Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NZQ3 (SPN90_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 124. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
NCK-interacting protein with SH3 domain
Alternative name(s):
54 kDa VacA-interacting protein
54 kDa vimentin-interacting protein
Short name=VIP54
90 kDa SH3 protein interacting with Nck
AF3p21
Dia-interacting protein 1
Short name=DIP-1
Diaphanous protein-interacting protein
SH3 adapter protein SPIN90
WASP-interacting SH3-domain protein
Short name=WISH
Wiskott-Aldrich syndrome protein-interacting protein
Gene names
Name:NCKIPSD
Synonyms:AF3P21, SPIN90
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length722 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo By similarity. In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 By similarity. May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. Plays a role in angiogenesis. Ref.13

Subunit structure

Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain By similarity. Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Interacts with TMIGD2. Ref.2 Ref.6 Ref.11 Ref.13

Subcellular location

Nucleus. Note: Colocalizes with DRF1 at membrane ruffles, and with Nck at Z-disks in mature cardiac myocytes.

Tissue specificity

Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen. Ref.2

Involvement in disease

A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with KMT2A/MLL1.

Sequence similarities

Contains 1 SH3 domain.

Sequence caution

The sequence BAG57476.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

BAIAP2Q604373EBI-745080,EBI-7010040From a different organism.
BAIAP2Q9UQB82EBI-745080,EBI-525456
Pacsin1Q9Z0W56EBI-745080,EBI-1550185From a different organism.
Pacsin2Q9QY172EBI-745080,EBI-491201From a different organism.

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NZQ3-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NZQ3-2)

The sequence of this isoform differs from the canonical sequence as follows:
     656-722: LRMEYLSLMH...EFLVLGEAPS → GPFGAGQRPW...IDSAFGGRSV
Isoform 3 (identifier: Q9NZQ3-3)

The sequence of this isoform differs from the canonical sequence as follows:
     165-171: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9NZQ3-4)

Also known as: WISH-B;

The sequence of this isoform differs from the canonical sequence as follows:
     165-171: Missing.
     656-658: LRM → GVH
     659-722: Missing.
Isoform 5 (identifier: Q9NZQ3-5)

The sequence of this isoform differs from the canonical sequence as follows:
     567-596: AADQNVIMAALSKHANVKIFSEKLLLLLNR → GGVGPGWAVAEHMVALRLSTLSIPMSFLSC
     597-722: Missing.
Note: Found in a brain affected by Alzheimer disease. May be due to intron retention. No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 722722NCK-interacting protein with SH3 domain
PRO_0000072130

Regions

Domain1 – 5858SH3
Motif175 – 19218Nuclear localization signal Potential
Compositional bias171 – 275105Pro-rich
Compositional bias197 – 24044Ser/Thr-rich
Compositional bias442 – 48746Leu-rich
Compositional bias534 – 60168Leu-rich

Sites

Site57 – 582Breakpoint for translocation to form KMT2A/MLL1-AF3P21 oncogene

Natural variations

Alternative sequence165 – 1717Missing in isoform 3 and isoform 4.
VSP_039422
Alternative sequence567 – 59630AADQN…LLLNR → GGVGPGWAVAEHMVALRLST LSIPMSFLSC in isoform 5.
VSP_039423
Alternative sequence597 – 722126Missing in isoform 5.
VSP_039424
Alternative sequence656 – 72267LRMEY…GEAPS → GPFGAGQRPWPGVPRLLEPG STPSREPHPVERSGVPALTS SWASGCPRPLHPALQLVIDS AFGGRSV in isoform 2.
VSP_003971
Alternative sequence656 – 6583LRM → GVH in isoform 4.
VSP_039425
Alternative sequence659 – 72264Missing in isoform 4.
VSP_039426
Natural variant3241T → S.
Corresponds to variant rs6785620 [ dbSNP | Ensembl ].
VAR_051378
Natural variant6601Y → S. Ref.8
Corresponds to variant rs17855516 [ dbSNP | Ensembl ].
VAR_063400

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 7683046B94647332

FASTA72278,960
        10         20         30         40         50         60 
MYRALYAFRS AEPNALAFAA GETFLVLERS SAHWWLAARA RSGETGYVPP AYLRRLQGLE 

