Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Thymocyte nuclear protein 1

Gene

THYN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Specifically binds 5-hydroxymethylcytosine (5hmC), suggesting that it acts as a specific reader of 5hmC.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Thymocyte nuclear protein 1
Alternative name(s):
Thymocyte protein Thy28
Gene namesi
Name:THYN1
Synonyms:THY28
ORF Names:HSPC144, MDS012, My0054
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:29560. THYN1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: HPA
  • nucleolus Source: HPA
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi29087.
OpenTargetsiENSG00000151500.
PharmGKBiPA128394653.

Polymorphism and mutation databases

BioMutaiTHYN1.
DMDMi74734762.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002625641 – 225Thymocyte nuclear protein 1Add BLAST225

Post-translational modificationi

Phosphorylated.By similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9P016.
MaxQBiQ9P016.
PaxDbiQ9P016.
PeptideAtlasiQ9P016.
PRIDEiQ9P016.

PTM databases

iPTMnetiQ9P016.
PhosphoSitePlusiQ9P016.

Expressioni

Gene expression databases

BgeeiENSG00000151500.
CleanExiHS_THYN1.
ExpressionAtlasiQ9P016. baseline and differential.
GenevisibleiQ9P016. HS.

Organism-specific databases

HPAiHPA038732.
HPA038733.

Interactioni

Protein-protein interaction databases

BioGridi118856. 8 interactors.
IntActiQ9P016. 3 interactors.
MINTiMINT-4776940.
STRINGi9606.ENSP00000341657.

Structurei

Secondary structure

1225
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi56 – 64Combined sources9
Beta strandi67 – 72Combined sources6
Helixi78 – 81Combined sources4
Helixi84 – 86Combined sources3
Beta strandi87 – 89Combined sources3
Helixi96 – 104Combined sources9
Beta strandi110 – 115Combined sources6
Beta strandi118 – 120Combined sources3
Beta strandi122 – 135Combined sources14
Helixi137 – 139Combined sources3
Beta strandi159 – 174Combined sources16
Helixi175 – 188Combined sources14
Turni191 – 194Combined sources4
Helixi196 – 199Combined sources4
Beta strandi204 – 208Combined sources5
Helixi210 – 218Combined sources9
Helixi219 – 221Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EOPX-ray2.30A/B55-221[»]
5J3EX-ray2.60A/B1-225[»]
ProteinModelPortaliQ9P016.
SMRiQ9P016.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9P016.

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi5 – 10Nuclear localization signalBy similarity6

Phylogenomic databases

eggNOGiKOG3383. Eukaryota.
COG2947. LUCA.
GeneTreeiENSGT00390000013297.
HOGENOMiHOG000263533.
HOVERGENiHBG054408.
InParanoidiQ9P016.
OMAiMTLFTRQ.
OrthoDBiEOG091G0MPN.
PhylomeDBiQ9P016.
TreeFamiTF332126.

Family and domain databases

Gene3Di3.10.590.10. 1 hit.
InterProiIPR002740. EVE_domain.
IPR015947. PUA-like_domain.
[Graphical view]
PfamiPF01878. EVE. 1 hit.
[Graphical view]
SUPFAMiSSF88697. SSF88697. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9P016-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRPRKRLAG TSGSDKGLSG KRTKTENSGE ALAKVEDSNP QKTSATKNCL
60 70 80 90 100
KNLSSHWLMK SEPESRLEKG VDVKFSIEDL KAQPKQTTCW DGVRNYQARN
110 120 130 140 150
FLRAMKLGEE AFFYHSNCKE PGIAGLMKIV KEAYPDHTQF EKNNPHYDPS
160 170 180 190 200
SKEDNPKWSM VDVQFVRMMK RFIPLAELKS YHQAHKATGG PLKNMVLFTR
210 220
QRLSIQPLTQ EEFDFVLSLE EKEPS
Length:225
Mass (Da):25,697
Last modified:October 1, 2000 - v1
Checksum:i76E6034A6404C962
GO
Isoform 2 (identifier: Q9P016-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     161-225: VDVQFVRMMKRFIPLAELKSYHQAHKATGGPLKNMVLFTRQRLSIQPLTQEEFDFVLSLEEKEPS → KSLILF

Show »
Length:166
Mass (Da):18,812
Checksum:i444349B36A982256
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti29G → V in AAH93074 (PubMed:15489334).Curated1
Sequence conflicti223E → G in AAG43118 (Ref. 2) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_021789161 – 225VDVQF…EKEPS → KSLILF in isoform 2. 2 PublicationsAdd BLAST65

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087886 mRNA. Translation: AAP97185.1.
AF059619 mRNA. Translation: AAG43118.1.
AF182413 mRNA. Translation: AAG14949.1.
AF161493 mRNA. Translation: AAF29108.1.
BC006978 mRNA. Translation: AAH06978.1.
BC093074 mRNA. Translation: AAH93074.1.
CCDSiCCDS8496.1. [Q9P016-1]
CCDS8497.1. [Q9P016-2]
RefSeqiNP_001032381.1. NM_001037304.1. [Q9P016-2]
NP_001032382.1. NM_001037305.1. [Q9P016-1]
NP_054893.1. NM_014174.2. [Q9P016-1]
NP_954994.1. NM_199297.1. [Q9P016-2]
NP_954995.1. NM_199298.1. [Q9P016-1]
UniGeneiHs.13645.

