Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Disintegrin and metalloproteinase domain-containing protein 22

Gene

ADAM22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein (PubMed:19692335). Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation. Neuronal receptor for LGI1.4 Publications

GO - Molecular functioni

  • integrin binding Source: UniProtKB
  • metalloendopeptidase activity Source: InterPro

GO - Biological processi

  • adult locomotory behavior Source: Ensembl
  • cell adhesion Source: UniProtKB-KW
  • central nervous system development Source: ProtInc
  • myelination in peripheral nervous system Source: Ensembl
  • negative regulation of cell adhesion Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Cell adhesion

Enzyme and pathway databases

BioCyciZFISH:ENSG00000008277-MONOMER.
ReactomeiR-HSA-5682910. LGI-ADAM interactions.

Protein family/group databases

MEROPSiM12.978.

Names & Taxonomyi

Protein namesi
Recommended name:
Disintegrin and metalloproteinase domain-containing protein 22
Short name:
ADAM 22
Alternative name(s):
Metalloproteinase-disintegrin ADAM22-3
Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2
Gene namesi
Name:ADAM22
Synonyms:MDC2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:201. ADAM22.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini223 – 736ExtracellularSequence analysisAdd BLAST514
Transmembranei737 – 757HelicalSequence analysisAdd BLAST21
Topological domaini758 – 906CytoplasmicSequence analysisAdd BLAST149

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi834S → A: Abolishes interactions with YWHAB and YWHAZ; when associated with A-857. 2 Publications1
Mutagenesisi857S → A: Abolishes interactions with YWHAB and YWHAZ; when associated with A-834. 2 Publications1

Organism-specific databases

DisGeNETi53616.
OpenTargetsiENSG00000008277.
PharmGKBiPA24518.

Polymorphism and mutation databases

BioMutaiADAM22.
DMDMi14423634.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 25Sequence analysisAdd BLAST25
PropeptideiPRO_000002911226 – 222By similarityAdd BLAST197
ChainiPRO_0000029113223 – 906Disintegrin and metalloproteinase domain-containing protein 22Add BLAST684

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi175N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi349 ↔ 4331 Publication
Disulfide bondi392 ↔ 4171 Publication
Disulfide bondi394 ↔ 4011 Publication
Disulfide bondi447 ↔ 4771 Publication
Disulfide bondi458 ↔ 4741 Publication
Disulfide bondi460 ↔ 4661 Publication
Disulfide bondi473 ↔ 4941 Publication
Disulfide bondi485 ↔ 4911 Publication
Disulfide bondi490 ↔ 5161 Publication
Disulfide bondi503 ↔ 5231 Publication
Disulfide bondi510 ↔ 5421 Publication
Glycosylationi519N-linked (GlcNAc...)1 Publication1
Disulfide bondi535 ↔ 5471 Publication
Disulfide bondi554 ↔ 6051 Publication
Disulfide bondi569 ↔ 6351 Publication
Disulfide bondi583 ↔ 5931 Publication
Disulfide bondi600 ↔ 6631 Publication
Glycosylationi634N-linked (GlcNAc...)1 Publication1
Disulfide bondi657 ↔ 6681 Publication
Glycosylationi675N-linked (GlcNAc...)1 Publication1
Disulfide bondi679 ↔ 6941 Publication
Disulfide bondi688 ↔ 7001 Publication
Disulfide bondi702 ↔ 7111 Publication
Modified residuei810PhosphoserineBy similarity1
Modified residuei834PhosphoserineCombined sources1
Modified residuei857PhosphoserineBy similarity1
Modified residuei862PhosphoserineBy similarity1
Modified residuei866PhosphoserineBy similarity1
Modified residuei870PhosphoserineBy similarity1

Post-translational modificationi

The precursor is cleaved by a furin endopeptidase.By similarity

Keywords - PTMi

Cleavage on pair of basic residues, Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ9P0K1.
PaxDbiQ9P0K1.
PeptideAtlasiQ9P0K1.
PRIDEiQ9P0K1.