        70         80         90        100        110        120 
QDVLQAIDRA IEAVHNTAMR DGGKYSLEQR GVLQKLIHHR KETLSRRGPS ASSVAVMTSS 

       130        140        150        160        170        180 
TSDHHLDAAA ARQPNGVCRA GFERQHSLPS SEHLGADGGL YQIPLPSSQI PPQPRRAAPT 

       190        200        210        220        230        240 
TPPPPVKRRD REALMASGSG GHNTMPSGGN SVSSGSSVSS TSLDTLYTSS SPSEPGSSCS 

       250        260        270        280        290        300 
PTPPPVPRRG THTTVSQVQP PPSKASAPEP PAEEEVATGT TSASDDLEAL GTLSLGTTEE 

       310        320        330        340        350        360 
KAAAEAAVPR TIGAELMELV RRNTGLSHEL CRVAIGIIVG HIQASVPASS PVMEQVLLSL 

       370        380        390        400        410        420 
VEGKDLSMAL PSGQVCHDQQ RLEVIFADLA RRKDDAQQRS WALYEDEGVI RCYLEELLHI 

       430        440        450        460        470        480 
LTDADPEVCK KMCKRNEFES VLALVAYYQM EHRASLRLLL LKCFGAMCSL DAAIISTLVS 

       490        500        510        520        530        540 
SVLPVELARD MQTDTQDHQK LCYSALILAM VFSMGEAVPY AHYEHLGTPF AQFLLNIVED 

       550        560        570        580        590        600 
GLPLDTTEQL PDLCVNLLLA LNLHLPAADQ NVIMAALSKH ANVKIFSEKL LLLLNRGDDP 

       610        620        630        640        650        660 
VRIFKHEPQP PHSVLKFLQD VFGSPATAAI FYHTDMMALI DITVRHIADL SPGDKLRMEY 

       670        680        690        700        710        720 
LSLMHAIVRT TPYLQHRHRL PDLQAILRRI LNEEETSPQC QMDRMIVREM CKEFLVLGEA 


PS 

« Hide

Isoform 2 [UniParc].

Checksum: BFC8DE473D3C2A4B
Show »

FASTA72277,931
Isoform 3 [UniParc].

Checksum: 73B743E6BA30F469
Show »

FASTA71578,237
Isoform 4 (WISH-B) [UniParc].

Checksum: 98E450E7A59047A6
Show »

FASTA65170,540
Isoform 5 [UniParc].

Checksum: 59BFFD741EE788F2
Show »

FASTA59664,196

References

« Hide 'large scale' references
[1]"Novel SH3 protein encoded by the AF3p21 gene is fused to the mixed lineage leukemia protein in a therapy-related leukemia with t(3;11)(p21;q23)."
Sano K., Hayakawa A., Piao J.-H., Kosaka Y., Nakamura H.
Blood 95:1066-1068(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHROMOSOMAL TRANSLOCATION WITH KMT2A/MLL1.
Tissue: Leukemia.
[2]"The VacA toxin of Helicobacter pylori identifies a new intermediate filament-interacting protein."
de Bernard M., Moschioni M., Napolitani G., Rappuoli R., Montecucco C.
EMBO J. 19:48-56(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH VACA, TISSUE SPECIFICITY.
Tissue: Cervix carcinoma.
[3]"Genomic organization, tissue expression and cellular localization of AF3p21, a fusion partner of MLL in therapy-related leukemia."
Hayakawa A., Matsuda Y., Daibata M., Nakamura H., Sano K.
Genes Chromosomes Cancer 30:364-374(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
Tissue: Cervix carcinoma.
[4]"SPIN90 (SH3 protein interacting with Nck, 90 kDa), an adapter protein that is developmentally regulated during cardiac myocyte differentiation."
Lim C.S., Park E.S., Kim D.J., Song Y.H., Eom S.H., Chun J.-S., Kim J.H., Kim J.-K., Park D., Song W.K.
J. Biol. Chem. 276:12871-12878(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Heart.
[5]"mDia-interacting protein acts downstream of rho-mDia and modifies src activation and stress fiber formation."
Satoh S., Tominaga T.
J. Biol. Chem. 276:39290-39294(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1 AND 2).
Tissue: Brain and Placenta.
[6]"Identification of FHOD1-binding proteins and mechanisms of FHOD1-regulated actin dynamics."
Westendorf J.J., Koka S.
J. Cell. Biochem. 92:29-41(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), INTERACTION WITH FHOD1.
Tissue: Bone marrow.
[7]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT SER-660.
Tissue: Placenta and Skin.
[9]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 448-722 (ISOFORM 5).
Tissue: Brain cortex.
[10]"Phosphoproteome of resting human platelets."
Zahedi R.P., Lewandrowski U., Wiesner J., Wortelkamp S., Moebius J., Schuetz C., Walter U., Gambaryan S., Sickmann A.
J. Proteome Res. 7:526-534(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Platelet.
[11]"Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
Voss M., Lettau M., Janssen O.
BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH FASLG.
[12]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[13]"Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis."
Rahimi N., Rezazadeh K., Mahoney J.E., Hartsough E., Meyer R.D.
Mol. Biol. Cell 23:1646-1656(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION IN ANGIOGENESIS, INTERACTION WITH TMIGD2.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF178432 mRNA. Translation: AAF35985.1.
AJ242655 mRNA. Translation: CAB65089.2.
AF303581 mRNA. Translation: AAK09094.1.
AB069981 Genomic DNA. Translation: BAB63204.1.
AB069982 Genomic DNA. Translation: BAB63205.1.
AY453794 mRNA. Translation: AAR83735.1.
AC141002 Genomic DNA. No translation available.
BC016052 mRNA. Translation: AAH16052.1.
BC026280 mRNA. Translation: AAH26280.1.
AK294151 mRNA. Translation: BAG57476.1. Different initiation.
CCDSCCDS2776.1. [Q9NZQ3-1]
CCDS46827.1. [Q9NZQ3-3]
RefSeqNP_057537.1. NM_016453.3. [Q9NZQ3-1]
NP_909119.1. NM_184231.2. [Q9NZQ3-3]
UniGeneHs.655006.

