Q9NZL6 (RGL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 110.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ral guanine nucleotide dissociation stimulator-like 1 Short name=RalGDS-like 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 768 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Probable guanine nucleotide exchange factor. |
| Subunit structure | Interacts with Ras By similarity. |
| Tissue specificity | Expressed in a wide variety of tissues with strong expression being seen in the heart, brain, kidney, spleen and testis. |
| Sequence similarities | Contains 1 N-terminal Ras-GEF domain. Contains 1 Ras-associating domain. Contains 1 Ras-GEF domain. |
| Sequence caution | The sequence BAA76803.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Guanine-nucleotide releasing factor |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | cellular lipid metabolic process Traceable author statement. Source: Reactome regulation of small GTPase mediated signal transductionInferred from electronic annotation. Source: InterPro small GTPase mediated signal transductionNon-traceable author statement Ref.1. Source: UniProtKB small molecule metabolic processTraceable author statement. Source: Reactome |
| Cellular_component | cytosol Traceable author statement. Source: Reactome |
| Molecular_function | Ral guanyl-nucleotide exchange factor activity Non-traceable author statement Ref.1. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q9NZL6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q9NZL6-2) The sequence of this isoform differs from the canonical sequence as follows: 1-9: MKLLWQAKM → MEVKPVGEPTQEVSKFKLSTKVESTGHWLVEDHVRIWEVLKTEE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 768 | 768 | Ral guanine nucleotide dissociation stimulator-like 1 | PRO_0000068885 | |||||
Regions | |||||||||
| Domain | 65 – 196 | 132 | N-terminal Ras-GEF | ||||||
| Domain | 232 – 501 | 270 | Ras-GEF | ||||||
| Domain | 648 – 735 | 88 | Ras-associating | ||||||
| Compositional bias | 541 – 613 | 73 | Ser-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 520 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 9 | 9 | MKLLWQAKM → MEVKPVGEPTQEVSKFKLST KVESTGHWLVEDHVRIWEVL KTEE in isoform B. | VSP_001824 | |||||
| Natural variant | 174 | 1 | Y → S in a breast cancer sample; somatic mutation. Ref.7 | VAR_035823 | |||||
| Natural variant | 699 | 1 | V → M in a breast cancer sample; somatic mutation. Ref.7 | VAR_035824 | |||||
Experimental info | |||||||||
| Sequence conflict | 15 | 1 | W → G Ref.6 | ||||||
| Sequence conflict | 687 | 1 | N → Y Ref.6 | ||||||
| Sequence conflict | 761 | 1 | N → Y in AAF67281. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF186779 mRNA. Translation: AAF67280.1. AF186780 mRNA. Translation: AAF67281.1. AF186798 AF186797 Genomic DNA. Translation: AAG14400.1.AF186798 AF186797 Genomic DNA. Translation: AAG14401.1.AB023176 mRNA. Translation: BAA76803.1. Different initiation. AL590422, AL592299 Genomic DNA. Translation: CAH73873.1. AL590422, AL592299 Genomic DNA. Translation: CAH73874.1. AL592299, AL590422 Genomic DNA. Translation: CAI14720.1. AL592299, AL590422 Genomic DNA. Translation: CAI14724.1. CH471067 Genomic DNA. Translation: EAW91166.1. CH471067 Genomic DNA. Translation: EAW91167.1. BC136591 mRNA. Translation: AAI36592.1. AL080117 mRNA. Translation: CAB45716.1. |
| IPI | IPI00299679. IPI00396431. |
| PIR | T12453. |
| RefSeq | NP_055964.3. NM_015149.3. |
| UniGene | Hs.497148. |
3D structure databases | |
| ProteinModelPortal | Q9NZL6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NZL6. 2 interactions. |
| STRING | 9606.ENSP00000303192. |
PTM databases | |
| PhosphoSite | Q9NZL6. |
Polymorphism databases | |
| DMDM | 14548230. |
Proteomic databases | |
| PaxDb | Q9NZL6. |
| PRIDE | Q9NZL6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000304685; ENSP00000303192; ENSG00000143344. ENST00000360851; ENSP00000354097; ENSG00000143344. ENST00000367531; ENSP00000356501; ENSG00000143344. |
| GeneID | 23179. |
| KEGG | hsa:23179. |
| UCSC | uc001gqo.3. human. |
Organism-specific databases | |
| CTD | 23179. |
| GeneCards | GC01P183605. |
| H-InvDB | HIX0001411. |
| HGNC | HGNC:30281. RGL1. |
| HPA | HPA019788. |
| MIM | 605667. gene. |
| neXtProt | NX_Q9NZL6. |
| PharmGKB | PA134934636. |
| HUGE | Search... |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG308735. |
| HOVERGEN | HBG005864. |
| OMA | WSNRHSK. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
Gene expression databases | |
| ArrayExpress | Q9NZL6. |
| Bgee | Q9NZL6. |
| CleanEx | HS_RGL1. |
| Genevestigator | Q9NZL6. |
| GermOnline | ENSG00000143344. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.840.10. 2 hits. |
| InterPro | IPR000159. Ras-assoc. IPR000651. Ras-like_Gua-exchang_fac_N. IPR019804. Ras_G-nucl-exch_fac_CS. IPR008937. Ras_GEF. IPR023578. Ras_GEF_dom. IPR001895. RasGRF_CDC25. [Graphical view] |
| PANTHER | PTHR23113. PTHR23113. 1 hit. |
| Pfam | PF00788. RA. 1 hit. PF00617. RasGEF. 1 hit. PF00618. RasGEF_N. 1 hit. [Graphical view] |
| SMART | SM00314. RA. 1 hit. SM00147. RasGEF. 1 hit. SM00229. RasGEFN. 1 hit. [Graphical view] |
| SUPFAM | SSF48366. Ras_GEF. 1 hit. |
| PROSITE | PS50200. RA. 1 hit. PS00720. RASGEF. 1 hit. PS50009. RASGEF_CAT. 1 hit. PS50212. RASGEF_NTER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | RGL1. human. |
| GenomeRNAi | 23179. |
| NextBio | 44629. |
| SOURCE | Search... |
Entry information
| Entry name | RGL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NZL6 Secondary accession number(s): Q5SXQ2 Q9Y2G6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