PTM databases

iPTMnetiQ9P0K1.
PhosphoSitePlusiQ9P0K1.

Expressioni

Tissue specificityi

Highly expressed in the brain and in some high-grade but not low-grade gliomas. Detected slightly or not at all in other tissues.1 Publication

Gene expression databases

BgeeiENSG00000008277.
CleanExiHS_ADAM22.
ExpressionAtlasiQ9P0K1. baseline and differential.
GenevisibleiQ9P0K1. HS.

Organism-specific databases

HPAiHPA045282.

Interactioni

Subunit structurei

Interacts with LGI1 and can bind to LGI4 (By similarity). Interacts with KCNA2, DLG2 and DLG4 (By similarity). Interacts through its C-terminal region with YWHAB/14-3-3 beta and YWHAZ/14-3-3 zeta but not with YWHAE/14-3-3 epsilon or YWHAH/14-3-3 eta.By similarity2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
YWHABP319462EBI-1567267,EBI-359815
YWHAQP273482EBI-1567267,EBI-359854
YWHAZP631043EBI-1567267,EBI-347088

GO - Molecular functioni

  • integrin binding Source: UniProtKB

Protein-protein interaction databases

BioGridi119789. 9 interactors.
IntActiQ9P0K1. 11 interactors.
MINTiMINT-252818.
STRINGi9606.ENSP00000265727.

Structurei

Secondary structure

1906
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi235 – 237Combined sources3
Beta strandi239 – 247Combined sources9
Helixi249 – 253Combined sources5
Turni254 – 257Combined sources4
Helixi259 – 280Combined sources22
Beta strandi281 – 292Combined sources12
Helixi305 – 318Combined sources14
Beta strandi325 – 333Combined sources9
Beta strandi336 – 338Combined sources3
Beta strandi341 – 343Combined sources3
Turni351 – 353Combined sources3
Beta strandi354 – 359Combined sources6
Helixi363 – 378Combined sources16
Helixi384 – 389Combined sources6
Helixi416 – 427Combined sources12
Helixi432 – 435Combined sources4
Helixi463 – 466Combined sources4
Turni467 – 473Combined sources7
Beta strandi486 – 488Combined sources3
Beta strandi491 – 496Combined sources6
Beta strandi502 – 504Combined sources3
Turni536 – 539Combined sources4
Beta strandi540 – 543Combined sources4
Beta strandi546 – 548Combined sources3
Helixi550 – 558Combined sources9
Helixi567 – 573Combined sources7
Turni574 – 576Combined sources3
Beta strandi585 – 590Combined sources6
Helixi595 – 597Combined sources3
Beta strandi600 – 602Combined sources3
Beta strandi605 – 607Combined sources3
Beta strandi613 – 617Combined sources5
Beta strandi622 – 628Combined sources7
Beta strandi631 – 637Combined sources7
Beta strandi640 – 645Combined sources6
Beta strandi656 – 658Combined sources3
Beta strandi661 – 666Combined sources6
Beta strandi668 – 670Combined sources3
Helixi671 – 674Combined sources4
Helixi688 – 690Combined sources3
Beta strandi692 – 695Combined sources4
Beta strandi700 – 702Combined sources3
Beta strandi706 – 708Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3G5CX-ray2.36A/B233-736[»]
ProteinModelPortaliQ9P0K1.
SMRiQ9P0K1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9P0K1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini239 – 438Peptidase M12BPROSITE-ProRule annotationAdd BLAST200
Domaini444 – 531DisintegrinPROSITE-ProRule annotationAdd BLAST88
Domaini675 – 712EGF-likeAdd BLAST38

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi532 – 678Cys-richAdd BLAST147

Sequence similaritiesi

Contains 1 disintegrin domain.PROSITE-ProRule annotation
Contains 1 EGF-like domain.Curated
Contains 1 peptidase M12B domain.PROSITE-ProRule annotation

