Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NZQ3

- SPN90_HUMAN

UniProt

Q9NZQ3 - SPN90_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

NCK-interacting protein with SH3 domain

Gene

NCKIPSD

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Has an important role in stress fiber formation induced by active diaphanous protein homolog 1 (DRF1). Induces microspike formation, in vivo (By similarity). In vitro, stimulates N-WASP-induced ARP2/3 complex activation in the absence of CDC42 (By similarity). May play an important role in the maintenance of sarcomeres and/or in the assembly of myofibrils into sarcomeres. Implicated in regulation of actin polymerization and cell adhesion. Plays a role in angiogenesis.By similarity1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei57 – 582Breakpoint for translocation to form KMT2A/MLL1-AF3P21 oncogene

GO - Molecular functioni

  1. cytoskeletal protein binding Source: UniProtKB

GO - Biological processi

  1. cytoskeleton organization Source: UniProtKB
  2. Fc-gamma receptor signaling pathway involved in phagocytosis Source: Reactome
  3. innate immune response Source: Reactome
  4. NLS-bearing protein import into nucleus Source: ProtInc
  5. signal transduction Source: ProtInc
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_160086. Regulation of actin dynamics for phagocytic cup formation.
SignaLinkiQ9NZQ3.

Names & Taxonomyi

Protein namesi
Recommended name:
NCK-interacting protein with SH3 domain
Alternative name(s):
54 kDa VacA-interacting protein
54 kDa vimentin-interacting protein
Short name:
VIP54
90 kDa SH3 protein interacting with Nck
AF3p21
Dia-interacting protein 1
Short name:
DIP-1
Diaphanous protein-interacting protein
SH3 adapter protein SPIN90
WASP-interacting SH3-domain protein
Short name:
WISH
Wiskott-Aldrich syndrome protein-interacting protein
Gene namesi
Name:NCKIPSD
Synonyms:AF3P21, SPIN90
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:15486. NCKIPSD.

Subcellular locationi

Nucleus
Note: Colocalizes with DRF1 at membrane ruffles, and with Nck at Z-disks in mature cardiac myocytes.

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. intermediate filament Source: UniProtKB
  3. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Involvement in diseasei

A chromosomal aberration involving NCKIPSD/AF3p21 is found in therapy-related leukemia. Translocation t(3;11)(p21;q23) with KMT2A/MLL1.

Keywords - Diseasei

Proto-oncogene

Organism-specific databases

PharmGKBiPA134872724.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 722722NCK-interacting protein with SH3 domainPRO_0000072130Add
BLAST

Proteomic databases

MaxQBiQ9NZQ3.
PaxDbiQ9NZQ3.
PRIDEiQ9NZQ3.

PTM databases

PhosphoSiteiQ9NZQ3.

Expressioni

Tissue specificityi

Highest expression in heart, brain, skeletal muscle, kidney and liver. Lower levels in placenta, lung, small intestine and leukocytes. Weak expression in colon, thymus and spleen.1 Publication

Gene expression databases

BgeeiQ9NZQ3.
CleanExiHS_NCKIPSD.
ExpressionAtlasiQ9NZQ3. baseline and differential.
GenevestigatoriQ9NZQ3.

Organism-specific databases

HPAiCAB019267.

Interactioni

Subunit structurei

Associates with the intermediate filaments, vimentin and desmin. Binds the first and third SH3 domains of NCK. Binds the proline-rich domains of N-WASP through its SH3 domain (By similarity). Similarly, binds diaphanous protein homolog 1 (DRF1). Binds the SH3 domains of GRB2 through its proline-rich domains. Interacts with Helicobacter pylori toxin vacA. Isoform 4 interacts with FHOD1. Interacts with FASLG. Interacts with TMIGD2.By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BAIAP2Q604373EBI-745080,EBI-7010040From a different organism.
BAIAP2Q9UQB82EBI-745080,EBI-525456
Pacsin1Q9Z0W56EBI-745080,EBI-1550185From a different organism.
Pacsin2Q9QY172EBI-745080,EBI-491201From a different organism.

Protein-protein interaction databases

BioGridi119583. 13 interactions.
IntActiQ9NZQ3. 18 interactions.
MINTiMINT-1438080.
STRINGi9606.ENSP00000294129.

