Reviewed,
UniProtKB/Swiss-Prot Q9P0K1 (ADA22_HUMAN)
Last modified
July 7, 2009.
Version 84.
History...
Clusters with 100%,
90%,
50% identity |
Documents (6) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Disintegrin and metalloproteinase domain-containing protein 22 Short name=ADAM 22 Alternative name(s): Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 2 Metalloproteinase-disintegrin ADAM22-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 906 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Probable ligand for integrin in the brain. This is a non catalytic metalloprotease-like protein. Involved in regulation of cell adhesion and spreading and in inhibition of cell proliferation. Ref.5 Ref.7 Ref.8 |
| Subunit structure | Interacts through its C-terminal region with YWHAB/14-3-3 beta and YWHAZ/14-3-3 zeta but not with YWHAE/14-3-3 epsilon or YWHAH/14-3-3 eta. Ref.5 Ref.7 |
| Subcellular location | |
| Tissue specificity | Highly expressed in the brain and in some high-grade but not low-grade gliomas. Detected slightly or not at all in other tissues. Ref.8 |
| Post-translational modification | The precursor is cleaved by a furin endopeptidase By similarity. |
| Sequence similarities | Contains 1 disintegrin domain. Contains 1 EGF-like domain. Contains 1 peptidase M12B domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Cell adhesion |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | EGF-like domain Signal Transmembrane |
| PTM | Cleavage on pair of basic residues Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell adhesion Inferred from electronic annotation. Source: UniProtKB-KW central nervous system development Ref.1Traceable author statement. Source: ProtInc negative regulation of cell adhesion Ref.1Non-traceable author statement. Source: UniProtKB proteolysisInferred from electronic annotation. Source: InterPro |
| Cellular component | integral to membrane Ref.1 Non-traceable author statement. Source: UniProtKB |
| Molecular function | integrin binding Ref.1 Non-traceable author statement. Source: UniProtKB metalloendopeptidase activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| YWHAB | P31946 | 2 | EBI-1567258,EBI-359815 | |
| YWHAB | P31946 | 1 | EBI-1567267,EBI-359815 | |
| YWHAE | P62258 | 1 | EBI-1567267,EBI-356498 | |
| Ywhag | P61982 | 1 | EBI-1567267,EBI-359843 | From a different organism. |
| YWHAH | Q04917 | 1 | EBI-1567267,EBI-306940 | |
| YWHAQ | P27348 | 2 | EBI-1567258,EBI-359854 | |
| YWHAQ | P27348 | 1 | EBI-1567267,EBI-359854 | |
| YWHAZ | P63104 | 2 | EBI-1567258,EBI-347088 | |
| YWHAZ | P63104 | 2 | EBI-1567267,EBI-347088 |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9P0K1-1) Also known as: Epsilon; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9P0K1-2) Also known as: Delta; The sequence of this isoform differs from the canonical sequence as follows: 768-803: Missing. 859-859: E → EYLNPWFKRDYNVAKWVEDVNKNTEEPYFR | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 3 (identifier: Q9P0K1-3) Also known as: Alpha; The sequence of this isoform differs from the canonical sequence as follows: 860-906: Missing. | ||||||
| Isoform 4 (identifier: Q9P0K1-4) Also known as: Beta; The sequence of this isoform differs from the canonical sequence as follows: 768-803: Missing. 860-906: Missing. | ||||||
| Isoform 5 (identifier: Q9P0K1-5) The sequence of this isoform differs from the canonical sequence as follows: 768-803: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||||
| Propeptide | 26 – 222 | 197 | By similarity | PRO_0000029112 | |||||||