3D structure databases

ProteinModelPortalQ9NZQ3.
SMRQ9NZQ3. Positions 1-53.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119583. 13 interactions.
IntActQ9NZQ3. 18 interactions.
MINTMINT-1438080.
STRING9606.ENSP00000294129.

PTM databases

PhosphoSiteQ9NZQ3.

Polymorphism databases

DMDM17433253.

Proteomic databases

MaxQBQ9NZQ3.
PaxDbQ9NZQ3.
PRIDEQ9NZQ3.

Protocols and materials databases

DNASU51517.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000294129; ENSP00000294129; ENSG00000213672. [Q9NZQ3-1]
ENST00000341520; ENSP00000342621; ENSG00000213672. [Q9NZQ3-2]
ENST00000416649; ENSP00000389059; ENSG00000213672. [Q9NZQ3-3]
GeneID51517.
KEGGhsa:51517.
UCSCuc003cum.3. human. [Q9NZQ3-3]
uc003cun.3. human. [Q9NZQ3-1]

Organism-specific databases

CTD51517.
GeneCardsGC03M048701.
HGNCHGNC:15486. NCKIPSD.
HPACAB019267.
MIM606671. gene.
neXtProtNX_Q9NZQ3.
PharmGKBPA134872724.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG283973.
HOGENOMHOG000008184.
HOVERGENHBG061630.
OMAERSSAHW.
OrthoDBEOG7966G7.
PhylomeDBQ9NZQ3.
TreeFamTF324522.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.
SignaLinkQ9NZQ3.

Gene expression databases

ArrayExpressQ9NZQ3.
BgeeQ9NZQ3.
CleanExHS_NCKIPSD.
GenevestigatorQ9NZQ3.

Family and domain databases

InterProIPR018556. DUF2013.
IPR001452. SH3_domain.
[Graphical view]
PfamPF09431. DUF2013. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMSSF50044. SSF50044. 1 hit.
PROSITEPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSNCKIPSD. human.
GeneWikiNCKIPSD.
GenomeRNAi51517.
NextBio55214.
PROQ9NZQ3.
SOURCESearch...

Entry information

Entry nameSPN90_HUMAN
AccessionPrimary (citable) accession number: Q9NZQ3
Secondary accession number(s): B4DFL5 expand/collapse secondary AC list , Q6GU34, Q6SPF3, Q8TC10, Q9UGM8
Entry history
Integrated into UniProtKB/Swiss-Prot: December 5, 2001
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM