Q9NZZ3 (CHMP5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Charged multivesicular body protein 5 Alternative name(s): Chromatin-modifying protein 5 SNF7 domain-containing protein 2 Vacuolar protein sorting-associated protein 60 Short name=Vps60 Short name=hVps60 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 219 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release. Ref.8 |
| Subunit structure | Probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III). ESCRT-III components are thought to multimerize to form a flat lattice on the perimeter membrane of the endosome. Several assembly forms of ESCRT-III may exist that interact and act sequentally. Interacts with VTA1. Interacts with CHMP2A. Interacts with VTA1; the interaction involves soluble CHMP5. Ref.8 Ref.10 Ref.12 |
| Subcellular location | Cytoplasm › cytosol. Endosome membrane; Peripheral membrane protein Probable. Note: Localizes to the midbody of dividing cells. Localized in two distinct rings on either side of the Fleming body. Ref.10 Ref.11 |
| Sequence similarities | Belongs to the SNF7 family. |
| Sequence caution | The sequence AAG23821.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Cellular component | Cytoplasm Endosome Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular membrane organization Traceable author statement. Source: Reactome endosomal transportTraceable author statement. Source: Reactome endosome to lysosome transportInferred from electronic annotation. Source: Compara lysosome organizationInferred from electronic annotation. Source: Compara protein transportInferred from electronic annotation. Source: UniProtKB-KW regulation of receptor recyclingInferred from electronic annotation. Source: Compara |
| Cellular_component | cytosol Traceable author statement. Source: Reactome endosome membraneInferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| STAMBP | O95630 | 2 | EBI-751303,EBI-396676 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NZZ3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NZZ3-2) The sequence of this isoform differs from the canonical sequence as follows: 166-219: ELDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQIPAS → GWSSGG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||
Molecule processing | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 219 | 219 | Charged multivesicular body protein 5 | PRO_0000211500 | |||||||||
Regions | |||||||||||||
| Region | 121 – 158 | 38 | Interaction with VTA1 | ||||||||||
| Coiled coil | 26 – 179 | 154 | Potential | ||||||||||
Amino acid modifications | |||||||||||||
| Modified residue | 86 | 1 | Phosphoserine Ref.14 | ||||||||||
Natural variations | |||||||||||||
| Alternative sequence | 166 – 219 | 54 | ELDAL…QIPAS → GWSSGG in isoform 2. | VSP_042556 | |||||||||
| Natural variant | 86 | 1 | S → P. Corresponds to variant rs11540558 [ dbSNP | Ensembl ]. | VAR_052029 | |||||||||
Experimental info | |||||||||||||
| Sequence conflict | 14 | 1 | P → R in AAD27743. Ref.1 | ||||||||||
| Sequence conflict | 19 | 1 | D → G in AAH16698. Ref.6 | ||||||||||
| Sequence conflict | 84 – 93 | 10 | QQSFNMEQAN → NSHSTWTGH in AAD27743. Ref.1 | ||||||||||
| Sequence conflict | 122 | 1 | Q → P in AAD27743. Ref.1 | ||||||||||
Secondary structure | |||||||||||||
Helix Strand Turn | |||||||||||||
| Helix | 160 – 176 | 17 | |||||||||||
| Helix | 181 – 188 | 8 | |||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells." Zhang Q.-H., Ye M., Wu X.-Y., Ren S.-X., Zhao M., Zhao C.-J., Fu G., Shen Y., Fan H.-Y., Lu G., Zhong M., Xu X.-R., Han Z.-G., Zhang J.-W., Tao J., Huang Q.-H., Zhou J., Hu G.-X. Chen Z.Genome Res. 10:1546-1560(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Umbilical cord blood. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Hippocampus. |
| [4] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Bone marrow, Brain, Kidney and Urinary bladder. |
| [7] | "Human acute promyelocytic leukemia cell line NB4's apoptosis related genes." Yu W.-Q., Sun B.-Z., Chai Y.-B., Zhu F., Liu X.-S., Li Z., Lu F., Yan W., Yang H., Zhao Z.-L. Submitted (JUN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 81-219 (ISOFORM 1). Tissue: Promyelocytic leukemia. |
| [8] | "Divergent retroviral late-budding domains recruit vacuolar protein sorting factors by using alternative adaptor proteins." Martin-Serrano J., Yarovoy A., Perez-Caballero D., Bieniasz P.D. Proc. Natl. Acad. Sci. U.S.A. 100:12414-12419(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN HIV-1 BUDDING, INTERACTION WITH CHMP2A. |