Keywords - Domaini

EGF-like domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3607. Eukaryota.
ENOG410XX2M. LUCA.
GeneTreeiENSGT00800000124044.
HOGENOMiHOG000231962.
HOVERGENiHBG050456.
InParanoidiQ9P0K1.
KOiK16068.
OMAiKYIWGQK.
OrthoDBiEOG091G010C.
PhylomeDBiQ9P0K1.
TreeFamiTF314733.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR018358. Disintegrin_CS.
IPR001762. Disintegrin_dom.
IPR013032. EGF-like_CS.
IPR013111. EGF_extracell.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF07974. EGF_2. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
PRINTSiPR00289. DISINTEGRIN.
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P0K1-1) [UniParc]FASTAAdd to basket
Also known as: Epsilon

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MQAAVAVSVP FLLLCVLGTC PPARCGQAGD ASLMELEKRK ENRFVERQSI
60 70 80 90 100
VPLRLIYRSG GEDESRHDAL DTRVRGDLGG PQLTHVDQAS FQVDAFGTSF
110 120 130 140 150
ILDVVLNHDL LSSEYIERHI EHGGKTVEVK GGEHCYYQGH IRGNPDSFVA
160 170 180 190 200
LSTCHGLHGM FYDGNHTYLI EPEENDTTQE DFHFHSVYKS RLFEFSLDDL
210 220 230 240 250
PSEFQQVNIT PSKFILKPRP KRSKRQLRRY PRNVEEETKY IELMIVNDHL
260 270 280 290 300
MFKKHRLSVV HTNTYAKSVV NMADLIYKDQ LKTRIVLVAM ETWATDNKFA
310 320 330 340 350
ISENPLITLR EFMKYRRDFI KEKSDAVHLF SGSQFESSRS GAAYIGGICS
360 370 380 390 400
LLKGGGVNEF GKTDLMAVTL AQSLAHNIGI ISDKRKLASG ECKCEDTWSG
410 420 430 440 450
CIMGDTGYYL PKKFTQCNIE EYHDFLNSGG GACLFNKPSK LLDPPECGNG
460 470 480 490 500
FIETGEECDC GTPAECVLEG AECCKKCTLT QDSQCSDGLC CKKCKFQPMG
510 520 530 540 550
TVCREAVNDC DIRETCSGNS SQCAPNIHKM DGYSCDGVQG ICFGGRCKTR
560 570 580 590 600
DRQCKYIWGQ KVTASDKYCY EKLNIEGTEK GNCGKDKDTW IQCNKRDVLC
610 620 630 640 650
GYLLCTNIGN IPRLGELDGE ITSTLVVQQG RTLNCSGGHV KLEEDVDLGY
660 670 680 690 700
VEDGTPCGPQ MMCLEHRCLP VASFNFSTCL SSKEGTICSG NGVCSNELKC
710 720 730 740 750
VCNRHWIGSD CNTYFPHNDD AKTGITLSGN GVAGTNIIIG IIAGTILVLA
760 770 780 790 800
LILGITAWGY KNYREQRQLP QGDYVKKPGD GDSFYSDIPP GVSTNSASSS
810 820 830 840 850
KKRSNGLSHS WSERIPDTKH ISDICENGRP RSNSWQGNLG GNKKKIRGKR
860 870 880 890 900
FRPRSNSTET LSPAKSPSSS TGSIASSRKY PYPMPPLPDE DKKVNRQSAR

LWETSI
Length:906
Mass (Da):100,433
Last modified:October 1, 2000 - v1
Checksum:i265ECCD0FA6C088B
GO
Isoform 2 (identifier: Q9P0K1-2) [UniParc]FASTAAdd to basket
Also known as: Delta

The sequence of this isoform differs from the canonical sequence as follows:
     768-803: Missing.
     859-859: E → EYLNPWFKRDYNVAKWVEDVNKNTEGPYFR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:899
Mass (Da):100,269
Checksum:i5AB89C258ECE0736
GO
Isoform 3 (identifier: Q9P0K1-3) [UniParc]FASTAAdd to basket
Also known as: Alpha

The sequence of this isoform differs from the canonical sequence as follows:
     860-906: Missing.

