Q9P0L0 (VAPA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Vesicle-associated membrane protein-associated protein A Short name=VAMP-A Short name=VAMP-associated protein A Short name=VAP-A Alternative name(s): 33 kDa VAMP-associated protein Short name=VAP-33 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 249 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | |
| Subunit structure | Homodimer, and heterodimer with VAPB. Interacts with VAMP1, VAMP2, STX1A, BET1, SEC22C and with the C-terminal domain of OCLN. Interacts with OSBPL1A. Interacts (via MSP domain) with ZFYVE27; may retain ZFYVE27 in the endoplasmic reticulum and regulate its function in cell projections formation. Ref.1 Ref.6 Ref.9 Ref.11 |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type IV membrane protein. Note: Present in the plasma membrane and in intracellular vesicles, together with SNARE proteins. May also associate with the cytoskeleton. Colocalizes with OCLN at the tight junction in polarized epithelial cells. Ref.1 Ref.11 |
| Tissue specificity | Ubiquitous. |
| Sequence similarities | Belongs to the VAMP-associated protein (VAP) (TC 9.B.17) family. [View classification] Contains 1 MSP domain. |
| Sequence caution | The sequence AAD09742.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAF72105.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BG488667 differs from that shown. Reason: Frameshift at positions 72, 207 and 241. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| EGFR | P00533 | 2 | EBI-1059156,EBI-297353 | |
| ZFYVE27 | Q5T4F4 | 5 | EBI-1059156,EBI-3892947 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P0L0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P0L0-2) The sequence of this isoform differs from the canonical sequence as follows: 139-139: L → LGITPPGNAPTVTSMSSINNTVATPASYHTKDDPRGLSVLKQEKQK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | |||||||||||||||||||||||||||
| Chain | 2 – 249 | 248 | Vesicle-associated membrane protein-associated protein A | PRO_0000213470 | ||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||
| Topological domain | 2 – 227 | 226 | Cytoplasmic Potential | |||||||||||||||||||||||||||
| Transmembrane | 228 – 248 | 21 | Helical; Anchor for type IV membrane protein; Potential | |||||||||||||||||||||||||||
| Domain | 14 – 131 | 118 | MSP | |||||||||||||||||||||||||||
| Coiled coil | 169 – 205 | 37 | Potential | |||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.10 | |||||||||||||||||||||||||||
| Modified residue | 125 | 1 | N6-acetyllysine Ref.12 | |||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||
| Alternative sequence | 139 | 1 | L → LGITPPGNAPTVTSMSSINN TVATPASYHTKDDPRGLSVL KQEKQK in isoform 2. | VSP_038648 | ||||||||||||||||||||||||||
| Natural variant | 8 | 1 | M → T. Corresponds to variant rs1044163 [ dbSNP | Ensembl ]. | VAR_050440 | ||||||||||||||||||||||||||
| Natural variant | 104 | 1 | P → L. Corresponds to variant rs1127666 [ dbSNP | Ensembl ]. | VAR_050441 | ||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||
| Mutagenesis | 94 | 1 | K → D: Alters interaction with ZFYVE27; when associated with D-96. Ref.11 | |||||||||||||||||||||||||||
| Mutagenesis | 96 | 1 | M → D: Alters interaction with ZFYVE27; when associated with D-94. Ref.11 | |||||||||||||||||||||||||||
| Sequence conflict | 10 – 11 | 2 | KH → ND in AAC26508. Ref.6 | |||||||||||||||||||||||||||
| Sequence conflict | 10 – 11 | 2 | KH → ND in AAV38424. Ref.8 | |||||||||||||||||||||||||||
| Sequence conflict | 160 | 1 | P → S in AAF72105. Ref.2 | |||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||
| Beta strand | 14 – 21 | 8 | ||||||||||||||||||||||||||||
| Beta strand | 23 – 25 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 33 – 40 | 8 | ||||||||||||||||||||||||||||
| Beta strand | 43 – 45 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 47 – 54 | 8 | ||||||||||||||||||||||||||||
| Turn | 56 – 58 | 3 | ||||||||||||||||||||||||||||
| Beta strand | 59 – 63 | 5 | ||||||||||||||||||||||||||||
| Beta strand | 73 – 80 | 8 | ||||||||||||||||||||||||||||
| Beta strand | 94 – 101 | 8 | ||||||||||||||||||||||||||||
| Helix | 109 – 115 | 7 | ||||||||||||||||||||||||||||
| Beta strand | 122 – 130 | 9 | ||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "VAP-33 localizes to both an intracellular vesicle population and with occludin at the tight junction." Lapierre L.A., Tuma P.L., Navarre J., Goldenring J.R., Anderson J.M. J. Cell Sci. 112:3723-3732(1999) [PubMed: 10523508] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, INTERACTION WITH OCLN. Tissue: Liver. |
