Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Hsp70-binding protein 1

Gene

HSPBP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Inhibits HSPA1A chaperone activity by changing the conformation of the ATP-binding domain of HSPA1A and interfering with ATP binding. Interferes with ubiquitination mediated by STUB1 and inhibits chaperone-assisted degradation of immature CFTR.4 Publications

GO - Molecular functioni

  • enzyme inhibitor activity Source: ProtInc

GO - Biological processi

  • positive regulation of proteasomal ubiquitin-dependent protein catabolic process Source: BHF-UCL
  • positive regulation of protein ubiquitination Source: BHF-UCL
  • protein folding Source: ProtInc

Names & Taxonomyi

Protein namesi
Recommended name:
Hsp70-binding protein 1
Short name:
HspBP1
Alternative name(s):
Heat shock protein-binding protein 1
Hsp70-binding protein 2
Short name:
HspBP2
Hsp70-interacting protein 1
Hsp70-interacting protein 2
Gene namesi
Name:HSPBP1
Synonyms:HSPBP
ORF Names:PP1845
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:24989. HSPBP1.

Pathology & Biotechi

Organism-specific databases

DisGeNETi23640.
PharmGKBiPA164720725.

Polymorphism and mutation databases

BioMutaiHSPBP1.
DMDMi74734730.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000840351 – 362Hsp70-binding protein 1Add BLAST362

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei354PhosphoserineCombined sources1
Modified residuei359PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NZL4.
MaxQBiQ9NZL4.
PaxDbiQ9NZL4.
PeptideAtlasiQ9NZL4.
PRIDEiQ9NZL4.

PTM databases

iPTMnetiQ9NZL4.
PhosphoSitePlusiQ9NZL4.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000133265.
ExpressionAtlasiQ9NZL4. baseline and differential.
GenevisibleiQ9NZL4. HS.

Organism-specific databases

HPAiCAB005865.
HPA071444.

Interactioni

Subunit structurei

Interacts with the ATP-binding domain of HSPA1A. Detected in a ternary complex containing STUB1, HSPA1A and HSPBP1.4 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi117168. 89 interactors.
IntActiQ9NZL4. 23 interactors.
MINTiMINT-1158196.
STRINGi9606.ENSP00000255631.

Structurei

Secondary structure

1362
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi90 – 104Combined sources15
Helixi113 – 134Combined sources22
Helixi137 – 145Combined sources9
Helixi148 – 154Combined sources7
Turni155 – 158Combined sources4
Helixi162 – 176Combined sources15
Helixi180 – 188Combined sources9
Helixi191 – 201Combined sources11
Helixi205 – 219Combined sources15
Helixi223 – 231Combined sources9
Helixi234 – 243Combined sources10
Helixi247 – 263Combined sources17
Helixi265 – 267Combined sources3
Helixi268 – 273Combined sources6
Helixi276 – 284Combined sources9
Helixi291 – 303Combined sources13
Helixi307 – 314Combined sources8
Helixi316 – 318Combined sources3
Helixi320 – 331Combined sources12
Helixi335 – 337Combined sources3
Helixi338 – 351Combined sources14

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1XQRX-ray2.10A/B87-362[»]
1XQSX-ray2.90A/B87-362[»]
ProteinModelPortaliQ9NZL4.
SMRiQ9NZL4.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NZL4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati135 – 177ARM 1Add BLAST43
Repeati180 – 220ARM 2Add BLAST41
Repeati223 – 262ARM 3Add BLAST40
Repeati265 – 304ARM 4Add BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi21 – 40Gly-richAdd BLAST20