Show »
Length:859
Mass (Da):95,288
Checksum:i6105B681A1331D55
GO
Isoform 4 (identifier: Q9P0K1-4) [UniParc]FASTAAdd to basket
Also known as: Beta

The sequence of this isoform differs from the canonical sequence as follows:
     768-803: Missing.
     860-906: Missing.

Show »
Length:823
Mass (Da):91,492
Checksum:iE9FD1A9BA99DE0DB
GO
Isoform 5 (identifier: Q9P0K1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     768-803: Missing.

Show »
Length:870
Mass (Da):96,637
Checksum:iC236086AD0BCCA2F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Isoform 2 (identifier: Q9P0K1-2)
Sequence conflicti848G → E in AAF73288 (PubMed:11050470).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02005781P → R.2 PublicationsCorresponds to variant rs2279542dbSNPEnsembl.1
Natural variantiVAR_051589119H → Y.Corresponds to variant rs4728730dbSNPEnsembl.1
Natural variantiVAR_051590207V → I.Corresponds to variant rs17255978dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005482768 – 803Missing in isoform 2, isoform 4 and isoform 5. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_005484859E → EYLNPWFKRDYNVAKWVEDV NKNTEGPYFR in isoform 2. 1 Publication1
Alternative sequenceiVSP_005483860 – 906Missing in isoform 3 and isoform 4. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009671 mRNA. Translation: BAA32349.1.
AB009671 mRNA. Translation: BAA32350.1.
AF155381 mRNA. Translation: AAF73288.1.
AF155382 mRNA. Translation: AAF73289.1.
AF073291 mRNA. Translation: AAF22476.2.
AC005075 Genomic DNA. No translation available.
AF158637 mRNA. Translation: AAD55251.1.
CCDSiCCDS43608.1. [Q9P0K1-2]
CCDS43609.1. [Q9P0K1-5]
CCDS43610.1. [Q9P0K1-3]
CCDS47637.1. [Q9P0K1-1]
RefSeqiNP_004185.1. NM_004194.4. [Q9P0K1-3]
NP_068367.1. NM_021721.4. [Q9P0K1-4]
NP_068368.2. NM_021722.5. [Q9P0K1-2]
NP_068369.1. NM_021723.4. [Q9P0K1-1]
UniGeneiHs.256398.

Genome annotation databases

EnsembliENST00000265727; ENSP00000265727; ENSG00000008277. [Q9P0K1-1]
ENST00000398201; ENSP00000381260; ENSG00000008277. [Q9P0K1-3]
ENST00000398204; ENSP00000381262; ENSG00000008277. [Q9P0K1-5]
ENST00000398209; ENSP00000381267; ENSG00000008277. [Q9P0K1-2]
GeneIDi53616.
KEGGihsa:53616.
UCSCiuc003ujk.3. human. [Q9P0K1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB009671 mRNA. Translation: BAA32349.1.
AB009671 mRNA. Translation: BAA32350.1.
AF155381 mRNA. Translation: AAF73288.1.
AF155382 mRNA. Translation: AAF73289.1.
AF073291 mRNA. Translation: AAF22476.2.
AC005075 Genomic DNA. No translation available.
AF158637 mRNA. Translation: AAD55251.1.
CCDSiCCDS43608.1. [Q9P0K1-2]
CCDS43609.1. [Q9P0K1-5]
CCDS43610.1. [Q9P0K1-3]
CCDS47637.1. [Q9P0K1-1]
RefSeqiNP_004185.1. NM_004194.4. [Q9P0K1-3]
NP_068367.1. NM_021721.4. [Q9P0K1-4]
NP_068368.2. NM_021722.5. [Q9P0K1-2]
NP_068369.1. NM_021723.4. [Q9P0K1-1]
UniGeneiHs.256398.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3G5CX-ray2.36A/B233-736[»]
ProteinModelPortaliQ9P0K1.
SMRiQ9P0K1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119789. 9 interactors.
IntActiQ9P0K1. 11 interactors.
MINTiMINT-252818.
STRINGi9606.ENSP00000265727.

