Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NZM6

- PK2L2_HUMAN

UniProt

Q9NZM6 - PK2L2_HUMAN

Protein

Polycystic kidney disease 2-like 2 protein

Gene

PKD2L2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 2 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    May function as a subunit of a cation channel and play a role in fertilization.

    GO - Molecular functioni

    1. calcium channel activity Source: RefGenome
    2. calcium ion binding Source: InterPro

    GO - Biological processi

    1. calcium ion transmembrane transport Source: GOC
    2. detection of mechanical stimulus Source: RefGenome

    Keywords - Molecular functioni

    Ion channel

    Keywords - Biological processi

    Ion transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Polycystic kidney disease 2-like 2 protein
    Alternative name(s):
    Polycystin-2L2
    Polycystin-L2
    Gene namesi
    Name:PKD2L2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:9012. PKD2L2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA33345.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 624624Polycystic kidney disease 2-like 2 proteinPRO_0000164361Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi115 – 1151N-linked (GlcNAc...)Sequence Analysis
    Glycosylationi138 – 1381N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    PaxDbiQ9NZM6.
    PRIDEiQ9NZM6.

    PTM databases

    PhosphoSiteiQ9NZM6.

    Expressioni

    Tissue specificityi

    According to PubMed:10602361, expressed only in testis. According to PubMed:10756092, expressed also in brain and kidney. Isoform 2 is found only in transformed lymphoblasts. Isoform 3 is found in all tissues tested.

    Gene expression databases

    ArrayExpressiQ9NZM6.
    BgeeiQ9NZM6.
    CleanExiHS_PKD2L2.
    GenevestigatoriQ9NZM6.

    Organism-specific databases

    HPAiHPA041903.
    HPA043634.

    Interactioni

    Protein-protein interaction databases

    BioGridi117970. 1 interaction.
    STRINGi9606.ENSP00000290431.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NZM6.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 3131CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini53 – 276224ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini298 – 31417CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini336 – 36025ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini382 – 40625CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini428 – 46942ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini491 – 624134CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei32 – 5221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei277 – 29721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei315 – 33521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei361 – 38121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei407 – 42721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei470 – 49021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili556 – 57621Sequence AnalysisAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi126 – 13813Polycystin motifAdd
    BLAST

    Sequence similaritiesi

    Belongs to the polycystin family.Curated

    Keywords - Domaini

    Coiled coil, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG325704.
    HOGENOMiHOG000230858.
    HOVERGENiHBG014945.
    InParanoidiQ9NZM6.
    KOiK04991.
    OMAiTSWQFYS.
    OrthoDBiEOG7N8ZTW.
    PhylomeDBiQ9NZM6.
    TreeFamiTF316484.

    Family and domain databases

    InterProiIPR013122. PKD1_2_channel.
    IPR003915. PKD_2.
    [Graphical view]
    PfamiPF08016. PKD_channel. 1 hit.
    [Graphical view]
    PRINTSiPR01433. POLYCYSTIN2.

    Sequences (7)i

    Sequence statusi: Complete.

    This entry describes 7 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform 1 (identifier: Q9NZM6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEASRWHRG GASKHKLHYR KEVEITTTLQ ELLLYFIFLI NLCILTFGMV    50
    NPHMYYLNKV MSSLFLDTSV PGEERTNFKS IRSITDFWKF MEGPLLEGLY 100
    WDSWYNNQQL YNLKNSSRIY YENILLGVPR VRQLKVRNNT CKVYSSFQSL 150
    MSECYGKYTS ANEDLSNFGL QINTEWRYST SNTNSPWHWG FLGVYRNGGY 200
    IFTLSKSKSE TKNKFIDLRL NSWITRGTRV IFIDFSLYNA NVNLFCIIRL 250
    VAEFPATGGI LTSWQFYSVK LLRYVSYYDY FIASCEITFC IFLFVFTTQE 300
    VKKIKEFKSA YFKSIWNWLE LLLLLLCFVA VSFNTYYNVQ IFLLLGQLLK 350
    STEKYSDFYF LACWHIYYNN IIAITIFFAW IKIFKFISFN KTMSQLSSTL 400
    SRCVKDIVGF AIMFFIIFFA YAQLGFLVFG SQVDDFSTFQ NSIFAQFRIV 450
    LGDFNFAGIQ QANPILGPIY FITFIFFVFF VLLNMFLAII NDTYSEVKAD 500
    YSIGRRLDFE LGKMIKQSYK NVLEKFRLKK AQKDEDKKTK GSGDLAEQAR 550
    REGFDENEIQ NAEQMKKWKE RLEKKYYSME IQDDYQPVTQ EEFRELFLYA 600
    VELEKELHYI NLKLNQVVRK VSAL 624
    Length:624
    Mass (Da):73,790
    Last modified:January 11, 2011 - v2
    Checksum:i7D9FFA04542A47A4
    GO
    Isoform 2 (identifier: Q9NZM6-2) [UniParc]FASTAAdd to Basket

    Also known as: PKD2L2b

    The sequence of this isoform differs from the canonical sequence as follows:
         11-44: Missing.
         45-45: L → V

    Show »
    Length:590
    Mass (Da):69,746
    Checksum:iBDDE4D9C3C3D7C5F
    GO
    Isoform 3 (identifier: Q9NZM6-3) [UniParc]FASTAAdd to Basket

    Also known as: PKD2L2a

    The sequence of this isoform differs from the canonical sequence as follows:
         45-57: LTFGMVNPHMYYL → CYVISIFGHFCAW
         58-624: Missing.

