Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9P0V9

- SEP10_HUMAN

UniProt

Q9P0V9 - SEP10_HUMAN

Protein

Septin-10

Gene

SEPT10

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 2 (23 Oct 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Filament-forming cytoskeletal GTPase. May play a role in cytokinesis Potential.Curated

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei128 – 1281GTP; via amide nitrogenBy similarity
    Binding sitei263 – 2631GTP; via amide nitrogen and carbonyl oxygenBy similarity
    Binding sitei278 – 2781GTPBy similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Nucleotide bindingi73 – 808GTPBy similarity
    Nucleotide bindingi209 – 2179GTPBy similarity

    GO - Molecular functioni

    1. GTP binding Source: UniProtKB-KW

    GO - Biological processi

    1. cell cycle Source: UniProtKB-KW
    2. cell division Source: UniProtKB-KW

    Keywords - Biological processi

    Cell cycle, Cell division

    Keywords - Ligandi

    GTP-binding, Nucleotide-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Septin-10
    Gene namesi
    Name:SEPT10
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:14349. SEPT10.

    Subcellular locationi

    Cytoplasm 1 Publication. Cytoplasmcytoskeleton By similarity
    Note: Using a GFP-fusion protein, detected in the nucleus.1 Publication

    GO - Cellular componenti

    1. septin complex Source: InterPro

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134918683.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 454454Septin-10PRO_0000173538Add
    BLAST

    Proteomic databases

    MaxQBiQ9P0V9.
    PaxDbiQ9P0V9.
    PRIDEiQ9P0V9.

    PTM databases

    PhosphoSiteiQ9P0V9.

    Expressioni

    Tissue specificityi

    Widely expressed. Abundantly expressed in heart and kidney, placenta, skeletal muscles, liver and lung, as well as various tumor cell lines.2 Publications

    Gene expression databases

    ArrayExpressiQ9P0V9.
    BgeeiQ9P0V9.
    CleanExiHS_SEPT10.
    GenevestigatoriQ9P0V9.

    Organism-specific databases

    HPAiHPA056304.

    Interactioni

    Subunit structurei

    Septins polymerize into heterooligomeric protein complexes that form filaments, and can associate with cellular membranes, actin filaments and microtubules. GTPase activity is required for filament formation By similarity.By similarity

    Protein-protein interaction databases

    BioGridi127339. 7 interactions.
    IntActiQ9P0V9. 3 interactions.
    MINTiMINT-6945309.
    STRINGi9606.ENSP00000380824.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9P0V9.
    SMRiQ9P0V9. Positions 65-331.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini63 – 329267Septin-type GAdd
    BLAST

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiCOG5019.
    HOGENOMiHOG000233586.
    HOVERGENiHBG065093.
    KOiK16940.
    PhylomeDBiQ9P0V9.
    TreeFamiTF101080.

    Family and domain databases

    Gene3Di3.40.50.300. 1 hit.
    InterProiIPR000038. Cell_div_GTP-bd.
    IPR027417. P-loop_NTPase.
    IPR016491. Septin.
    [Graphical view]
    PANTHERiPTHR18884. PTHR18884. 1 hit.
    PfamiPF00735. Septin. 1 hit.
    [Graphical view]
    PIRSFiPIRSF006698. Septin. 1 hit.
    SUPFAMiSSF52540. SSF52540. 1 hit.
    PROSITEiPS51719. G_SEPTIN. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9P0V9-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MASSEVARHL LFQSHMATKT TCMSSQGSDD EQIKRENIRS LTMSGHVGFE    50
    SLPDQLVNRS IQQGFCFNIL CVGETGIGKS TLIDTLFNTN FEDYESSHFC 100
    PNVKLKAQTY ELQESNVQLK LTIVNTVGFG DQINKEESYQ PIVDYIDAQF 150
    EAYLQEELKI KRSLFTYHDS RIHVCLYFIS PTGHSLKTLD LLTMKNLDSK 200
    VNIIPVIAKA DTVSKTELQK FKIKLMSELV SNGVQIYQFP TDDDTIAKVN 250
    AAMNGQLPFA VVGSMDEVKV GNKMVKARQY PWGVVQVENE NHCDFVKLRE 300
    MLICTNMEDL REQTHTRHYE LYRRCKLEEM GFTDVGPENK PVSVQETYEA 350
    KRHEFHGERQ RKEEEMKQMF VQRVKEKEAI LKEAERELQA KFEHLKRLHQ 400
    EERMKLEEKR RLLEEEIIAF SKKKATSEIF HSQSFLATGS NLRKDKDRKN 450
    SNFL 454
    Length:454
    Mass (Da):52,593
    Last modified:October 23, 2007 - v2
    Checksum:i95C8F7FAA266BC10
    GO
    Isoform 2 (identifier: Q9P0V9-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         450-454: NSNFL → KEPGCRFELLCIDVRACETNGGRKDAEKAPIFCKTEVPEHRRSSSQANFIKKKN

    Show »
    Length:503
    Mass (Da):58,136
    Checksum:i4313FEB8875291E9
    GO
    Isoform 3 (identifier: Q9P0V9-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         11-33: Missing.

