier: Q9P0V9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     450-454: NSNFL → KEPGCRFELLCIDVRACETNGGRKDAEKAPIFCKTEVPEHRRSSSQANFIKKKN

Show »
Length:503
Mass (Da):58,136
Checksum:i4313FEB8875291E9
GO
Isoform 3 (identifier: Q9P0V9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     11-33: Missing.

Show »
Length:431
Mass (Da):50,065
Checksum:iCF6F70189AA897DA
GO

Sequence cautioni

The sequence AAF67469.1 differs from that shown. Reason: Frameshift at position 444.
Isoform 2 : The sequence AAH50345.2 differs from that shown. Reason: Frameshift at position 503.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti189 – 1891L → P.
Corresponds to variant rs3829701 [ dbSNP | Ensembl ].
VAR_051936

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei11 – 3323Missing in isoform 3.
VSP_041479Add
BLAST
Alternative sequencei450 – 4545NSNFL → KEPGCRFELLCIDVRACETN GGRKDAEKAPIFCKTEVPEH RRSSSQANFIKKKN in isoform 2.
VSP_014091

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF146760 mRNA. Translation: AAF67469.1. Frameshift.
AK092033 mRNA. Translation: BAG52471.1.
AK021681 mRNA. Translation: BAB13873.1.
AC140485 Genomic DNA. Translation: AAY24142.1.
CH471182 Genomic DNA. Translation: EAW53864.1.
BC020502 mRNA. Translation: AAH20502.1.
BC050345 mRNA. Translation: AAH50345.2. Frameshift.
CCDSiCCDS42726.1. [Q9P0V9-3]
CCDS46383.1. [Q9P0V9-1]
RefSeqiNP_653311.1. NM_144710.3. [Q9P0V9-1]
NP_848699.1. NM_178584.2. [Q9P0V9-3]
UniGeneiHs.469615.

Genome annotation databases

EnsembliENST00000397712; ENSP00000380824; ENSG00000186522. [Q9P0V9-1]
ENST00000397714; ENSP00000380826; ENSG00000186522. [Q9P0V9-3]
GeneIDi151011.
KEGGihsa:151011.
UCSCiuc002tew.4. human. [Q9P0V9-1]
uc002tex.4. human. [Q9P0V9-3]

Polymorphism databases

DMDMi160400057.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF146760 mRNA. Translation: AAF67469.1 . Frameshift.
AK092033 mRNA. Translation: BAG52471.1 .
AK021681 mRNA. Translation: BAB13873.1 .
AC140485 Genomic DNA. Translation: AAY24142.1 .
CH471182 Genomic DNA. Translation: EAW53864.1 .
BC020502 mRNA. Translation: AAH20502.1 .
BC050345 mRNA. Translation: AAH50345.2 . Frameshift.
CCDSi CCDS42726.1. [Q9P0V9-3 ]
CCDS46383.1. [Q9P0V9-1 ]
RefSeqi NP_653311.1. NM_144710.3. [Q9P0V9-1 ]
NP_848699.1. NM_178584.2. [Q9P0V9-3 ]
UniGenei Hs.469615.

3D structure databases

ProteinModelPortali Q9P0V9.
SMRi Q9P0V9. Positions 65-331.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 127339. 7 interactions.
IntActi Q9P0V9. 3 interactions.
MINTi MINT-6945309.
STRINGi 9606.ENSP00000380824.

PTM databases

PhosphoSitei Q9P0V9.

Polymorphism databases

DMDMi 160400057.

Proteomic databases

MaxQBi Q9P0V9.
PaxDbi Q9P0V9.
PRIDEi Q9P0V9.

Protocols and materials databases

DNASUi 151011.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000397712 ; ENSP00000380824 ; ENSG00000186522 . [Q9P0V9-1 ]
ENST00000397714 ; ENSP00000380826 ; ENSG00000186522 . [Q9P0V9-3 ]
GeneIDi 151011.
KEGGi hsa:151011.
UCSCi uc002tew.4. human. [Q9P0V9-1 ]
uc002tex.4. human. [Q9P0V9-3 ]

Organism-specific databases

CTDi 151011.
GeneCardsi GC02M110300.
H-InvDB HIX0018271.
HGNCi HGNC:14349. SEPT10.
HPAi HPA056304.
MIMi 611737. gene.
neXtProti NX_Q9P0V9.
PharmGKBi PA134918683.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5019.
HOGENOMi HOG000233586.
HOVERGENi HBG065093.
KOi K16940.
PhylomeDBi Q9P0V9.
TreeFami TF101080.

Miscellaneous databases

GenomeRNAii 151011.
NextBioi 86574.
PROi Q9P0V9.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9P0V9.
Bgeei Q9P0V9.
CleanExi HS_SEPT10.
Genevestigatori Q9P0V9.

Family and domain databases

Gene3Di 3.40.50.300. 1 hit.
InterProi IPR000038. Cell_div_GTP-bd.
IPR027417. P-loop_NTPase.
IPR016491. Septin.
[Graphical view ]
PANTHERi PTHR18884. PTHR18884. 1 hit.
Pfami PF00735. Septin. 1 hit.
[Graphical view ]
PIRSFi PIRSF006698. Septin. 1 hit.
SUPFAMi SSF52540. SSF52540. 1 hit.
PROSITEi PS51719. G_SEPTIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and functional characterization of human septin 10, a novel member of septin family cloned from dendritic cells."
    Sui L., Zhang W., Liu Q., Chen T., Li N., Wan T., Yu M., Cao X.
    Biochem. Biophys. Res. Commun. 304:393-398(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GTPASE ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Dendritic cell.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Testis and Uterus.
  6. "Expression profiling the human septin gene family."
    Hall P.A., Jung K., Hillan K.J., Russell S.E.H.
    J. Pathol. 206:269-278(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiSEP10_HUMAN
AccessioniPrimary (citable) accession number: Q9P0V9
Secondary accession number(s): B3KRQ9, Q86VP5, Q9HAH6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: October 23, 2007
Last modified: July 9, 2014
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi