Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

NCK-interacting protein with SH3 domain

Gene

NCKIPSD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo (By similarity). In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 (By similarity). May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. Plays a role in angiogenesis.By similarity1 Publication

GO - Molecular functioni

  • cytoskeletal protein binding Source: UniProtKB

GO - Biological processi

  • cytoskeleton organization Source: UniProtKB
  • Fc-gamma receptor signaling pathway involved in phagocytosis Source: Reactome
  • NLS-bearing protein import into nucleus Source: ProtInc
  • positive regulation of neuron projection development Source: Ensembl
  • signal transduction Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-5663213. RHO GTPases Activate WASPs and WAVEs.
SignaLinkiQ9NZQ3.
SIGNORiQ9NZQ3.

Names & Taxonomyi

Protein namesi
Recommended name:
NCK-interacting protein with SH3 domain
Alternative name(s):
54 kDa VacA-interacting protein
54 kDa vimentin-interacting protein
Short name:
VIP54
90 kDa SH3 protein interacting with Nck
AF3p21
Dia-interacting protein 1
Short name:
DIP-1
Diaphanous protein-interacting protein
SH3 adapter protein SPIN90
WASP-interacting SH3-domain protein
Short name:
WISH
Wiskott-Aldrich syndrome protein-interacting protein
Gene namesi
Name:NCKIPSD
Synonyms:AF3P21, SPIN90
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:15486. NCKIPSD.

Subcellular locationi

  • Nucleus

  • Note: Colocalizes with DRF1 at membrane ruffles, and with Nck at Z-disks in mature cardiac myocytes.

GO - Cellular componenti

  • cytosol Source: Reactome
  • intermediate filament Source: UniProtKB
  • nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with KMT2A/MLL1.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei57 – 58Breakpoint for translocation to form KMT2A/MLL1-AF3P21 oncogene2

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

DisGeNETi51517.
OpenTargetsiENSG00000213672.
PharmGKBiPA134872724.

Polymorphism and mutation databases

BioMutaiNCKIPSD.
DMDMi17433253.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000721301 – 722NCK-interacting protein with SH3 domainAdd BLAST722

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei120PhosphoserineBy similarity1
Modified residuei181PhosphothreonineCombined sources1
Modified residuei294PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NZQ3.
MaxQBiQ9NZQ3.
PaxDbiQ9NZQ3.
PeptideAtlasiQ9NZQ3.
PRIDEiQ9NZQ3.

PTM databases

iPTMnetiQ9NZQ3.
PhosphoSitePlusiQ9NZQ3.

Expressioni

Tissue specificityi

Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen.1 Publication

Gene expression databases

BgeeiENSG00000213672.
CleanExiHS_NCKIPSD.
ExpressionAtlasiQ9NZQ3. baseline and differential.
GenevisibleiQ9NZQ3. HS.

Organism-specific databases

HPAiCAB019267.
HPA050005.

Interactioni

Subunit structurei

Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain (By similarity). Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Interacts with TMIGD2.By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BAIAP2Q604373EBI-745080,EBI-7010040From a different organism.
BAIAP2Q9UQB82EBI-745080,EBI-525456
FYNP062412EBI-745080,EBI-515315
Pacsin1Q9Z0W56EBI-745080,EBI-1550185From a different organism.
Pacsin2Q9QY172EBI-745080,EBI-491201From a different organism.
PSMD9O002333EBI-745080,EBI-750973
SORBS3O605043EBI-745080,EBI-741237

GO - Molecular functioni

  • cytoskeletal protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi119583. 53 interactors.
IntActiQ9NZQ3. 36 interactors.
MINTiMINT-1438080.
STRINGi9606.ENSP00000294129.

Structurei

3D structure databases

ProteinModelPortaliQ9NZQ3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 58SH3PROSITE-ProRule annotationAdd BLAST58

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi175 – 192Nuclear localization signalSequence analysisAdd BLAST18

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi171 – 275Pro-richAdd BLAST105
Compositional biasi197 – 240Ser/Thr-richAdd BLAST44
Compositional biasi442 – 487Leu-richAdd BLAST46
Compositional biasi534 – 601Leu-richAdd BLAST68

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain, SH3-binding

Phylogenomic databases

eggNOGiKOG4035. Eukaryota.
ENOG410Y8WT. LUCA.
GeneTreeiENSGT00390000015725.
HOGENOMiHOG000008184.
HOVERGENiHBG061630.
InParanoidiQ9NZQ3.
OMAiMRDGGKY.
OrthoDBiEOG091G0D4N.
PhylomeDBiQ9NZQ3.
TreeFamiTF324522.

