Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NZQ3

- SPN90_HUMAN

UniProt

Q9NZQ3 - SPN90_HUMAN

Protein

NCK-interacting protein with SH3 domain

Gene

NCKIPSD

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 126 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo By similarity. In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 By similarity. May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. Plays a role in angiogenesis.By similarity1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei57 – 582Breakpoint for translocation to form KMT2A/MLL1-AF3P21 oncogene

    GO - Molecular functioni

    1. cytoskeletal protein binding Source: UniProtKB
    2. protein binding Source: IntAct

    GO - Biological processi

    1. cytoskeleton organization Source: UniProtKB
    2. Fc-gamma receptor signaling pathway involved in phagocytosis Source: Reactome
    3. innate immune response Source: Reactome
    4. NLS-bearing protein import into nucleus Source: ProtInc
    5. signal transduction Source: ProtInc

    Enzyme and pathway databases

    ReactomeiREACT_160086. Regulation of actin dynamics for phagocytic cup formation.
    SignaLinkiQ9NZQ3.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    NCK-interacting protein with SH3 domain
    Alternative name(s):
    54 kDa VacA-interacting protein
    54 kDa vimentin-interacting protein
    Short name:
    VIP54
    90 kDa SH3 protein interacting with Nck
    AF3p21
    Dia-interacting protein 1
    Short name:
    DIP-1
    Diaphanous protein-interacting protein
    SH3 adapter protein SPIN90
    WASP-interacting SH3-domain protein
    Short name:
    WISH
    Wiskott-Aldrich syndrome protein-interacting protein
    Gene namesi
    Name:NCKIPSD
    Synonyms:AF3P21, SPIN90
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:15486. NCKIPSD.

    Subcellular locationi

    Nucleus
    Note: Colocalizes with DRF1 at membrane ruffles, and with Nck at Z-disks in mature cardiac myocytes.

    GO - Cellular componenti

    1. cytosol Source: Reactome
    2. intermediate filament Source: UniProtKB
    3. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Involvement in diseasei

    A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with KMT2A/MLL1.

    Keywords - Diseasei

    Proto-oncogene

    Organism-specific databases

    PharmGKBiPA134872724.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 722722NCK-interacting protein with SH3 domainPRO_0000072130Add
    BLAST

    Proteomic databases

    MaxQBiQ9NZQ3.
    PaxDbiQ9NZQ3.
    PRIDEiQ9NZQ3.

    PTM databases

    PhosphoSiteiQ9NZQ3.

    Expressioni

    Tissue specificityi

    Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen.1 Publication

    Gene expression databases

    ArrayExpressiQ9NZQ3.
    BgeeiQ9NZQ3.
    CleanExiHS_NCKIPSD.
    GenevestigatoriQ9NZQ3.

    Organism-specific databases

    HPAiCAB019267.

    Interactioni

    Subunit structurei

    Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain By similarity. Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Interacts with TMIGD2.By similarity4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    BAIAP2Q604373EBI-745080,EBI-7010040From a different organism.
    BAIAP2Q9UQB82EBI-745080,EBI-525456
    Pacsin1Q9Z0W56EBI-745080,EBI-1550185From a different organism.
    Pacsin2Q9QY172EBI-745080,EBI-491201From a different organism.

    Protein-protein interaction databases

    BioGridi119583. 13 interactions.
    IntActiQ9NZQ3. 18 interactions.
    MINTiMINT-1438080.
    STRINGi9606.ENSP00000294129.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NZQ3.
    SMRiQ9NZQ3. Positions 1-53.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini1 – 5858SH3PROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi175 – 19218Nuclear localization signalSequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi171 – 275105Pro-richAdd
    BLAST
    Compositional biasi197 – 24044Ser/Thr-richAdd
    BLAST
    Compositional biasi442 – 48746Leu-richAdd
    BLAST
    Compositional biasi534 – 60168Leu-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 SH3 domain.PROSITE-ProRule annotation

    Keywords - Domaini

    SH3 domain, SH3-binding

    Phylogenomic databases

    eggNOGiNOG283973.
    HOGENOMiHOG000008184.
    HOVERGENiHBG061630.
    OMAiERSSAHW.
    OrthoDBiEOG7966G7.
    PhylomeDBiQ9NZQ3.
    TreeFamiTF324522.