| [9] | Erratum Martin-Serrano J., Yarovoy A., Perez-Caballero D., Bieniasz P.D. Proc. Natl. Acad. Sci. U.S.A. 100:152845-152845(2003) |
| [10] | "The role of LIP5 and CHMP5 in multivesicular body formation and HIV-1 budding in mammalian cells." Ward D.M., Vaughn M.B., Shiflett S.L., White P.L., Pollock A.L., Hill J., Schnegelberger R., Sundquist W.I., Kaplan J. J. Biol. Chem. 280:10548-10555(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH VTA1. |
| [11] | "Human ESCRT and ALIX proteins interact with proteins of the midbody and function in cytokinesis." Morita E., Sandrin V., Chung H.Y., Morham S.G., Gygi S.P., Rodesch C.K., Sundquist W.I. EMBO J. 26:4215-4227(2007) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [12] | "Targeting of AMSH to endosomes is required for epidermal growth factor receptor degradation." Ma Y.M., Boucrot E., Villen J., Affar el B., Gygi S.P., Goettlinger H.G., Kirchhausen T. J. Biol. Chem. 282:9805-9812(2007) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH VTA1, MASS SPECTROMETRY. |
| [13] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [14] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF132968 mRNA. Translation: AAD27743.1. AF161525 mRNA. Translation: AAF29140.1. AK295744 mRNA. Translation: BAG58578.1. AK315455 mRNA. Translation: BAG37842.1. AL356472 Genomic DNA. Translation: CAH72744.1. CH471071 Genomic DNA. Translation: EAW58512.1. BC006974 mRNA. Translation: AAH06974.1. BC007457 mRNA. Translation: AAH07457.1. BC016698 mRNA. Translation: AAH16698.1. BC020796 mRNA. Translation: AAH20796.1. BC021168 mRNA. Translation: AAH21168.1. AF275810 mRNA. Translation: AAG23821.1. Different initiation. AF229832 mRNA. Translation: AAF42917.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00100796. IPI00981695. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001182465.1. NM_001195536.1. NP_057494.3. NM_016410.5. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.635313. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| DIP | DIP-50420N. | ||||||||||||||||||||||||||||||||||||
| IntAct | Q9NZZ3. 3 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-1466639. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000223500. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 51702157. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
| PeptideAtlas | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
| PRIDE | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 51510. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000223500; ENSP00000223500; ENSG00000086065. ENST00000419016; ENSP00000442725; ENSG00000086065. | ||||||||||||||||||||||||||||||||||||
| GeneID | 51510. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:51510. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc003zsm.4. human. uc011lnv.2. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 51510. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC09P033257. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:26942. CHMP5. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB033874. HPA042883. HPA056437. | ||||||||||||||||||||||||||||||||||||
| MIM | 610900. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134903143. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | NOG300000. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000191086. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG055759. | ||||||||||||||||||||||||||||||||||||
| InParanoid | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
| KO | K12198. | ||||||||||||||||||||||||||||||||||||
| OMA | NQSFNME. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4PK290. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Reactome | REACT_11123. Membrane Trafficking. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| Bgee | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_CHMP5. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9NZZ3. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000086065. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR005024. Snf7. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF03357. Snf7. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| ChiTaRS | CHMP5. human. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 51510. | ||||||||||||||||||||||||||||||||||||
| NextBio | 55198. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | CHMP5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NZZ3 Secondary accession number(s): B2RD95 Q9Y323 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