Structurei

3D structure databases

ProteinModelPortaliQ9NZQ3.
SMRiQ9NZQ3. Positions 1-53.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 5858SH3PROSITE-ProRule annotationAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi175 – 19218Nuclear localization signalSequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi171 – 275105Pro-richAdd
BLAST
Compositional biasi197 – 24044Ser/Thr-richAdd
BLAST
Compositional biasi442 – 48746Leu-richAdd
BLAST
Compositional biasi534 – 60168Leu-richAdd
BLAST

Sequence similaritiesi

Contains 1 SH3 domain.PROSITE-ProRule annotation

Keywords - Domaini

SH3 domain, SH3-binding

Phylogenomic databases

eggNOGiNOG283973.
GeneTreeiENSGT00390000015725.
HOGENOMiHOG000008184.
HOVERGENiHBG061630.
InParanoidiQ9NZQ3.
OMAiERSSAHW.
OrthoDBiEOG7966G7.
PhylomeDBiQ9NZQ3.
TreeFamiTF324522.

Family and domain databases

InterProiIPR018556. DUF2013.
IPR001452. SH3_domain.
[Graphical view]
PfamiPF09431. DUF2013. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view]
SMARTiSM00326. SH3. 1 hit.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 1 hit.
PROSITEiPS50002. SH3. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NZQ3-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYRALYAFRS AEPNALAFAA GETFLVLERS SAHWWLAARA RSGETGYVPP
60 70 80 90 100
AYLRRLQGLE QDVLQAIDRA IEAVHNTAMR DGGKYSLEQR GVLQKLIHHR
110 120 130 140 150
KETLSRRGPS ASSVAVMTSS TSDHHLDAAA ARQPNGVCRA GFERQHSLPS
160 170 180 190 200
SEHLGADGGL YQIPLPSSQI PPQPRRAAPT TPPPPVKRRD REALMASGSG
210 220 230 240 250
GHNTMPSGGN SVSSGSSVSS TSLDTLYTSS SPSEPGSSCS PTPPPVPRRG
260 270 280 290 300
THTTVSQVQP PPSKASAPEP PAEEEVATGT TSASDDLEAL GTLSLGTTEE
310 320 330 340 350
KAAAEAAVPR TIGAELMELV RRNTGLSHEL CRVAIGIIVG HIQASVPASS
360 370 380 390 400
PVMEQVLLSL VEGKDLSMAL PSGQVCHDQQ RLEVIFADLA RRKDDAQQRS
410 420 430 440 450
WALYEDEGVI RCYLEELLHI LTDADPEVCK KMCKRNEFES VLALVAYYQM
460 470 480 490 500
EHRASLRLLL LKCFGAMCSL DAAIISTLVS SVLPVELARD MQTDTQDHQK
510 520 530 540 550
LCYSALILAM VFSMGEAVPY AHYEHLGTPF AQFLLNIVED GLPLDTTEQL
560 570 580 590 600
PDLCVNLLLA LNLHLPAADQ NVIMAALSKH ANVKIFSEKL LLLLNRGDDP
610 620 630 640 650
VRIFKHEPQP PHSVLKFLQD VFGSPATAAI FYHTDMMALI DITVRHIADL
660 670 680 690 700
SPGDKLRMEY LSLMHAIVRT TPYLQHRHRL PDLQAILRRI LNEEETSPQC
710 720
QMDRMIVREM CKEFLVLGEA PS
Length:722
Mass (Da):78,960
Last modified:October 1, 2000 - v1
Checksum:i7683046B94647332
GO
Isoform 2 (identifier: Q9NZQ3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     656-722: LRMEYLSLMH...EFLVLGEAPS → GPFGAGQRPW...IDSAFGGRSV

Show »
Length:722
Mass (Da):77,931
Checksum:iBFC8DE473D3C2A4B
GO
Isoform 3 (identifier: Q9NZQ3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     165-171: Missing.

Note: No experimental confirmation available.

Show »
Length:715
Mass (Da):78,237
Checksum:i73B743E6BA30F469
GO
Isoform 4 (identifier: Q9NZQ3-4) [UniParc]FASTAAdd to Basket

Also known as: WISH-B

The sequence of this isoform differs from the canonical sequence as follows:
     165-171: Missing.
     656-658: LRM → GVH
     659-722: Missing.

Show »
Length:651
Mass (Da):70,540
Checksum:i98E450E7A59047A6
GO
Isoform 5 (identifier: Q9NZQ3-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     567-596: AADQNVIMAALSKHANVKIFSEKLLLLLNR → GGVGPGWAVAEHMVALRLSTLSIPMSFLSC
     597-722: Missing.

Note: Found in a brain affected by Alzheimer disease. May be due to intron retention. No experimental confirmation available.