| Chain | 223 – 906 | 684 | Disintegrin and metalloproteinase domain-containing protein 22 | PRO_0000029113 | |||||||
Regions | |||||||||||
| Topological domain | 223 – 736 | 514 | Extracellular Potential | ||||||||
| Transmembrane | 737 – 757 | 21 | Potential | ||||||||
| Topological domain | 758 – 906 | 149 | Cytoplasmic Potential | ||||||||
| Domain | 239 – 438 | 200 | Peptidase M12B | ||||||||
| Domain | 444 – 531 | 88 | Disintegrin | ||||||||
| Domain | 675 – 712 | 38 | EGF-like | ||||||||
| Compositional bias | 532 – 678 | 147 | Cys-rich | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 834 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 866 | 1 | Phosphoserine By similarity | ||||||||
| Modified residue | 868 | 1 | Phosphoserine By similarity | ||||||||
| Glycosylation | 175 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 519 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 634 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 675 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 349 ↔ 433 | By similarity | |||||||||
| Disulfide bond | 392 ↔ 417 | By similarity | |||||||||
| Disulfide bond | 394 ↔ 401 | By similarity | |||||||||
| Disulfide bond | 503 ↔ 523 | By similarity | |||||||||
| Disulfide bond | 679 ↔ 694 | By similarity | |||||||||
| Disulfide bond | 688 ↔ 700 | By similarity | |||||||||
| Disulfide bond | 702 ↔ 711 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 768 – 803 | 36 | Missing in isoform 2, isoform 4 and isoform 5. | VSP_005482 | |||||||
| Alternative sequence | 859 | 1 | E → EYLNPWFKRDYNVAKWVEDV NKNTEEPYFR in isoform 2. | VSP_005484 | |||||||
| Alternative sequence | 860 – 906 | 47 | Missing in isoform 3 and isoform 4. | VSP_005483 | |||||||
| Natural variant | 81 | 1 | P → R: dbSNP rs2279542. Ref.3 Ref.4 | VAR_020057 | |||||||
| Natural variant | 119 | 1 | H → Y: dbSNP rs4728730. | VAR_051589 | |||||||
| Natural variant | 207 | 1 | V → I: dbSNP rs17255978. | VAR_051590 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 834 | 1 | S → A: Abolishes interactions with YWHAB and YWHAZ; when associated with A-857. Ref.5 Ref.7 | ||||||||
| Mutagenesis | 857 | 1 | S → A: Abolishes interactions with YWHAB and YWHAZ; when associated with A-834. Ref.5 Ref.7 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "Metalloproteinase-like, disintegrin-like, cysteine-rich proteins MDC2 and MDC3: novel human cellular disintegrins highly expressed in the brain." Sagane K., Ohya Y., Hasegawa Y., Tanaka I. Biochem. J. 334:93-98(1998) [PubMed: 9693107] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4). Tissue: Brain. |
| [2] | "The specific expression of three novel splice variant forms of human metalloprotease-like disintegrin-like cysteine-rich protein 2 gene in brain tissues and gliomas." Harada T., Nishie A., Torigoe K., Ikezaki K., Shono T., Maehara Y., Kuwano M., Wada M. Jpn. J. Cancer Res. 91:1001-1006(2000) [PubMed: 11050470] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2). |
| [3] | "Isolation and tissue specific expression of novel ADAM family from 7q21.1 region." Wada M., Torigoe K., Harada T., Kuwano M. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), VARIANT ARG-81. Tissue: Brain. |
| [4] | "The identification of seven metalloproteinase-disintegrin (ADAM) genes from genomic libraries." Poindexter K., Nelson N., DuBose R.F., Black R.A., Cerretti D.P. Gene 237:61-70(1999) [PubMed: 10524237] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 40-906 (ISOFORM 1), VARIANT ARG-81. Tissue: Cerebellum. |
