Q9P0V9 (SEP10_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Septin-10 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 454 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Filament-forming cytoskeletal GTPase. May play a role in cytokinesis Potential. |
| Subunit structure | Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation By similarity. |
| Subcellular location | Cytoplasm. Cytoplasm › cytoskeleton By similarity. Note: Using a GFP-fusion protein, detected in the nucleus (Ref.1). Ref.1 |
| Tissue specificity | Widely expressed. Abundantly expressed in heart and kidney, placenta, skeletal muscles, liver and lung, as well as various tumor cell lines. Ref.1 Ref.6 |
| Sequence similarities | Belongs to the septin family. |
| Sequence caution | The sequence AAF67469.1 differs from that shown. Reason: Frameshift at position 444. Isoform 2: The sequence AAH50345.2 differs from that shown. Reason: Frameshift at position 503. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell cycle Cell division |
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | GTP-binding Nucleotide-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cell cycle Inferred from electronic annotation. Source: UniProtKB-KW cell divisionInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | septin complex Inferred from electronic annotation. Source: InterPro |
| Molecular_function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P0V9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P0V9-2) The sequence of this isoform differs from the canonical sequence as follows: 450-454: NSNFL → KEPGCRFELLCIDVRACETNGGRKDAEKAPIFCKTEVPEHRRSSSQANFIKKKN | ||||||
| Isoform 3 (identifier: Q9P0V9-3) The sequence of this isoform differs from the canonical sequence as follows: 11-33: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 454 | 454 | Septin-10 | PRO_0000173538 | |||||
Regions | |||||||||
| Nucleotide binding | 73 – 80 | 8 | GTP By similarity | ||||||
| Nucleotide binding | 209 – 217 | 9 | GTP By similarity | ||||||
Sites | |||||||||
| Binding site | 128 | 1 | GTP; via amide nitrogen By similarity | ||||||
| Binding site | 263 | 1 | GTP; via amide nitrogen and carbonyl oxygen By similarity | ||||||
| Binding site | 278 | 1 | GTP By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 11 – 33 | 23 | Missing in isoform 3. | VSP_041479 | |||||
| Alternative sequence | 450 – 454 | 5 | NSNFL → KEPGCRFELLCIDVRACETN GGRKDAEKAPIFCKTEVPEH RRSSSQANFIKKKN in isoform 2. | VSP_014091 | |||||
| Natural variant | 189 | 1 | L → P. Corresponds to variant rs3829701 [ dbSNP | Ensembl ]. | VAR_051936 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and functional characterization of human septin 10, a novel member of septin family cloned from dendritic cells." Sui L., Zhang W., Liu Q., Chen T., Li N., Wan T., Yu M., Cao X. Biochem. Biophys. Res. Commun. 304:393-398(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GTPASE ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Dendritic cell. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Testis and Uterus. |
| [6] | "Expression profiling the human septin gene family." Hall P.A., Jung K., Hillan K.J., Russell S.E.H. J. Pathol. 206:269-278(2005) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF146760 mRNA. Translation: AAF67469.1. Frameshift. AK092033 mRNA. Translation: BAG52471.1. AK021681 mRNA. Translation: BAB13873.1. AC140485 Genomic DNA. Translation: AAY24142.1. CH471182 Genomic DNA. Translation: EAW53864.1. BC020502 mRNA. Translation: AAH20502.1. BC050345 mRNA. Translation: AAH50345.2. Frameshift. |
| IPI | IPI00374970. IPI00872036. IPI00873459. |
| RefSeq | NP_653311.1. NM_144710.3. NP_848699.1. NM_178584.2. |
| UniGene | Hs.469615. |
3D structure databases | |
| ProteinModelPortal | Q9P0V9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9P0V9. 2 interactions. |
| MINT | MINT-6945309. |
| STRING | 9606.ENSP00000380824. |
PTM databases | |
| PhosphoSite | Q9P0V9. |
Polymorphism databases | |
| DMDM | 160400057. |
Proteomic databases | |
| PaxDb | Q9P0V9. |
| PRIDE | Q9P0V9. |
Protocols and materials databases | |
| DNASU | 151011. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000397712; ENSP00000380824; ENSG00000186522. ENST00000397714; ENSP00000380826; ENSG00000186522. |
| GeneID | 151011. |
| KEGG | hsa:151011. |
| UCSC | uc002tew.3. human. uc002tex.3. human. |
Organism-specific databases | |
| CTD | 151011. |
| GeneCards | GC02M110300. |
| H-InvDB | HIX0018271. |
| HGNC | HGNC:14349. SEPT10. |
| HPA | HPA056304. |
| MIM | 611737. gene. |
| neXtProt | NX_Q9P0V9. |
| PharmGKB | PA134918683. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG5019. |
| HOGENOM | HOG000233586. |
| HOVERGEN | HBG065093. |
Gene expression databases | |
| ArrayExpress | Q9P0V9. |
| Bgee | Q9P0V9. |
| CleanEx | HS_SEPT10. |
| Genevestigator | Q9P0V9. |
| GermOnline | ENSG00000186522. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000038. Cell_div_GTP-bd. IPR016491. Septin. [Graphical view] |
| PANTHER | PTHR18884. PTHR18884. 1 hit. |
| Pfam | PF00735. Septin. 1 hit. [Graphical view] |
| PIRSF | PIRSF006698. Septin. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 151011. |
| NextBio | 86574. |
| SOURCE | Search... |
Entry information
| Entry name | SEP10_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P0V9 Secondary accession number(s): B3KRQ9, Q86VP5, Q9HAH6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