    Family and domain databases

    InterProiIPR018556. DUF2013.
    IPR001452. SH3_domain.
    [Graphical view]
    PfamiPF09431. DUF2013. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view]
    SMARTiSM00326. SH3. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 1 hit.
    PROSITEiPS50002. SH3. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NZQ3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYRALYAFRS AEPNALAFAA GETFLVLERS SAHWWLAARA RSGETGYVPP    50
    AYLRRLQGLE QDVLQAIDRA IEAVHNTAMR DGGKYSLEQR GVLQKLIHHR 100
    KETLSRRGPS ASSVAVMTSS TSDHHLDAAA ARQPNGVCRA GFERQHSLPS 150
    SEHLGADGGL YQIPLPSSQI PPQPRRAAPT TPPPPVKRRD REALMASGSG 200
    GHNTMPSGGN SVSSGSSVSS TSLDTLYTSS SPSEPGSSCS PTPPPVPRRG 250
    THTTVSQVQP PPSKASAPEP PAEEEVATGT TSASDDLEAL GTLSLGTTEE 300
    KAAAEAAVPR TIGAELMELV RRNTGLSHEL CRVAIGIIVG HIQASVPASS 350
    PVMEQVLLSL VEGKDLSMAL PSGQVCHDQQ RLEVIFADLA RRKDDAQQRS 400
    WALYEDEGVI RCYLEELLHI LTDADPEVCK KMCKRNEFES VLALVAYYQM 450
    EHRASLRLLL LKCFGAMCSL DAAIISTLVS SVLPVELARD MQTDTQDHQK 500
    LCYSALILAM VFSMGEAVPY AHYEHLGTPF AQFLLNIVED GLPLDTTEQL 550
    PDLCVNLLLA LNLHLPAADQ NVIMAALSKH ANVKIFSEKL LLLLNRGDDP 600
    VRIFKHEPQP PHSVLKFLQD VFGSPATAAI FYHTDMMALI DITVRHIADL 650
    SPGDKLRMEY LSLMHAIVRT TPYLQHRHRL PDLQAILRRI LNEEETSPQC 700
    QMDRMIVREM CKEFLVLGEA PS 722
    Length:722
    Mass (Da):78,960
    Last modified:October 1, 2000 - v1
    Checksum:i7683046B94647332
    GO
    Isoform 2 (identifier: Q9NZQ3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         656-722: LRMEYLSLMH...EFLVLGEAPS → GPFGAGQRPW...IDSAFGGRSV

    Show »
    Length:722
    Mass (Da):77,931
    Checksum:iBFC8DE473D3C2A4B
    GO
    Isoform 3 (identifier: Q9NZQ3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         165-171: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:715
    Mass (Da):78,237
    Checksum:i73B743E6BA30F469
    GO
    Isoform 4 (identifier: Q9NZQ3-4) [UniParc]FASTAAdd to Basket

    Also known as: WISH-B

    The sequence of this isoform differs from the canonical sequence as follows:
         165-171: Missing.
         656-658: LRM → GVH
         659-722: Missing.

    Show »
    Length:651
    Mass (Da):70,540
    Checksum:i98E450E7A59047A6
    GO
    Isoform 5 (identifier: Q9NZQ3-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         567-596: AADQNVIMAALSKHANVKIFSEKLLLLLNR → GGVGPGWAVAEHMVALRLSTLSIPMSFLSC
         597-722: Missing.

    Note: Found in a brain affected by Alzheimer disease. May be due to intron retention. No experimental confirmation available.

    Show »
    Length:596
    Mass (Da):64,196
    Checksum:i59BFFD741EE788F2
    GO

    Sequence cautioni

    The sequence BAG57476.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti324 – 3241T → S.
    Corresponds to variant rs6785620 [ dbSNP | Ensembl ].
    VAR_051378
    Natural varianti660 – 6601Y → S.1 Publication
    Corresponds to variant rs17855516 [ dbSNP | Ensembl ].
    VAR_063400