Show »
Length:596
Mass (Da):64,196
Checksum:i59BFFD741EE788F2
GO

Sequence cautioni

The sequence BAG57476.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti324 – 3241T → S.
Corresponds to variant rs6785620 [ dbSNP | Ensembl ].
VAR_051378
Natural varianti660 – 6601Y → S.1 Publication
Corresponds to variant rs17855516 [ dbSNP | Ensembl ].
VAR_063400

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei165 – 1717Missing in isoform 3 and isoform 4. 2 PublicationsVSP_039422
Alternative sequencei567 – 59630AADQN…LLLNR → GGVGPGWAVAEHMVALRLST LSIPMSFLSC in isoform 5. 1 PublicationVSP_039423Add
BLAST
Alternative sequencei597 – 722126Missing in isoform 5. 1 PublicationVSP_039424Add
BLAST
Alternative sequencei656 – 72267LRMEY…GEAPS → GPFGAGQRPWPGVPRLLEPG STPSREPHPVERSGVPALTS SWASGCPRPLHPALQLVIDS AFGGRSV in isoform 2. 1 PublicationVSP_003971Add
BLAST
Alternative sequencei656 – 6583LRM → GVH in isoform 4. 1 PublicationVSP_039425
Alternative sequencei659 – 72264Missing in isoform 4. 1 PublicationVSP_039426Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF178432 mRNA. Translation: AAF35985.1.
AJ242655 mRNA. Translation: CAB65089.2.
AF303581 mRNA. Translation: AAK09094.1.
AB069981 Genomic DNA. Translation: BAB63204.1.
AB069982 Genomic DNA. Translation: BAB63205.1.
AY453794 mRNA. Translation: AAR83735.1.
AC141002 Genomic DNA. No translation available.
BC016052 mRNA. Translation: AAH16052.1.
BC026280 mRNA. Translation: AAH26280.1.
AK294151 mRNA. Translation: BAG57476.1. Different initiation.
CCDSiCCDS2776.1. [Q9NZQ3-1]
CCDS46827.1. [Q9NZQ3-3]
RefSeqiNP_057537.1. NM_016453.3. [Q9NZQ3-1]
NP_909119.1. NM_184231.2. [Q9NZQ3-3]
UniGeneiHs.655006.

Genome annotation databases

EnsembliENST00000294129; ENSP00000294129; ENSG00000213672. [Q9NZQ3-1]
ENST00000416649; ENSP00000389059; ENSG00000213672. [Q9NZQ3-3]
GeneIDi51517.
KEGGihsa:51517.
UCSCiuc003cum.3. human. [Q9NZQ3-3]
uc003cun.3. human. [Q9NZQ3-1]

Polymorphism databases

DMDMi17433253.

Keywords - Coding sequence diversityi

Alternative splicing, Chromosomal rearrangement, Polymorphism

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF178432 mRNA. Translation: AAF35985.1 .
AJ242655 mRNA. Translation: CAB65089.2 .
AF303581 mRNA. Translation: AAK09094.1 .
AB069981 Genomic DNA. Translation: BAB63204.1 .
AB069982 Genomic DNA. Translation: BAB63205.1 .
AY453794 mRNA. Translation: AAR83735.1 .
AC141002 Genomic DNA. No translation available.
BC016052 mRNA. Translation: AAH16052.1 .
BC026280 mRNA. Translation: AAH26280.1 .
AK294151 mRNA. Translation: BAG57476.1 . Different initiation.
CCDSi CCDS2776.1. [Q9NZQ3-1 ]
CCDS46827.1. [Q9NZQ3-3 ]
RefSeqi NP_057537.1. NM_016453.3. [Q9NZQ3-1 ]
NP_909119.1. NM_184231.2. [Q9NZQ3-3 ]
UniGenei Hs.655006.

3D structure databases

ProteinModelPortali Q9NZQ3.
SMRi Q9NZQ3. Positions 1-53.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119583. 13 interactions.
IntActi Q9NZQ3. 18 interactions.
MINTi MINT-1438080.
STRINGi 9606.ENSP00000294129.

PTM databases

PhosphoSitei Q9NZQ3.

Polymorphism databases

DMDMi 17433253.

Proteomic databases

MaxQBi Q9NZQ3.
PaxDbi Q9NZQ3.
PRIDEi Q9NZQ3.