Protein family/group databases

MEROPSiM12.978.

PTM databases

iPTMnetiQ9P0K1.
PhosphoSitePlusiQ9P0K1.

Polymorphism and mutation databases

BioMutaiADAM22.
DMDMi14423634.

Proteomic databases

MaxQBiQ9P0K1.
PaxDbiQ9P0K1.
PeptideAtlasiQ9P0K1.
PRIDEiQ9P0K1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000265727; ENSP00000265727; ENSG00000008277. [Q9P0K1-1]
ENST00000398201; ENSP00000381260; ENSG00000008277. [Q9P0K1-3]
ENST00000398204; ENSP00000381262; ENSG00000008277. [Q9P0K1-5]
ENST00000398209; ENSP00000381267; ENSG00000008277. [Q9P0K1-2]
GeneIDi53616.
KEGGihsa:53616.
UCSCiuc003ujk.3. human. [Q9P0K1-1]

Organism-specific databases

CTDi53616.
DisGeNETi53616.
GeneCardsiADAM22.
HGNCiHGNC:201. ADAM22.
HPAiHPA045282.
MIMi603709. gene.
neXtProtiNX_Q9P0K1.
OpenTargetsiENSG00000008277.
PharmGKBiPA24518.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3607. Eukaryota.
ENOG410XX2M. LUCA.
GeneTreeiENSGT00800000124044.
HOGENOMiHOG000231962.
HOVERGENiHBG050456.
InParanoidiQ9P0K1.
KOiK16068.
OMAiKYIWGQK.
OrthoDBiEOG091G010C.
PhylomeDBiQ9P0K1.
TreeFamiTF314733.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000008277-MONOMER.
ReactomeiR-HSA-5682910. LGI-ADAM interactions.

Miscellaneous databases

ChiTaRSiADAM22. human.
EvolutionaryTraceiQ9P0K1.
GeneWikiiADAM22.
GenomeRNAii53616.
PROiQ9P0K1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000008277.
CleanExiHS_ADAM22.
ExpressionAtlasiQ9P0K1. baseline and differential.
GenevisibleiQ9P0K1. HS.

Family and domain databases

Gene3Di3.40.390.10. 1 hit.
4.10.70.10. 1 hit.
InterProiIPR006586. ADAM_Cys-rich.
IPR018358. Disintegrin_CS.
IPR001762. Disintegrin_dom.
IPR013032. EGF-like_CS.
IPR013111. EGF_extracell.
IPR024079. MetalloPept_cat_dom.
IPR001590. Peptidase_M12B.
IPR002870. Peptidase_M12B_N.
[Graphical view]
PfamiPF08516. ADAM_CR. 1 hit.
PF00200. Disintegrin. 1 hit.
PF07974. EGF_2. 1 hit.
PF01562. Pep_M12B_propep. 1 hit.
PF01421. Reprolysin. 1 hit.
[Graphical view]
PRINTSiPR00289. DISINTEGRIN.
SMARTiSM00608. ACR. 1 hit.
SM00050. DISIN. 1 hit.
[Graphical view]
SUPFAMiSSF57552. SSF57552. 1 hit.
PROSITEiPS50215. ADAM_MEPRO. 1 hit.
PS00427. DISINTEGRIN_1. 1 hit.
PS50214. DISINTEGRIN_2. 1 hit.
PS00022. EGF_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiADA22_HUMAN
AccessioniPrimary (citable) accession number: Q9P0K1
Secondary accession number(s): O75075
, O75076, Q9P0K2, Q9UIA1, Q9UKK2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: October 1, 2000
Last modified: November 2, 2016
This is version 158 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.