Family and domain databases

InterProiIPR018556. DUF2013.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF09431. DUF2013. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NZQ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYRALYAFRS AEPNALAFAA GETFLVLERS SAHWWLAARA RSGETGYVPP
60 70 80 90 100
AYLRRLQGLE QDVLQAIDRA IEAVHNTAMR DGGKYSLEQR GVLQKLIHHR
110 120 130 140 150
KETLSRRGPS ASSVAVMTSS TSDHHLDAAA ARQPNGVCRA GFERQHSLPS
160 170 180 190 200
SEHLGADGGL YQIPLPSSQI PPQPRRAAPT TPPPPVKRRD REALMASGSG
210 220 230 240 250
GHNTMPSGGN SVSSGSSVSS TSLDTLYTSS SPSEPGSSCS PTPPPVPRRG
260 270 280 290 300
THTTVSQVQP PPSKASAPEP PAEEEVATGT TSASDDLEAL GTLSLGTTEE
310 320 330 340 350
KAAAEAAVPR TIGAELMELV RRNTGLSHEL CRVAIGIIVG HIQASVPASS
360 370 380 390 400
PVMEQVLLSL VEGKDLSMAL PSGQVCHDQQ RLEVIFADLA RRKDDAQQRS
410 420 430 440 450
WALYEDEGVI RCYLEELLHI LTDADPEVCK KMCKRNEFES VLALVAYYQM
460 470 480 490 500
EHRASLRLLL LKCFGAMCSL DAAIISTLVS SVLPVELARD MQTDTQDHQK
510 520 530 540 550
LCYSALILAM VFSMGEAVPY AHYEHLGTPF AQFLLNIVED GLPLDTTEQL
560 570 580 590 600
PDLCVNLLLA LNLHLPAADQ NVIMAALSKH ANVKIFSEKL LLLLNRGDDP
610 620 630 640 650
VRIFKHEPQP PHSVLKFLQD VFGSPATAAI FYHTDMMALI DITVRHIADL
660 670 680 690 700
SPGDKLRMEY LSLMHAIVRT TPYLQHRHRL PDLQAILRRI LNEEETSPQC
710 720
QMDRMIVREM CKEFLVLGEA PS
Length:722
Mass (Da):78,960
Last modified:October 1, 2000 - v1
Checksum:i7683046B94647332
GO
Isoform 2 (identifier: Q9NZQ3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-722: LRMEYLSLMH...EFLVLGEAPS → GPFGAGQRPW...IDSAFGGRSV

Show »
Length:722
Mass (Da):77,931
Checksum:iBFC8DE473D3C2A4B
GO
Isoform 3 (identifier: Q9NZQ3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-171: Missing.

Note: No experimental confirmation available.
Show »
Length:715
Mass (Da):78,237
Checksum:i73B743E6BA30F469
GO
Isoform 4 (identifier: Q9NZQ3-4) [UniParc]FASTAAdd to basket
Also known as: WISH-B

The sequence of this isoform differs from the canonical sequence as follows:
     165-171: Missing.
     656-658: LRM → GVH
     659-722: Missing.

Show »
Length:651
Mass (Da):70,540
Checksum:i98E450E7A59047A6
GO
Isoform 5 (identifier: Q9NZQ3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-596: AADQNVIMAALSKHANVKIFSEKLLLLLNR → GGVGPGWAVAEHMVALRLSTLSIPMSFLSC
     597-722: Missing.

Note: Found in a brain affected by Alzheimer disease. May be due to intron retention. No experimental confirmation available.
Show »
Length:596
Mass (Da):64,196
Checksum:i59BFFD741EE788F2
GO

Sequence cautioni

The sequence BAG57476 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051378324T → S.Corresponds to variant rs6785620dbSNPEnsembl.1
Natural variantiVAR_063400660Y → S.1 PublicationCorresponds to variant rs17855516dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_039422165 – 171Missing in isoform 3 and isoform 4. 2 Publications7
Alternative sequenceiVSP_039423567 – 596AADQN…LLLNR → GGVGPGWAVAEHMVALRLST LSIPMSFLSC in isoform 5. 1 PublicationAdd BLAST30
Alternative sequenceiVSP_039424597 – 722Missing in isoform 5. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_003971656 – 722LRMEY…GEAPS → GPFGAGQRPWPGVPRLLEPG STPSREPHPVERSGVPALTS SWASGCPRPLHPALQLVIDS AFGGRSV in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_039425656 – 658LRM → GVH in isoform 4. 1 Publication3
Alternative sequenceiVSP_039426659 – 722Missing in isoform 4. 1 PublicationAdd BLAST64

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF178432 mRNA. Translation: AAF35985.1.
AJ242655 mRNA. Translation: CAB65089.2.
AF303581 mRNA. Translation: AAK09094.1.
AB069981 Genomic DNA. Translation: BAB63204.1.
AB069982 Genomic DNA. Translation: BAB63205.1.
AY453794 mRNA. Translation: AAR83735.1.
AC141002 Genomic DNA. No translation available.
BC016052 mRNA. Translation: AAH16052.1.
BC026280 mRNA. Translation: AAH26280.1.
AK294151 mRNA. Translation: BAG57476.1. Different initiation.
CCDSiCCDS2776.1. [Q9NZQ3-1]
CCDS46827.1. [Q9NZQ3-3]
RefSeqiNP_057537.1. NM_016453.3. [Q9NZQ3-1]
NP_909119.1. NM_184231.2. [Q9NZQ3-3]
UniGeneiHs.655006.