| [2] | "Cloning and isolating human 33kDa Vamp-associated protein cDNA." Zhou H.J., Huang X.W., Zhou Y., Hu S.L., Yuan J.G., Qiang B.Q. Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "DNA sequence and analysis of human chromosome 18." Nusbaum C., Zody M.C., Borowsky M.L., Kamal M., Kodira C.D., Taylor T.D., Whittaker C.A., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Yang X., Abouelleil A., Allen N.R., Anderson S., Bloom T., Bugalter B., Butler J. Lander E.S.Nature 437:551-555(2005) [PubMed: 16177791] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-199 (ISOFORM 2). Tissue: Lung. |
| [6] | "Identification of a human homologue of the vesicle-associated membrane protein (VAMP)-associated protein of 33 kDa (VAP-33): a broadly expressed protein that binds to VAMP." Weir M.L., Klip A., Trimble W.S. Biochem. J. 333:247-251(1998) [PubMed: 9657962] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-249 (ISOFORM 1), INTERACTION WITH VAMP1 AND VAMP2. Tissue: Pancreatic islet. |
| [7] | "Molecular cloning and characterization of mammalian homologues of vesicle-associated membrane protein-associated (VAMP-associated) proteins." Nishimura Y., Hayashi M., Inada H., Tanaka T. Biochem. Biophys. Res. Commun. 254:21-26(1999) [PubMed: 9920726] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 8-249 (ISOFORM 1). Tissue: B-cell. |
| [8] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 8-249 (ISOFORM 1). |
| [9] | "VAP-A binds promiscuously to both v- and tSNAREs." Weir M.L., Xie H., Klip A., Trimble W.S. Biochem. Biophys. Res. Commun. 286:616-621(2001) [PubMed: 11511104] [Abstract] Cited for: FUNCTION, INTERACTION WITH VAPB; VAMP1; VAMP2; STX1A; BET1 AND SEC22C. |
| [10] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, MASS SPECTROMETRY. Tissue: Embryonic kidney. |
| [11] | "Promotion of neurite extension by protrudin requires its interaction with vesicle-associated membrane protein-associated protein." Saita S., Shirane M., Natume T., Iemura S., Nakayama K.I. J. Biol. Chem. 284:13766-13777(2009) [PubMed: 19289470] [Abstract] Cited for: FUNCTION, INTERACTION WITH ZFYVE27, MUTAGENESIS OF LYS-94 AND MET-96, SUBCELLULAR LOCATION. |
| [12] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-125, MASS SPECTROMETRY. |
| [13] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF044670 mRNA. Translation: AAD09742.1. Different initiation. AF154847 mRNA. Translation: AAF72105.1. Different initiation. AC006238 Genomic DNA. No translation available. CH471113 Genomic DNA. Translation: EAX01591.1. CH471113 Genomic DNA. Translation: EAX01592.1. BC002992 mRNA. Translation: AAH02992.2. BG488667 mRNA. No translation available. AF057358 mRNA. Translation: AAC26508.1. AF086627 mRNA. Translation: AAD13576.1. BT019618 mRNA. Translation: AAV38424.1. | ||||||||||||
| IPI | IPI00170692. IPI00374657. | ||||||||||||
| RefSeq | NP_003565.4. NM_003574.5. NP_919415.2. NM_194434.2. | ||||||||||||
| UniGene | Hs.165195. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9P0L0. | ||||||||||||
| SMR | Q9P0L0. Positions 9-135. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9P0L0. 22 interactions. | ||||||||||||
| STRING | Q9P0L0. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9P0L0. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 122066680. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9P0L0. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000400000; ENSP00000382880; ENSG00000101558. | ||||||||||||
| GeneID | 9218. | ||||||||||||
| KEGG | hsa:9218. | ||||||||||||
| UCSC | uc002kok.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 9218. | ||||||||||||
| GeneCards | GC18P009904. | ||||||||||||
| H-InvDB | HIX0014330. | ||||||||||||
| HGNC | HGNC:12648. VAPA. | ||||||||||||
| HPA | HPA009174. | ||||||||||||
| MIM | 605703. gene. | ||||||||||||
| neXtProt | NX_Q9P0L0. | ||||||||||||
| PharmGKB | PA37272. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG17459. | ||||||||||||
| GeneTree | ENSGT00390000006947. | ||||||||||||
| HOVERGEN | HBG028551. | ||||||||||||
| OMA | TASFRDN. | ||||||||||||
| PhylomeDB | Q9P0L0. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_22258. Metabolism of lipids and lipoproteins. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9P0L0. | ||||||||||||
| Bgee | Q9P0L0. | ||||||||||||
| CleanEx | HS_VAPA. | ||||||||||||
| Genevestigator | Q9P0L0. | ||||||||||||
| GermOnline | ENSG00000101558. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR000535. Major_sperm. IPR008962. PapD-like. IPR016763. Vesicle-associated_membrane. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:2.60.40.360. MSP. 1 hit. | ||||||||||||
| KO | K06096. | ||||||||||||
| Pfam | PF00635. Motile_Sperm. 1 hit. [Graphical view] | ||||||||||||
| PIRSF | PIRSF019693. VAMP-associated. 1 hit. | ||||||||||||
| SUPFAM | SSF49354. PapD-like. 1 hit. | ||||||||||||
| PROSITE | PS50202. MSP. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 34557. | ||||||||||||
| PMAP-CutDB | Q9P0L0. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | VAPA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P0L0 Secondary accession number(s): A6NDZ0 Q9UBZ2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with