    Show »
    Length:57
    Mass (Da):6,759
    Checksum:i4539353342C77CAA
    GO
    Isoform 4 (identifier: Q9NZM6-4) [UniParc]FASTAAdd to Basket

    Also known as: PKD2L2c

    The sequence of this isoform differs from the canonical sequence as follows:
         12-23: ASKHKLHYRKEV → YVISIFGHFCAW
         24-624: Missing.

    Show »
    Length:23
    Mass (Da):2,682
    Checksum:i0C7B55E80C496CC0
    GO
    Isoform 5 (identifier: Q9NZM6-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         595-624: ELFLYAVELEKELHYINLKLNQVVRKVSAL → DGTTTKYKMRFSECLTKRI

    Note: No experimental confirmation available.

    Show »
    Length:613
    Mass (Da):72,496
    Checksum:i198CD4B1F9EC9804
    GO
    Isoform 6 (identifier: Q9NZM6-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         383-483: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:523
    Mass (Da):62,216
    Checksum:i9D1CAFED503A7EF6
    GO
    Isoform 7 (identifier: Q9NZM6-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         326-347: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:602
    Mass (Da):71,255
    Checksum:iC409FD9113F83EB1
    GO

    Sequence cautioni

    The sequence AAD46478.1 differs from that shown. Reason: Frameshift at position 595.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti205 – 2062Missing in BAG63344. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti404 – 4041V → I.1 Publication
    Corresponds to variant rs1880458 [ dbSNP | Ensembl ].
    VAR_047542
    Natural varianti507 – 5071L → P.4 Publications
    Corresponds to variant rs12187140 [ dbSNP | Ensembl ].
    VAR_047543

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei11 – 4434Missing in isoform 2. 1 PublicationVSP_004732Add
    BLAST
    Alternative sequencei12 – 2312ASKHK…YRKEV → YVISIFGHFCAW in isoform 4. 1 PublicationVSP_004733Add
    BLAST
    Alternative sequencei24 – 624601Missing in isoform 4. 1 PublicationVSP_004734Add
    BLAST
    Alternative sequencei45 – 5713LTFGM…HMYYL → CYVISIFGHFCAW in isoform 3. 1 PublicationVSP_004736Add
    BLAST
    Alternative sequencei45 – 451L → V in isoform 2. 1 PublicationVSP_004735
    Alternative sequencei58 – 624567Missing in isoform 3. 1 PublicationVSP_004737Add
    BLAST
    Alternative sequencei326 – 34722Missing in isoform 7. 1 PublicationVSP_045581Add
    BLAST
    Alternative sequencei383 – 483101Missing in isoform 6. 1 PublicationVSP_045582Add
    BLAST
    Alternative sequencei595 – 62430ELFLY…KVSAL → DGTTTKYKMRFSECLTKRI in isoform 5. 1 PublicationVSP_035775Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF118125 mRNA. Translation: AAD46478.1. Frameshift.
    AF182034 mRNA. Translation: AAF65622.1.
    AC106753 Genomic DNA. No translation available.
    AK301924 mRNA. Translation: BAG63344.1.
    AC106791 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW62174.1.
    BC044581 mRNA. Translation: AAH44581.1.
    CCDSiCCDS43367.1. [Q9NZM6-5]
    CCDS58971.1. [Q9NZM6-6]
    CCDS58972.1. [Q9NZM6-7]
    RefSeqiNP_001245377.1. NM_001258448.1. [Q9NZM6-7]
    NP_001245378.1. NM_001258449.1. [Q9NZM6-6]
    NP_055201.2. NM_014386.3. [Q9NZM6-5]
    XP_005272017.1. XM_005271960.2. [Q9NZM6-1]
    UniGeneiHs.716884.