| [5] | "The interaction between ADAM 22 and 14-3-3zeta: regulation of cell adhesion and spreading." Zhu P., Sun Y., Xu R., Sang Y., Zhao J., Liu G., Cai L., Li C., Zhao S. Biochem. Biophys. Res. Commun. 301:991-999(2003) [PubMed: 12589811] [Abstract] Cited for: FUNCTION, INTERACTION WITH YWHAZ, MUTAGENESIS OF SER-834 AND SER-857. |
| [6] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:RESEARCH008.1-RESEARCH008.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [7] | "ADAM22 plays an important role in cell adhesion and spreading with the assistance of 14-3-3." Zhu P., Sang Y., Xu H., Zhao J., Xu R., Sun Y., Xu T., Wang X., Chen L., Feng H., Li C., Zhao S. Biochem. Biophys. Res. Commun. 331:938-946(2005) [PubMed: 15882968] [Abstract] Cited for: FUNCTION, INTERACTION WITH YWHAB, MUTAGENESIS OF SER-834 AND SER-857. |
| [8] | "ADAM22, expressed in normal brain but not in high-grade gliomas, inhibits cellular proliferation via the disintegrin domain." D'Abaco G.M., Ng K., Paradiso L., Godde N.J., Kaye A., Novak U. Neurosurgery 58:179-186(2006) [PubMed: 16385342] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AB009671 mRNA. Translation: BAA32349.1. AB009671 mRNA. Translation: BAA32350.1. AF155381 mRNA. Translation: AAF73288.1. AF155382 mRNA. Translation: AAF73289.1. AF073291 mRNA. Translation: AAF22476.2. AF158637 mRNA. Translation: AAD55251.1. | |
| IPI | IPI00000779. IPI00220631. IPI00220632. IPI00220634. IPI00220635. |
| RefSeq | NP_057435.2. NP_068368.2. NP_068369.1. |
| UniGene | Hs.592282 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1FVL based on UniProtKB P18619. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9P0K1. 9 interactions. |
Protein family/group databases | |
| MEROPS | M12.978. |
PTM databases | |
| PhosphoSite | Q9P0K1. |
Proteomic databases | |
| PRIDE | Q9P0K1. |
Genome annotation databases | |
| Ensembl | ENSG00000008277. Homo sapiens. [Contig view] |
| GeneID | 53616. |
| UCSC | uc003ujk.1. human. uc003ujl.1. human. uc003ujn.1. human. uc003ujo.1. human. |
Organism-specific databases | |
| GeneCards | GC07P087401. |
| H-InvDB | HIX0025260. HIX0039022. |
| HGNC | HGNC:201. ADAM22. |
| MIM | 603709. gene. |
| PharmGKB | PA24518. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q9P0K1. |
| HOVERGEN | Q9P0K1. |
Gene expression databases | |
| ArrayExpress | Q9P0K1. |
| Bgee | Q9P0K1. |
| CleanEx | HS_ADAM22. |
| GermOnline | ENSG00000008277. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006586. ADAM_Cys-rich. IPR001762. Blood-coag_inhib_Disintegrin. IPR018358. Disintegrin_CS. IPR006210. EGF-like. IPR013032. EGF-like_reg_CS. IPR013111. EGF_extracell. IPR006025. Pept_M_Zn_BS. IPR001590. Peptidase_M12B. IPR002870. Peptidase_M12B_N. [Graphical view] |
| Gene3D | G3DSA:4.10.70.10. Blood-coag_inhib_Disintegrin. 1 hit. |
| Pfam | PF08516. ADAM_CR. 1 hit. PF00200. Disintegrin. 1 hit. PF07974. EGF_2. 1 hit. PF01562. Pep_M12B_propep. 1 hit. PF01421. Reprolysin. 1 hit. [Graphical view] |
| PRINTS | PR00289. DISINTEGRIN. |
| ProDom | PD000664. Disintegrin. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SMART | SM00608. ACR. 1 hit. SM00050. DISIN. 1 hit. SM00181. EGF. 1 hit. [Graphical view] |
| PROSITE | PS50215. ADAM_MEPRO. 1 hit. PS00427. DISINTEGRIN_1. 1 hit. PS50214. DISINTEGRIN_2. 1 hit. PS00022. EGF_1. 1 hit. PS01186. EGF_2. False negative. PS50026. EGF_3. False negative. PS00142. ZINC_PROTEASE. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 56096. |
| SOURCE | Search... |
Entry information
| Entry name | ADA22_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9P0K1 Secondary accession number(s): O75075 Q9UKK2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