Genome annotation databases

EnsembliENST00000341541; ENSP00000341657; ENSG00000151500. [Q9P016-1]
ENST00000352327; ENSP00000341452; ENSG00000151500. [Q9P016-2]
ENST00000392594; ENSP00000376373; ENSG00000151500. [Q9P016-1]
ENST00000392595; ENSP00000376374; ENSG00000151500. [Q9P016-1]
GeneIDi29087.
KEGGihsa:29087.
UCSCiuc001qhf.4. human. [Q9P016-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF087886 mRNA. Translation: AAP97185.1.
AF059619 mRNA. Translation: AAG43118.1.
AF182413 mRNA. Translation: AAG14949.1.
AF161493 mRNA. Translation: AAF29108.1.
BC006978 mRNA. Translation: AAH06978.1.
BC093074 mRNA. Translation: AAH93074.1.
CCDSiCCDS8496.1. [Q9P016-1]
CCDS8497.1. [Q9P016-2]
RefSeqiNP_001032381.1. NM_001037304.1. [Q9P016-2]
NP_001032382.1. NM_001037305.1. [Q9P016-1]
NP_054893.1. NM_014174.2. [Q9P016-1]
NP_954994.1. NM_199297.1. [Q9P016-2]
NP_954995.1. NM_199298.1. [Q9P016-1]
UniGeneiHs.13645.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3EOPX-ray2.30A/B55-221[»]
5J3EX-ray2.60A/B1-225[»]
ProteinModelPortaliQ9P016.
SMRiQ9P016.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118856. 8 interactors.
IntActiQ9P016. 3 interactors.
MINTiMINT-4776940.
STRINGi9606.ENSP00000341657.

PTM databases

iPTMnetiQ9P016.
PhosphoSitePlusiQ9P016.

Polymorphism and mutation databases

BioMutaiTHYN1.
DMDMi74734762.

Proteomic databases

EPDiQ9P016.
MaxQBiQ9P016.
PaxDbiQ9P016.
PeptideAtlasiQ9P016.
PRIDEiQ9P016.

Protocols and materials databases

DNASUi29087.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000341541; ENSP00000341657; ENSG00000151500. [Q9P016-1]
ENST00000352327; ENSP00000341452; ENSG00000151500. [Q9P016-2]
ENST00000392594; ENSP00000376373; ENSG00000151500. [Q9P016-1]
ENST00000392595; ENSP00000376374; ENSG00000151500. [Q9P016-1]
GeneIDi29087.
KEGGihsa:29087.
UCSCiuc001qhf.4. human. [Q9P016-1]

Organism-specific databases

CTDi29087.
DisGeNETi29087.
GeneCardsiTHYN1.
HGNCiHGNC:29560. THYN1.
HPAiHPA038732.
HPA038733.
MIMi613739. gene.
neXtProtiNX_Q9P016.
OpenTargetsiENSG00000151500.
PharmGKBiPA128394653.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3383. Eukaryota.
COG2947. LUCA.
GeneTreeiENSGT00390000013297.
HOGENOMiHOG000263533.
HOVERGENiHBG054408.
InParanoidiQ9P016.
OMAiMTLFTRQ.
OrthoDBiEOG091G0MPN.
PhylomeDBiQ9P016.
TreeFamiTF332126.

Miscellaneous databases

EvolutionaryTraceiQ9P016.
GeneWikiiTHYN1.
GenomeRNAii29087.
PROiQ9P016.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000151500.
CleanExiHS_THYN1.
ExpressionAtlasiQ9P016. baseline and differential.
GenevisibleiQ9P016. HS.

Family and domain databases

Gene3Di3.10.590.10. 1 hit.
InterProiIPR002740. EVE_domain.
IPR015947. PUA-like_domain.
[Graphical view]
PfamiPF01878. EVE. 1 hit.
[Graphical view]
SUPFAMiSSF88697. SSF88697. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiTHYN1_HUMAN
AccessioniPrimary (citable) accession number: Q9P016
Secondary accession number(s): Q567Q2, Q9H3L4, Q9HC20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: October 1, 2000
Last modified: November 30, 2016
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.