    Genome annotation databases

    EnsembliENST00000290431; ENSP00000290431; ENSG00000078795. [Q9NZM6-5]
    ENST00000414094; ENSP00000388060; ENSG00000078795. [Q9NZM6-3]
    ENST00000502810; ENSP00000425513; ENSG00000078795. [Q9NZM6-7]
    ENST00000508638; ENSP00000423382; ENSG00000078795. [Q9NZM6-6]
    ENST00000508883; ENSP00000424725; ENSG00000078795. [Q9NZM6-1]
    GeneIDi27039.
    KEGGihsa:27039.
    UCSCiuc003lbw.1. human. [Q9NZM6-5]
    uc003lby.3. human. [Q9NZM6-1]

    Polymorphism databases

    DMDMi317373272.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF118125 mRNA. Translation: AAD46478.1 . Frameshift.
    AF182034 mRNA. Translation: AAF65622.1 .
    AC106753 Genomic DNA. No translation available.
    AK301924 mRNA. Translation: BAG63344.1 .
    AC106791 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW62174.1 .
    BC044581 mRNA. Translation: AAH44581.1 .
    CCDSi CCDS43367.1. [Q9NZM6-5 ]
    CCDS58971.1. [Q9NZM6-6 ]
    CCDS58972.1. [Q9NZM6-7 ]
    RefSeqi NP_001245377.1. NM_001258448.1. [Q9NZM6-7 ]
    NP_001245378.1. NM_001258449.1. [Q9NZM6-6 ]
    NP_055201.2. NM_014386.3. [Q9NZM6-5 ]
    XP_005272017.1. XM_005271960.2. [Q9NZM6-1 ]
    UniGenei Hs.716884.

    3D structure databases

    ProteinModelPortali Q9NZM6.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 117970. 1 interaction.
    STRINGi 9606.ENSP00000290431.

    PTM databases

    PhosphoSitei Q9NZM6.

    Polymorphism databases

    DMDMi 317373272.

    Proteomic databases

    PaxDbi Q9NZM6.
    PRIDEi Q9NZM6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000290431 ; ENSP00000290431 ; ENSG00000078795 . [Q9NZM6-5 ]
    ENST00000414094 ; ENSP00000388060 ; ENSG00000078795 . [Q9NZM6-3 ]
    ENST00000502810 ; ENSP00000425513 ; ENSG00000078795 . [Q9NZM6-7 ]
    ENST00000508638 ; ENSP00000423382 ; ENSG00000078795 . [Q9NZM6-6 ]
    ENST00000508883 ; ENSP00000424725 ; ENSG00000078795 . [Q9NZM6-1 ]
    GeneIDi 27039.
    KEGGi hsa:27039.
    UCSCi uc003lbw.1. human. [Q9NZM6-5 ]
    uc003lby.3. human. [Q9NZM6-1 ]

    Organism-specific databases

    CTDi 27039.
    GeneCardsi GC05P137225.
    H-InvDB HIX0024797.
    HGNCi HGNC:9012. PKD2L2.
    HPAi HPA041903.
    HPA043634.
    MIMi 604669. gene.
    neXtProti NX_Q9NZM6.
    PharmGKBi PA33345.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG325704.
    HOGENOMi HOG000230858.
    HOVERGENi HBG014945.
    InParanoidi Q9NZM6.
    KOi K04991.
    OMAi TSWQFYS.
    OrthoDBi EOG7N8ZTW.
    PhylomeDBi Q9NZM6.
    TreeFami TF316484.

    Miscellaneous databases

    GeneWikii TRPP3.
    GenomeRNAii 27039.
    NextBioi 49604.
    PROi Q9NZM6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NZM6.
    Bgeei Q9NZM6.
    CleanExi HS_PKD2L2.
    Genevestigatori Q9NZM6.

    Family and domain databases

    InterProi IPR013122. PKD1_2_channel.
    IPR003915. PKD_2.
    [Graphical view ]
    Pfami PF08016. PKD_channel. 1 hit.
    [Graphical view ]
    PRINTSi PR01433. POLYCYSTIN2.
    ProtoNeti Search...

    Publicationsi

    1. "Genes homologous to the autosomal dominant polycystic kidney disease genes (PKD1 and PKD2)."
      Veldhuisen B., Spruit L., Dauwerse H.G., Breuning M.H., Peters D.J.M.
      Eur. J. Hum. Genet. 7:860-872(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), VARIANT PRO-507.
      Tissue: Testis.
    2. "Identification and characterization of a novel polycystin family member, polycystin-L2, in mouse and human: sequence, expression, alternative splicing, and chromosomal localization."
      Guo L., Schreiber T.H., Weremowicz S., Morton C.C., Lee C., Zhou J.
      Genomics 64:241-251(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), VARIANT PRO-507.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7), VARIANTS ILE-404 AND PRO-507.
      Tissue: Testis.
    4. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6), VARIANT PRO-507.
      Tissue: Testis.
    7. Cited for: REVIEW.

    Entry informationi

    Entry nameiPK2L2_HUMAN
    AccessioniPrimary (citable) accession number: Q9NZM6
    Secondary accession number(s): A6NK98
    , B4DXD2, E9PC91, E9PDG4, Q86YB4, Q9UNJ0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 10, 2002
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 112 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3