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG2160. Eukaryota.
ENOG410Y90B. LUCA.
HOGENOMiHOG000007740.
HOVERGENiHBG053282.
InParanoidiQ9NZL4.
KOiK09562.
OrthoDBiEOG091G0HDF.
PhylomeDBiQ9NZL4.
TreeFamiTF324307.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiView protein in InterPro
IPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR013918. Nucleotide_exch_fac_Fes1.
PfamiView protein in Pfam
PF08609. Fes1. 1 hit.
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NZL4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSDEGSRGSR LPLALPPASQ GCSSGGGGGG GGGSSAGGSG NSRPPRNLQG
60 70 80 90 100
LLQMAITAGS EEPDPPPEPM SEERRQWLQE AMSAAFRGQR EEVEQMKSCL
110 120 130 140 150
RVLSQPMPPT AGEAEQAADQ QEREGALELL ADLCENMDNA ADFCQLSGMH
160 170 180 190 200
LLVGRYLEAG AAGLRWRAAQ LIGTCSQNVA AIQEQVLGLG ALRKLLRLLD
210 220 230 240 250
RDACDTVRVK ALFAISCLVR EQEAGLLQFL RLDGFSVLMR AMQQQVQKLK
260 270 280 290 300
VKSAFLLQNL LVGHPEHKGT LCSMGMVQQL VALVRTEHSP FHEHVLGALC
310 320 330 340 350
SLVTDFPQGV RECREPELGL EELLRHRCQL LQQHEEYQEE LEFCEKLLQT
360
CFSSPADDSM DR
Length:362
Mass (Da):39,474
Last modified:October 1, 2000 - v1
Checksum:i2B6AAB4161D5A326
GO
Isoform 2 (identifier: Q9NZL4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     207-309: Missing.

Note: No experimental confirmation available.
Show »
Length:259
Mass (Da):28,024
Checksum:i50A959E12693AF09
GO
Isoform 3 (identifier: Q9NZL4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGRRAPLKRRLLSRPSRIDPSGRQSCFSGDHLLPLTHSSLLHKRPM
     25-27: Missing.

Note: No experimental confirmation available.
Show »
Length:405
Mass (Da):44,474
Checksum:iE8F3AB9347464ABE
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti276M → V in BAG57622 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02364525 – 27Missing 4 Publications3
Isoform 3 (identifier: Q9NZL4-3)
Natural varianti71G → V. Corresponds to variant dbSNP:rs140649061Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0536811M → MGGRRAPLKRRLLSRPSRID PSGRQSCFSGDHLLPLTHSS LLHKRPM in isoform 3. 1 Publication1
Alternative sequenceiVSP_05368225 – 27Missing in isoform 3. 1 Publication3
Alternative sequenceiVSP_015945207 – 309Missing in isoform 2. 1 PublicationAdd BLAST103

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF093420 mRNA. Translation: AAC79703.1.
AF187859 mRNA. Translation: AAF35833.1.
AB020592 mRNA. Translation: BAB18742.1.
AF217996 mRNA. Translation: AAG17238.1.
AK130636 mRNA. Translation: BAC85399.1.
AK294358 mRNA. Translation: BAG57622.1.
CR457118 mRNA. Translation: CAG33399.1.
AK075293 mRNA. Translation: BAG52102.1.
BC001236 mRNA. Translation: AAH01236.1.
BC002373 mRNA. Translation: AAH02373.1.
RefSeqiNP_001123578.1. NM_001130106.1.
NP_001284529.1. NM_001297600.1.
NP_036399.3. NM_012267.4.
XP_016882033.1. XM_017026544.1.
UniGeneiHs.53066.

Genome annotation databases

EnsembliENST00000255631; ENSP00000255631; ENSG00000133265.
ENST00000433386; ENSP00000398244; ENSG00000133265.
ENST00000587922; ENSP00000467574; ENSG00000133265.
GeneIDi23640.
KEGGihsa:23640.
UCSCiuc002qkc.4. human. [Q9NZL4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiHPBP1_HUMAN
AccessioniPrimary (citable) accession number: Q9NZL4
Secondary accession number(s): B3KQP0
, B4DG11, O95351, Q6ZNU5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 25, 2005
Last sequence update: October 1, 2000
Last modified: August 30, 2017
This is version 131 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references