Protocols and materials databases

DNASUi 51517.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000294129 ; ENSP00000294129 ; ENSG00000213672 . [Q9NZQ3-1 ]
ENST00000416649 ; ENSP00000389059 ; ENSG00000213672 . [Q9NZQ3-3 ]
GeneIDi 51517.
KEGGi hsa:51517.
UCSCi uc003cum.3. human. [Q9NZQ3-3 ]
uc003cun.3. human. [Q9NZQ3-1 ]

Organism-specific databases

CTDi 51517.
GeneCardsi GC03M048701.
HGNCi HGNC:15486. NCKIPSD.
HPAi CAB019267.
MIMi 606671. gene.
neXtProti NX_Q9NZQ3.
PharmGKBi PA134872724.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG283973.
GeneTreei ENSGT00390000015725.
HOGENOMi HOG000008184.
HOVERGENi HBG061630.
InParanoidi Q9NZQ3.
OMAi ERSSAHW.
OrthoDBi EOG7966G7.
PhylomeDBi Q9NZQ3.
TreeFami TF324522.

Enzyme and pathway databases

Reactomei REACT_160086. Regulation of actin dynamics for phagocytic cup formation.
SignaLinki Q9NZQ3.

Miscellaneous databases

ChiTaRSi NCKIPSD. human.
GeneWikii NCKIPSD.
GenomeRNAii 51517.
NextBioi 55214.
PROi Q9NZQ3.
SOURCEi Search...

Gene expression databases

Bgeei Q9NZQ3.
CleanExi HS_NCKIPSD.
ExpressionAtlasi Q9NZQ3. baseline and differential.
Genevestigatori Q9NZQ3.

Family and domain databases

InterProi IPR018556. DUF2013.
IPR001452. SH3_domain.
[Graphical view ]
Pfami PF09431. DUF2013. 1 hit.
PF00018. SH3_1. 1 hit.
[Graphical view ]
SMARTi SM00326. SH3. 1 hit.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 1 hit.
PROSITEi PS50002. SH3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Novel SH3 protein encoded by the AF3p21 gene is fused to the mixed lineage leukemia protein in a therapy-related leukemia with t(3;11)(p21;q23)."
    Sano K., Hayakawa A., Piao J.-H., Kosaka Y., Nakamura H.
    Blood 95:1066-1068(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHROMOSOMAL TRANSLOCATION WITH KMT2A/MLL1.
    Tissue: Leukemia.
  2. "The VacA toxin of Helicobacter pylori identifies a new intermediate filament-interacting protein."
    de Bernard M., Moschioni M., Napolitani G., Rappuoli R., Montecucco C.
    EMBO J. 19:48-56(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH VACA, TISSUE SPECIFICITY.
    Tissue: Cervix carcinoma.
  3. "Genomic organization, tissue expression and cellular localization of AF3p21, a fusion partner of MLL in therapy-related leukemia."
    Hayakawa A., Matsuda Y., Daibata M., Nakamura H., Sano K.
    Genes Chromosomes Cancer 30:364-374(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    Tissue: Cervix carcinoma.
  4. "SPIN90 (SH3 protein interacting with Nck, 90 kDa), an adapter protein that is developmentally regulated during cardiac myocyte differentiation."
    Lim C.S., Park E.S., Kim D.J., Song Y.H., Eom S.H., Chun J.-S., Kim J.H., Kim J.-K., Park D., Song W.K.
    J. Biol. Chem. 276:12871-12878(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Heart.
  5. "mDia-interacting protein acts downstream of rho-mDia and modifies src activation and stress fiber formation."
    Satoh S., Tominaga T.
    J. Biol. Chem. 276:39290-39294(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORMS 1 AND 2).
    Tissue: Brain and Placenta.
  6. "Identification of FHOD1-binding proteins and mechanisms of FHOD1-regulated actin dynamics."
    Westendorf J.J., Koka S.
    J. Cell. Biochem. 92:29-41(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), INTERACTION WITH FHOD1.
    Tissue: Bone marrow.
  7. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT SER-660.
    Tissue: Placenta and Skin.
  9. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 448-722 (ISOFORM 5).
    Tissue: Brain cortex.
  10. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.
  11. "Identification of SH3 domain interaction partners of human FasL (CD178) by phage display screening."
    Voss M., Lettau M., Janssen O.
    BMC Immunol. 10:53-53(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH FASLG.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "Identification of IGPR-1 as a novel adhesion molecule involved in angiogenesis."
    Rahimi N., Rezazadeh K., Mahoney J.E., Hartsough E., Meyer R.D.
    Mol. Biol. Cell 23:1646-1656(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN ANGIOGENESIS, INTERACTION WITH TMIGD2.

Entry informationi

Entry nameiSPN90_HUMAN
AccessioniPrimary (citable) accession number: Q9NZQ3
Secondary accession number(s): B4DFL5
, Q6GU34, Q6SPF3, Q8TC10, Q9UGM8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 5, 2001
Last sequence update: October 1, 2000
Last modified: October 29, 2014
This is version 127 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3