    Show »
    Length:431
    Mass (Da):50,065
    Checksum:iCF6F70189AA897DA
    GO

    Sequence cautioni

    The sequence AAF67469.1 differs from that shown. Reason: Frameshift at position 444.
    Isoform 2 : The sequence AAH50345.2 differs from that shown. Reason: Frameshift at position 503.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti189 – 1891L → P.
    Corresponds to variant rs3829701 [ dbSNP | Ensembl ].
    VAR_051936

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei11 – 3323Missing in isoform 3. 1 PublicationVSP_041479Add
    BLAST
    Alternative sequencei450 – 4545NSNFL → KEPGCRFELLCIDVRACETN GGRKDAEKAPIFCKTEVPEH RRSSSQANFIKKKN in isoform 2. 1 PublicationVSP_014091

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF146760 mRNA. Translation: AAF67469.1. Frameshift.
    AK092033 mRNA. Translation: BAG52471.1.
    AK021681 mRNA. Translation: BAB13873.1.
    AC140485 Genomic DNA. Translation: AAY24142.1.
    CH471182 Genomic DNA. Translation: EAW53864.1.
    BC020502 mRNA. Translation: AAH20502.1.
    BC050345 mRNA. Translation: AAH50345.2. Frameshift.
    CCDSiCCDS42726.1. [Q9P0V9-3]
    CCDS46383.1. [Q9P0V9-1]
    RefSeqiNP_653311.1. NM_144710.3. [Q9P0V9-1]
    NP_848699.1. NM_178584.2. [Q9P0V9-3]
    UniGeneiHs.469615.

    Genome annotation databases

    EnsembliENST00000397712; ENSP00000380824; ENSG00000186522. [Q9P0V9-1]
    ENST00000397714; ENSP00000380826; ENSG00000186522. [Q9P0V9-3]
    GeneIDi151011.
    KEGGihsa:151011.
    UCSCiuc002tew.4. human. [Q9P0V9-1]
    uc002tex.4. human. [Q9P0V9-3]

    Polymorphism databases

    DMDMi160400057.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF146760 mRNA. Translation: AAF67469.1 . Frameshift.
    AK092033 mRNA. Translation: BAG52471.1 .
    AK021681 mRNA. Translation: BAB13873.1 .
    AC140485 Genomic DNA. Translation: AAY24142.1 .
    CH471182 Genomic DNA. Translation: EAW53864.1 .
    BC020502 mRNA. Translation: AAH20502.1 .
    BC050345 mRNA. Translation: AAH50345.2 . Frameshift.
    CCDSi CCDS42726.1. [Q9P0V9-3 ]
    CCDS46383.1. [Q9P0V9-1 ]
    RefSeqi NP_653311.1. NM_144710.3. [Q9P0V9-1 ]
    NP_848699.1. NM_178584.2. [Q9P0V9-3 ]
    UniGenei Hs.469615.

    3D structure databases

    ProteinModelPortali Q9P0V9.
    SMRi Q9P0V9. Positions 65-331.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 127339. 7 interactions.
    IntActi Q9P0V9. 3 interactions.
    MINTi MINT-6945309.
    STRINGi 9606.ENSP00000380824.

    PTM databases

    PhosphoSitei Q9P0V9.

    Polymorphism databases

    DMDMi 160400057.

    Proteomic databases

    MaxQBi Q9P0V9.
    PaxDbi Q9P0V9.
    PRIDEi Q9P0V9.

    Protocols and materials databases

    DNASUi 151011.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000397712 ; ENSP00000380824 ; ENSG00000186522 . [Q9P0V9-1 ]
    ENST00000397714 ; ENSP00000380826 ; ENSG00000186522 . [Q9P0V9-3 ]
    GeneIDi 151011.
    KEGGi hsa:151011.
    UCSCi uc002tew.4. human. [Q9P0V9-1 ]
    uc002tex.4. human. [Q9P0V9-3 ]

    Organism-specific databases

    CTDi 151011.
    GeneCardsi GC02M110300.
    H-InvDB HIX0018271.
    HGNCi HGNC:14349. SEPT10.
    HPAi HPA056304.
    MIMi 611737. gene.
    neXtProti NX_Q9P0V9.
    PharmGKBi PA134918683.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5019.
    HOGENOMi HOG000233586.
    HOVERGENi HBG065093.
    KOi K16940.
    PhylomeDBi Q9P0V9.
    TreeFami TF101080.

    Miscellaneous databases

    GenomeRNAii 151011.
    NextBioi 86574.
    PROi Q9P0V9.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9P0V9.
    Bgeei Q9P0V9.
    CleanExi HS_SEPT10.
    Genevestigatori Q9P0V9.

    Family and domain databases

    Gene3Di 3.40.50.300. 1 hit.
    InterProi IPR000038. Cell_div_GTP-bd.
    IPR027417. P-loop_NTPase.
    IPR016491. Septin.
    [Graphical view ]
    PANTHERi PTHR18884. PTHR18884. 1 hit.
    Pfami PF00735. Septin. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF006698. Septin. 1 hit.
    SUPFAMi SSF52540. SSF52540. 1 hit.
    PROSITEi PS51719. G_SEPTIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and functional characterization of human septin 10, a novel member of septin family cloned from dendritic cells."
      Sui L., Zhang W., Liu Q., Chen T., Li N., Wan T., Yu M., Cao X.
      Biochem. Biophys. Res. Commun. 304:393-398(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), GTPASE ACTIVITY, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Dendritic cell.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Testis and Uterus.
    6. "Expression profiling the human septin gene family."
      Hall P.A., Jung K., Hillan K.J., Russell S.E.H.
      J. Pathol. 206:269-278(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiSEP10_HUMAN
    AccessioniPrimary (citable) accession number: Q9P0V9
    Secondary accession number(s): B3KRQ9, Q86VP5, Q9HAH6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: June 21, 2005
    Last sequence update: October 23, 2007
    Last modified: October 1, 2014
    This is version 101 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3