Genome annotation databases

EnsembliENST00000294129; ENSP00000294129; ENSG00000213672. [Q9NZQ3-1]
ENST00000416649; ENSP00000389059; ENSG00000213672. [Q9NZQ3-3]
GeneIDi51517.
KEGGihsa:51517.
UCSCiuc003cum.5. human. [Q9NZQ3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF178432 mRNA. Translation: AAF35985.1.
AJ242655 mRNA. Translation: CAB65089.2.
AF303581 mRNA. Translation: AAK09094.1.
AB069981 Genomic DNA. Translation: BAB63204.1.
AB069982 Genomic DNA. Translation: BAB63205.1.
AY453794 mRNA. Translation: AAR83735.1.
AC141002 Genomic DNA. No translation available.
BC016052 mRNA. Translation: AAH16052.1.
BC026280 mRNA. Translation: AAH26280.1.
AK294151 mRNA. Translation: BAG57476.1. Different initiation.
CCDSiCCDS2776.1. [Q9NZQ3-1]
CCDS46827.1. [Q9NZQ3-3]
RefSeqiNP_057537.1. NM_016453.3. [Q9NZQ3-1]
NP_909119.1. NM_184231.2. [Q9NZQ3-3]
UniGeneiHs.655006.

3D structure databases

ProteinModelPortaliQ9NZQ3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119583. 53 interactors.
IntActiQ9NZQ3. 36 interactors.
MINTiMINT-1438080.
STRINGi9606.ENSP00000294129.

PTM databases

iPTMnetiQ9NZQ3.
PhosphoSitePlusiQ9NZQ3.

Polymorphism and mutation databases

BioMutaiNCKIPSD.
DMDMi17433253.

Proteomic databases

EPDiQ9NZQ3.
MaxQBiQ9NZQ3.
PaxDbiQ9NZQ3.
PeptideAtlasiQ9NZQ3.
PRIDEiQ9NZQ3.

Protocols and materials databases

DNASUi51517.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294129; ENSP00000294129; ENSG00000213672. [Q9NZQ3-1]
ENST00000416649; ENSP00000389059; ENSG00000213672. [Q9NZQ3-3]
GeneIDi51517.
KEGGihsa:51517.
UCSCiuc003cum.5. human. [Q9NZQ3-1]

Organism-specific databases

CTDi51517.
DisGeNETi51517.
GeneCardsiNCKIPSD.
HGNCiHGNC:15486. NCKIPSD.
HPAiCAB019267.
HPA050005.
MIMi606671. gene.
neXtProtiNX_Q9NZQ3.
OpenTargetsiENSG00000213672.
PharmGKBiPA134872724.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4035. Eukaryota.
ENOG410Y8WT. LUCA.
GeneTreeiENSGT00390000015725.
HOGENOMiHOG000008184.
HOVERGENiHBG061630.
InParanoidiQ9NZQ3.
OMAiMRDGGKY.
OrthoDBiEOG091G0D4N.
PhylomeDBiQ9NZQ3.
TreeFamiTF324522.

Enzyme and pathway databases

ReactomeiR-HSA-2029482. Regulation of actin dynamics for phagocytic cup formation.
R-HSA-5663213. RHO GTPases Activate WASPs and WAVEs.
SignaLinkiQ9NZQ3.
SIGNORiQ9NZQ3.

Miscellaneous databases

ChiTaRSiNCKIPSD. human.
GeneWikiiNCKIPSD.
GenomeRNAii51517.
PROiQ9NZQ3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000213672.
CleanExiHS_NCKIPSD.
ExpressionAtlasiQ9NZQ3. baseline and differential.
GenevisibleiQ9NZQ3. HS.

Family and domain databases

InterProiIPR018556. DUF2013.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF09431. DUF2013. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSPN90_HUMAN
AccessioniPrimary (citable) accession number: Q9NZQ3
Secondary accession number(s): B4DFL5
, Q6GU34, Q6SPF3, Q8TC10, Q9UGM8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 5, 2001
Last sequence update: October 1, 2000
Last modified: November 30, 2016
This is version 149 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.