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei165 – 1717Missing in isoform 3 and isoform 4. 2 PublicationsVSP_039422
    Alternative sequencei567 – 59630AADQN…LLLNR → GGVGPGWAVAEHMVALRLST LSIPMSFLSC in isoform 5. 1 PublicationVSP_039423Add
    BLAST
    Alternative sequencei597 – 722126Missing in isoform 5. 1 PublicationVSP_039424Add
    BLAST
    Alternative sequencei656 – 72267LRMEY…GEAPS → GPFGAGQRPWPGVPRLLEPG STPSREPHPVERSGVPALTS SWASGCPRPLHPALQLVIDS AFGGRSV in isoform 2. 1 PublicationVSP_003971Add
    BLAST
    Alternative sequencei656 – 6583LRM → GVH in isoform 4. 1 PublicationVSP_039425
    Alternative sequencei659 – 72264Missing in isoform 4. 1 PublicationVSP_039426Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF178432 mRNA. Translation: AAF35985.1.
    AJ242655 mRNA. Translation: CAB65089.2.
    AF303581 mRNA. Translation: AAK09094.1.
    AB069981 Genomic DNA. Translation: BAB63204.1.
    AB069982 Genomic DNA. Translation: BAB63205.1.
    AY453794 mRNA. Translation: AAR83735.1.
    AC141002 Genomic DNA. No translation available.
    BC016052 mRNA. Translation: AAH16052.1.
    BC026280 mRNA. Translation: AAH26280.1.
    AK294151 mRNA. Translation: BAG57476.1. Different initiation.
    CCDSiCCDS2776.1. [Q9NZQ3-1]
    CCDS46827.1. [Q9NZQ3-3]
    RefSeqiNP_057537.1. NM_016453.3. [Q9NZQ3-1]
    NP_909119.1. NM_184231.2. [Q9NZQ3-3]
    UniGeneiHs.655006.

    Genome annotation databases

    EnsembliENST00000294129; ENSP00000294129; ENSG00000213672. [Q9NZQ3-1]
    ENST00000416649; ENSP00000389059; ENSG00000213672. [Q9NZQ3-3]
    GeneIDi51517.
    KEGGihsa:51517.
    UCSCiuc003cum.3. human. [Q9NZQ3-3]
    uc003cun.3. human. [Q9NZQ3-1]

    Polymorphism databases

    DMDMi17433253.

    Keywords - Coding sequence diversityi

    Alternative splicing, Chromosomal rearrangement, Polymorphism

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF178432 mRNA. Translation: AAF35985.1 .
    AJ242655 mRNA. Translation: CAB65089.2 .
    AF303581 mRNA. Translation: AAK09094.1 .
    AB069981 Genomic DNA. Translation: BAB63204.1 .
    AB069982 Genomic DNA. Translation: BAB63205.1 .
    AY453794 mRNA. Translation: AAR83735.1 .
    AC141002 Genomic DNA. No translation available.
    BC016052 mRNA. Translation: AAH16052.1 .
    BC026280 mRNA. Translation: AAH26280.1 .
    AK294151 mRNA. Translation: BAG57476.1 . Different initiation.
    CCDSi CCDS2776.1. [Q9NZQ3-1 ]
    CCDS46827.1. [Q9NZQ3-3 ]
    RefSeqi NP_057537.1. NM_016453.3. [Q9NZQ3-1 ]
    NP_909119.1. NM_184231.2. [Q9NZQ3-3 ]
    UniGenei Hs.655006.

    3D structure databases

    ProteinModelPortali Q9NZQ3.
    SMRi Q9NZQ3. Positions 1-53.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119583. 13 interactions.
    IntActi Q9NZQ3. 18 interactions.
    MINTi MINT-1438080.
    STRINGi 9606.ENSP00000294129.

    PTM databases

    PhosphoSitei Q9NZQ3.

    Polymorphism databases

    DMDMi 17433253.

    Proteomic databases

    MaxQBi Q9NZQ3.
    PaxDbi Q9NZQ3.
    PRIDEi Q9NZQ3.

