Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9P0V9 (SEP10_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 97. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Septin-10
Gene names
Name:SEPT10
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length454 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Filament-forming cytoskeletal GTPase. May play a role in cytokinesis Potential.

Subunit structure

Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation By similarity.

Subcellular location

Cytoplasm. Cytoplasmcytoskeleton By similarity. Note: Using a GFP-fusion protein, detected in the nucleus (Ref.1). Ref.1

Tissue specificity

Widely expressed. Abundantly expressed in heart and kidney, placenta, skeletal muscles, liver and lung, as well as various tumor cell lines. Ref.1 Ref.6

Sequence similarities

Belongs to the septin family.

Sequence caution

The sequence AAF67469.1 differs from that shown. Reason: Frameshift at position 444.

Isoform 2: The sequence AAH50345.2 differs from that shown. Reason: Frameshift at position 503.

Ontologies

Keywords
   Biological processCell cycle
Cell division
   Cellular componentCytoplasm
Cytoskeleton
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandGTP-binding
Nucleotide-binding
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcell cycle

Inferred from electronic annotation. Source: UniProtKB-KW

cell division

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentseptin complex

Inferred from electronic annotation. Source: InterPro

   Molecular_functionGTP binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9P0V9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9P0V9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     450-454: NSNFL → KEPGCRFELLCIDVRACETNGGRKDAEKAPIFCKTEVPEHRRSSSQANFIKKKN
Isoform 3 (identifier: Q9P0V9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     11-33: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 454454Septin-10
PRO_0000173538

Regions

Nucleotide binding73 – 808GTP By similarity
Nucleotide binding209 – 2179GTP By similarity

Sites

Binding site1281GTP; via amide nitrogen By similarity
Binding site2631GTP; via amide nitrogen and carbonyl oxygen By similarity
Binding site2781GTP By similarity

Natural variations

Alternative sequence11 – 3323Missing in isoform 3.
VSP_041479
Alternative sequence450 – 4545NSNFL → KEPGCRFELLCIDVRACETN GGRKDAEKAPIFCKTEVPEH RRSSSQANFIKKKN in isoform 2.
VSP_014091
Natural variant1891L → P.
Corresponds to variant rs3829701 [ dbSNP | Ensembl ].
VAR_051936

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 23, 2007. Version 2.
Checksum: 95C8F7FAA266BC10

FASTA45452,593
        10         20         30         40         50         60 
MASSEVARHL LFQSHMATKT TCMSSQGSDD EQIKRENIRS LTMSGHVGFE SLPDQLVNRS 

        70         80         90        100        110        120 
IQQGFCFNIL CVGETGIGKS TLIDTLFNTN FEDYESSHFC PNVKLKAQTY ELQESNVQLK 

       130        140        150        160        170        180 
LTIVNTVGFG DQINKEESYQ PIVDYIDAQF EAYLQEELKI KRSLFTYHDS RIHVCLYFIS 

       190        200        210        220        230        240 
PTGHSLKTLD LLTMKNLDSK VNIIPVIAKA DTVSKTELQK FKIKLMSELV SNGVQIYQFP 

       250        260        270        280        290        300 
TDDDTIAKVN AAMNGQLPFA VVGSMDEVKV GNKMVKARQY PWGVVQVENE NHCDFVKLRE 

       310        320        330        340        350        360 
MLICTNMEDL REQTHTRHYE LYRRCKLEEM GFTDVGPENK PVSVQETYEA KRHEFHGERQ 

       370        380        390        400        410        420 
RKEEEMKQMF VQRVKEKEAI LKEAERELQA KFEHLKRLHQ EERMKLEEKR RLLEEEIIAF 

       430        440        450 
SKKKATSEIF HSQSFLATGS NLRKDKDRKN SNFL 

« Hide

Isoform 2 [UniParc].

Checksum: 4313FEB8875291E9
Show »

FASTA50358,136
Isoform 3 [UniParc].

Checksum: CF6F70189AA897DA
Show »

FASTA43150,065

References

« Hide 'large scale' references
[1]"Cloning and functional characterization of human septin 10, a novel member of septin family cloned from dendritic cells."
Sui L., Zhang W., Liu Q., Chen T., Li N., Wan T., Yu M., Cao X.
Biochem. Biophys. Res. Commun. 304:393-398(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GTPASE ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Dendritic cell.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Testis and Uterus.
[6]"Expression profiling the human septin gene family."
Hall P.A., Jung K., Hillan K.J., Russell S.E.H.
J. Pathol. 206:269-278(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF146760 mRNA. Translation: AAF67469.1. Frameshift.
AK092033 mRNA. Translation: BAG52471.1.
AK021681 mRNA. Translation: BAB13873.1.
AC140485 Genomic DNA. Translation: AAY24142.1.
CH471182 Genomic DNA. Translation: EAW53864.1.
BC020502 mRNA. Translation: AAH20502.1.
BC050345 mRNA. Translation: AAH50345.2. Frameshift.
RefSeqNP_653311.1. NM_144710.3.
NP_848699.1. NM_178584.2.
UniGeneHs.469615.

3D structure databases

ProteinModelPortalQ9P0V9.
SMRQ9P0V9. Positions 41-331.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid127339. 7 interactions.
IntActQ9P0V9. 3 interactions.
MINTMINT-6945309.
STRING9606.ENSP00000380824.

PTM databases

PhosphoSiteQ9P0V9.

Polymorphism databases

DMDM160400057.

Proteomic databases

PaxDbQ9P0V9.
PRIDEQ9P0V9.

Protocols and materials databases

DNASU151011.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000397712; ENSP00000380824; ENSG00000186522. [Q9P0V9-1]
ENST00000397714; ENSP00000380826; ENSG00000186522. [Q9P0V9-3]
GeneID151011.
KEGGhsa:151011.
UCSCuc002tew.4. human. [Q9P0V9-1]
uc002tex.4. human. [Q9P0V9-3]

Organism-specific databases

CTD151011.
GeneCardsGC02M110300.
H-InvDBHIX0018271.
HGNCHGNC:14349. SEPT10.
HPAHPA056304.
MIM611737. gene.
neXtProtNX_Q9P0V9.
PharmGKBPA134918683.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5019.
HOGENOMHOG000233586.
HOVERGENHBG065093.
KOK16940.
PhylomeDBQ9P0V9.
TreeFamTF101080.

Gene expression databases

ArrayExpressQ9P0V9.
BgeeQ9P0V9.
CleanExHS_SEPT10.
GenevestigatorQ9P0V9.

Family and domain databases

Gene3D3.40.50.300. 1 hit.
InterProIPR000038. Cell_div_GTP-bd.
IPR027417. P-loop_NTPase.
IPR016491. Septin.
[Graphical view]
PANTHERPTHR18884. PTHR18884. 1 hit.
PfamPF00735. Septin. 1 hit.
[Graphical view]
PIRSFPIRSF006698. Septin. 1 hit.
SUPFAMSSF52540. SSF52540. 1 hit.
ProtoNetSearch...

Other

GenomeRNAi151011.
NextBio86574.
PROQ9P0V9.
SOURCESearch...

Entry information

Entry nameSEP10_HUMAN
AccessionPrimary (citable) accession number: Q9P0V9
Secondary accession number(s): B3KRQ9, Q86VP5, Q9HAH6
Entry history
Integrated into UniProtKB/Swiss-Prot: June 21, 2005
Last sequence update: October 23, 2007
Last modified: April 16, 2014
This is version 97 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM