Q9NZQ3 (SPN90_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: NCK-interacting protein with SH3 domain Alternative name(s): 54 kDa VacA-interacting protein 54 kDa vimentin-interacting protein Short name=VIP54 90 kDa SH3 protein interacting with Nck AF3p21 Dia-interacting protein 1 Short name=DIP-1 Diaphanous protein-interacting protein SH3 adapter protein SPIN90 WASP-interacting SH3-domain protein Short name=WISH Wiskott-Aldrich syndrome protein-interacting protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 722 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo By similarity. In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 By similarity. May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. |
| Subunit structure | Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain By similarity. Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Ref.2 Ref.6 Ref.11 |
| Subcellular location | Nucleus. Note: Colocalizes with DRF1 at membrane ruffles, and with Nck at Z-disks in mature cardiac myocytes. |
| Tissue specificity | Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen. Ref.2 |
| Involvement in disease | Note=A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with MLL. |
| Sequence similarities | Contains 1 SH3 domain. |
| Sequence caution | The sequence BAG57476.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement Polymorphism |
| Disease | Proto-oncogene |
| Domain | SH3 domain SH3-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | NLS-bearing substrate import into nucleus Traceable author statement. Source: ProtInc cytoskeleton organizationNon-traceable author statement Ref.2. Source: UniProtKB signal transductionTraceable author statement. Source: ProtInc |
| Cellular component | intermediate filament Non-traceable author statement Ref.2. Source: UniProtKB nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | SH3 domain binding Inferred from electronic annotation. Source: UniProtKB-KW cytoskeletal protein bindingNon-traceable author statement Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NZQ3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NZQ3-2) The sequence of this isoform differs from the canonical sequence as follows: 656-722: LRMEYLSLMH...EFLVLGEAPS → GPFGAGQRPW...IDSAFGGRSV | ||||||
| Isoform 3 (identifier: Q9NZQ3-3) The sequence of this isoform differs from the canonical sequence as follows: 165-171: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q9NZQ3-4) Also known as: WISH-B; The sequence of this isoform differs from the canonical sequence as follows: 165-171: Missing. 656-658: LRM → GVH 659-722: Missing. | ||||||
| Isoform 5 (identifier: Q9NZQ3-5) The sequence of this isoform differs from the canonical sequence as follows: 567-596: AADQNVIMAALSKHANVKIFSEKLLLLLNR → GGVGPGWAVAEHMVALRLSTLSIPMSFLSC 597-722: Missing. | ||||||
| Note: Found in a brain affected by Alzheimer disease. May be due to intron retention. No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 722 | 722 | NCK-interacting protein with SH3 domain | PRO_0000072130 | |||||
Regions | |||||||||
| Domain | 1 – 58 | 58 | SH3 | ||||||
| Motif | 175 – 192 | 18 | Nuclear localization signal Potential | ||||||
| Compositional bias | 171 – 275 | 105 | Pro-rich | ||||||
| Compositional bias | 197 – 240 | 44 | Ser/Thr-rich | ||||||
| Compositional bias | 442 – 487 | 46 | Leu-rich | ||||||
| Compositional bias | 534 – 601 | 68 | Leu-rich | ||||||
Sites | |||||||||
| Site | 57 – 58 | 2 | Breakpoint for translocation to form MLL-AF3P21 oncogene | ||||||
Amino acid modifications | |||||||||
| Modified residue | 181 | 1 | Phosphothreonine Ref.10 | ||||||
Natural variations | |||||||||
| Alternative sequence | 165 – 171 | 7 | Missing in isoform 3 and isoform 4. | VSP_039422 | |||||
| Alternative sequence | 567 – 596 | 30 | AADQN…LLLNR → GGVGPGWAVAEHMVALRLST LSIPMSFLSC in isoform 5. | VSP_039423 | |||||
| Alternative sequence | 597 – 722 | 126 | Missing in isoform 5. | VSP_039424 | |||||
| Alternative sequence | 656 – 722 | 67 | LRMEY…GEAPS → GPFGAGQRPWPGVPRLLEPG STPSREPHPVERSGVPALTS SWASGCPRPLHPALQLVIDS AFGGRSV in isoform 2. | VSP_003971 | |||||
| Alternative sequence | 656 – 658 | 3 | LRM → GVH in isoform 4. | VSP_039425 | |||||
| Alternative sequence | 659 – 722 | 64 | Missing in isoform 4. | VSP_039426 | |||||
| Natural variant | 324 | 1 | T → S. Corresponds to variant rs6785620 [ dbSNP | Ensembl ]. | VAR_051378 | |||||
| Natural variant | 660 | 1 | Y → S. Ref.8 Corresponds to variant rs17855516 [ dbSNP | Ensembl ]. | VAR_063400 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Novel SH3 protein encoded by the AF3p21 gene is fused to the mixed lineage leukemia protein in a therapy-related leukemia with t(3;11)(p21;q23)." Sano K., Hayakawa A., Piao J.-H., Kosaka Y., Nakamura H. Blood 95:1066-1068(2000) [PubMed: 10648423] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHROMOSOMAL TRANSLOCATION WITH MLL. Tissue: Leukemia. |
| [2] | "The VacA toxin of Helicobacter pylori identifies a new intermediate filament-interacting protein." de Bernard M., Moschioni M., Napolitani G., Rappuoli R., Montecucco C. EMBO J. 19:48-56(2000) [PubMed: 10619843] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH VACA, TISSUE SPECIFICITY. Tissue: Cervix carcinoma. |
| [3] | "Genomic organization, tissue expression and cellular localization of AF3p21, a fusion partner of MLL in therapy-related leukemia." Hayakawa A., Matsuda Y., Daibata M., Nakamura H., Sano K. Genes Chromosomes Cancer 30:364-374(2001) [PubMed: 11241789] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1). Tissue: Cervix carcinoma. |
| [4] | "SPIN90 (SH3 protein interacting with Nck, 90 kDa), an adapter protein that is developmentally regulated during cardiac myocyte differentiation." Lim C.S., Park E.S., Kim D.J., Song Y.H., Eom S.H., Chun J.-S., Kim J.H., Kim J.-K., Park D., Song W.K. J. Biol. Chem. 276:12871-12878(2001) [PubMed: 11278500] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Heart. |
| [5] | "mDia-interacting protein acts downstream of rho-mDia and modifies src activation and stress fiber formation." Satoh S., Tominaga T. J. Biol. Chem. 276:39290-39294(2001) [PubMed: 11509578] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1 AND 2). Tissue: Brain and Placenta. |
| [6] | "Identification of FHOD1-binding proteins and mechanisms of FHOD1-regulated actin dynamics." Westendorf J.J., Koka S. J. Cell. Biochem. 92:29-41(2004) [PubMed: 15095401] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), INTERACTION WITH FHOD1. Tissue: Bone marrow. |
| [7] | "The DNA sequence, annotation and analysis of human chromosome 3." Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. Gibbs R.A.Nature 440:1194-1198(2006) [PubMed: 16641997] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT SER-660. Tissue: Placenta and Skin. |
| [9] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 448-722 (ISOFORM 5). Tissue: Brain cortex. |
| [10] | "Phosphoproteome of resting human platelets." Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A. J. Proteome Res. 7:526-534(2008) [PubMed: 18088087] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-181, MASS SPECTROMETRY. Tissue: Platelet. |
| [11] | "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening." Voss M., Lettau M., Janssen O. BMC Immunol. 10:53-53(2009) [PubMed: 19807924] [Abstract] Cited for: INTERACTION WITH FASLG. |
| [12] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF178432 mRNA. Translation: AAF35985.1. AJ242655 mRNA. Translation: CAB65089.2. AF303581 mRNA. Translation: AAK09094.1. AB069981 Genomic DNA. Translation: BAB63204.1. AB069982 Genomic DNA. Translation: BAB63205.1. AY453794 mRNA. Translation: AAR83735.1. AC141002 Genomic DNA. No translation available. BC016052 mRNA. Translation: AAH16052.1. BC026280 mRNA. Translation: AAH26280.1. AK294151 mRNA. Translation: BAG57476.1. Different initiation. |
| IPI | IPI00009319. IPI00218563. IPI00555978. IPI00969137. IPI00969157. |
| RefSeq | NP_057537.1. NM_016453.2. NP_909119.1. NM_184231.1. |
| UniGene | Hs.655006. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1NYF based on UniProtKB P06241. |
| ProteinModelPortal | Q9NZQ3. |
| SMR | Q9NZQ3. Positions 1-56. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NZQ3. 10 interactions. |
| MINT | MINT-1438080. |
| STRING | Q9NZQ3. |
PTM databases | |
| PhosphoSite | Q9NZQ3. |
Polymorphism databases | |
| DMDM | 17433253. |
Proteomic databases | |
| PRIDE | Q9NZQ3. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000294129; ENSP00000294129; ENSG00000213672. ENST00000416649; ENSP00000389059; ENSG00000213672. |
| GeneID | 51517. |
| KEGG | hsa:51517. |
| UCSC | uc003cun.1. human. |
Organism-specific databases | |
| CTD | 51517. |
| GeneCards | GC03M048675. |
| H-InvDB | HIX0200539. |
| HGNC | HGNC:15486. NCKIPSD. |
| HPA | CAB019267. |
| MIM | 606671. gene. |
| neXtProt | NX_Q9NZQ3. |
| PharmGKB | PA134872724. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00390000015725. |
| HOVERGEN | HBG061630. |
| OMA | CQMDRMI. |
| OrthoDB | EOG4GMTWT. |
| PhylomeDB | Q9NZQ3. |
Gene expression databases | |
| ArrayExpress | Q9NZQ3. |
| Bgee | Q9NZQ3. |
| CleanEx | HS_NCKIPSD. |
| Genevestigator | Q9NZQ3. |
| GermOnline | ENSG00000008300. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR018556. DUF2013. IPR001452. SH3_domain. [Graphical view] |
| Pfam | PF09431. DUF2013. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] |
| SMART | SM00326. SH3. 1 hit. [Graphical view] |
| SUPFAM | SSF50044. SH3. 1 hit. |
| PROSITE | PS50002. SH3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 55214. |
| SOURCE | Search... |
Entry information
| Entry name | SPN90_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NZQ3 Secondary accession number(s): B4DFL5 Q9UGM8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with