    Protocols and materials databases

    DNASUi 51517.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000294129 ; ENSP00000294129 ; ENSG00000213672 . [Q9NZQ3-1 ]
    ENST00000416649 ; ENSP00000389059 ; ENSG00000213672 . [Q9NZQ3-3 ]
    GeneIDi 51517.
    KEGGi hsa:51517.
    UCSCi uc003cum.3. human. [Q9NZQ3-3 ]
    uc003cun.3. human. [Q9NZQ3-1 ]

    Organism-specific databases

    CTDi 51517.
    GeneCardsi GC03M048701.
    HGNCi HGNC:15486. NCKIPSD.
    HPAi CAB019267.
    MIMi 606671. gene.
    neXtProti NX_Q9NZQ3.
    PharmGKBi PA134872724.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG283973.
    HOGENOMi HOG000008184.
    HOVERGENi HBG061630.
    OMAi ERSSAHW.
    OrthoDBi EOG7966G7.
    PhylomeDBi Q9NZQ3.
    TreeFami TF324522.

    Enzyme and pathway databases

    Reactomei REACT_160086. Regulation of actin dynamics for phagocytic cup formation.
    SignaLinki Q9NZQ3.

    Miscellaneous databases

    ChiTaRSi NCKIPSD. human.
    GeneWikii NCKIPSD.
    GenomeRNAii 51517.
    NextBioi 55214.
    PROi Q9NZQ3.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NZQ3.
    Bgeei Q9NZQ3.
    CleanExi HS_NCKIPSD.
    Genevestigatori Q9NZQ3.

    Family and domain databases

    InterProi IPR018556. DUF2013.
    IPR001452. SH3_domain.
    [Graphical view ]
    Pfami PF09431. DUF2013. 1 hit.
    PF00018. SH3_1. 1 hit.
    [Graphical view ]
    SMARTi SM00326. SH3. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 1 hit.
    PROSITEi PS50002. SH3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Novel SH3 protein encoded by the AF3p21 gene is fused to the mixed lineage leukemia protein in a therapy-related leukemia with t(3;11)(p21;q23)."
      Sano K., Hayakawa A., Piao J.-H., Kosaka Y., Nakamura H.
      Blood 95:1066-1068(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHROMOSOMAL TRANSLOCATION WITH KMT2A/MLL1.
      Tissue: Leukemia.
    2. "The VacA toxin of Helicobacter pylori identifies a new intermediate filament-interacting protein."
      de Bernard M., Moschioni M., Napolitani G., Rappuoli R., Montecucco C.
      EMBO J. 19:48-56(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH VACA, TISSUE SPECIFICITY.
      Tissue: Cervix carcinoma.
    3. "Genomic organization, tissue expression and cellular localization of AF3p21, a fusion partner of MLL in therapy-related leukemia."
      Hayakawa A., Matsuda Y., Daibata M., Nakamura H., Sano K.
      Genes Chromosomes Cancer 30:364-374(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
      Tissue: Cervix carcinoma.
    4. "SPIN90 (SH3 protein interacting with Nck, 90 kDa), an adapter protein that is developmentally regulated during cardiac myocyte differentiation."
      Lim C.S., Park E.S., Kim D.J., Song Y.H., Eom S.H., Chun J.-S., Kim J.H., Kim J.-K., Park D., Song W.K.
      J. Biol. Chem. 276:12871-12878(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Heart.
    5. "mDia-interacting protein acts downstream of rho-mDia and modifies src activation and stress fiber formation."
      Satoh S., Tominaga T.
      J. Biol. Chem. 276:39290-39294(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1 AND 2).
      Tissue: Brain and Placenta.
    6. "Identification of FHOD1-binding proteins and mechanisms of FHOD1-regulated actin dynamics."
      Westendorf J.J., Koka S.
      J. Cell. Biochem. 92:29-41(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), INTERACTION WITH FHOD1.
      Tissue: Bone marrow.
    7. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT SER-660.
      Tissue: Placenta and Skin.
    9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 448-722 (ISOFORM 5).
      Tissue: Brain cortex.
    10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Platelet.
    11. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
      Voss M., Lettau M., Janssen O.
      BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH FASLG.
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis."
      Rahimi N., Rezazadeh K., Mahoney J.E., Hartsough E., Meyer R.D.
      Mol. Biol. Cell 23:1646-1656(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN ANGIOGENESIS, INTERACTION WITH TMIGD2.

    Entry informationi

    Entry nameiSPN90_HUMAN
    AccessioniPrimary (citable) accession number: Q9NZQ3
    Secondary accession number(s): B4DFL5
    , Q6GU34, Q6SPF3, Q8TC10, Q9UGM8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 5, 2001
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 126 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3