Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kv channel-interacting protein 1

Gene

KCNIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Regulates channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Increases the presence of KCND2 at the cell surface.4 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi146 – 1571PROSITE-ProRule annotation2 PublicationsAdd BLAST12
Calcium bindingi194 – 2052PROSITE-ProRule annotation2 PublicationsAdd BLAST12

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • potassium channel activity Source: UniProtKB-KW
  • potassium channel regulator activity Source: UniProtKB
  • voltage-gated ion channel activity Source: UniProtKB-KW

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Calcium, Metal-binding, Potassium

Enzyme and pathway databases

BioCyciZFISH:G66-33457-MONOMER.
ReactomeiR-HSA-5576894. Phase 1 - inactivation of fast Na+ channels.

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 1
Short name:
KChIP11 Publication
Alternative name(s):
A-type potassium channel modulatory protein 1
Potassium channel-interacting protein 1
Vesicle APC-binding protein
Gene namesi
Name:KCNIP1
Synonyms:KCHIP1, VABP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:15521. KCNIP1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • dendrite Source: UniProtKB-SubCell
  • extrinsic component of cytoplasmic side of plasma membrane Source: UniProtKB
  • plasma membrane Source: Reactome
  • voltage-gated potassium channel complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi30820.
OpenTargetsiENSG00000182132.
PharmGKBiPA30041.

Polymorphism and mutation databases

DMDMi73621122.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000738181 – 227Kv channel-interacting protein 1Add BLAST227

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki61Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO1)By similarity

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

PaxDbiQ9NZI2.
PRIDEiQ9NZI2.

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.

Gene expression databases

BgeeiENSG00000182132.
CleanExiHS_KCNIP1.
ExpressionAtlasiQ9NZI2. baseline and differential.
GenevisibleiQ9NZI2. HS.

Organism-specific databases

HPAiHPA022864.

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels. Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (By similarity). Part of a heterooctamer composed of the tetrameric channel and four KCNIP1 chains. Interacts with KCND3 and the N-terminal domain of KCND2. Probably part of a complex consisting of KCNIP1, KCNIP2 isoform 3 and KCND2. Self-associates to form homodimers and homotetramers. Interacts with KCNIP2 isoform 3 in a calcium-dependent manner. Interacts with Naja atra venom CTX3.By similarity6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KCND2Q9NZV84EBI-2120635,EBI-1646745
KCND3Q9UK173EBI-2120635,EBI-9825212
KCNIP2Q9NS61-34EBI-2120635,EBI-1053010

Protein-protein interaction databases

BioGridi119044. 5 interactors.
DIPiDIP-29246N.
IntActiQ9NZI2. 3 interactors.
STRINGi9606.ENSP00000395323.

Structurei

Secondary structure

1227
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi50 – 56Combined sources7
Beta strandi57 – 59Combined sources3
Helixi61 – 74Combined sources14
Turni76 – 78Combined sources3
Helixi82 – 90Combined sources9
Beta strandi93 – 96Combined sources4
Helixi99 – 109Combined sources11
Beta strandi112 – 116Combined sources5
Helixi119 – 131Combined sources13
Helixi134 – 145Combined sources12
Beta strandi151 – 153Combined sources3
Helixi155 – 169Combined sources15
Helixi175 – 177Combined sources3
Beta strandi179 – 181Combined sources3
Helixi182 – 193Combined sources12
Beta strandi198 – 201Combined sources4
Helixi203 – 211Combined sources9
Helixi214 – 225Combined sources12

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1S1EX-ray2.30A1-227[»]
2I2RX-ray3.35E/F/G/H/M/N/O/P48-227[»]
2NZ0X-ray3.20A/C49-227[»]
ProteinModelPortaliQ9NZI2.
SMRiQ9NZI2.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NZI2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini38 – 94EF-hand 1; degeneratePROSITE-ProRule annotationAdd BLAST57
Domaini97 – 132EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini133 – 168EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini181 – 216EF-hand 4PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni214 – 227Interaction with KCND2By similarityAdd BLAST14

Sequence similaritiesi

Belongs to the recoverin family.Curated
Contains 4 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0044. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00760000118820.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ9NZI2.
OMAiTDAPKQH.
OrthoDBiEOG091G11T4.
PhylomeDBiQ9NZI2.
TreeFamiTF318560.

Family and domain databases

CDDicd00051. EFh. 2 hits.
Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NZI2-1) [UniParc]FASTAAdd to basket
Also known as: KCHIP1b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAVMGTFSS LQTKQRRPSK DIAWWYYQYQ RDKIEDELEM TMVCHRPEGL
60 70 80 90 100
EQLEAQTNFT KRELQVLYRG FKNECPSGVV NEDTFKQIYA QFFPHGDAST
110 120 130 140 150
YAHYLFNAFD TTQTGSVKFE DFVTALSILL RGTVHEKLRW TFNLYDINKD
160 170 180 190 200
GYINKEEMMD IVKAIYDMMG KYTYPVLKED TPRQHVDVFF QKMDKNKDGI
210 220
VTLDEFLESC QEDDNIMRSL QLFQNVM
Length:227
Mass (Da):26,817
Last modified:August 16, 2005 - v2
Checksum:iD39DD5F8EA13B0FD
GO
Isoform 2 (identifier: Q9NZI2-2) [UniParc]FASTAAdd to basket
Also known as: KCHIP1a

The sequence of this isoform differs from the canonical sequence as follows:
     21-31: Missing.
     93-130: Missing.

Show »
Length:178
Mass (Da):21,036
Checksum:i8D1E9F2FEB2D5502
GO
Isoform 3 (identifier: Q9NZI2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.

Show »
Length:188
Mass (Da):22,079
Checksum:i5712C89FF2FA0176
GO
Isoform 4 (identifier: Q9NZI2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQR → MSGCSKRCKLGFVKFAQTIFKLITGTLSK

Show »
Length:225
Mass (Da):26,227
Checksum:i15705CD8C4385B7B
GO
Isoform 5 (identifier: Q9NZI2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-31: Missing.
     96-96: G → GALPCLEGSPCVEFLPPSPALLFCLV

Show »
Length:241
Mass (Da):27,842
Checksum:i856A1EC2DEE17668
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti116S → P in BAH13550 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0150431 – 39Missing in isoform 3. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_0415111 – 31MGAVM…YQYQR → MSGCSKRCKLGFVKFAQTIF KLITGTLSK in isoform 4. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_01504421 – 31Missing in isoform 2 and isoform 5. 4 PublicationsAdd BLAST11
Alternative sequenceiVSP_04768693 – 130Missing in isoform 2. 4 PublicationsAdd BLAST38
Alternative sequenceiVSP_04768796G → GALPCLEGSPCVEFLPPSPA LLFCLV in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF199597 mRNA. Translation: AAF33682.1.
AY170821 mRNA. Translation: AAN77491.1.
DQ148476 mRNA. Translation: AAZ77793.1.
DQ148477 mRNA. Translation: AAZ77794.1.
DQ148478 mRNA. Translation: AAZ77795.1.
DQ148479 mRNA. Translation: AAZ77796.1.
AY780424 mRNA. Translation: AAV51968.1.
AK301775 mRNA. Translation: BAH13550.1.
AC008619 Genomic DNA. No translation available.
AC008719 Genomic DNA. No translation available.
AC027306 Genomic DNA. No translation available.
AC027312 Genomic DNA. No translation available.
AC034199 Genomic DNA. No translation available.
AC113432 Genomic DNA. No translation available.
AC134820 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61470.1.
BC050375 mRNA. Translation: AAH50375.1.
CCDSiCCDS34285.1. [Q9NZI2-4]
CCDS34286.1. [Q9NZI2-1]
CCDS64312.1. [Q9NZI2-5]
CCDS64313.1. [Q9NZI2-3]
RefSeqiNP_001030009.1. NM_001034837.2. [Q9NZI2-1]
NP_001030010.1. NM_001034838.2. [Q9NZI2-4]
NP_001265268.1. NM_001278339.1. [Q9NZI2-5]
NP_001265269.1. NM_001278340.1. [Q9NZI2-3]
NP_055407.1. NM_014592.3.
XP_016864896.1. XM_017009407.1. [Q9NZI2-4]
UniGeneiHs.484111.

Genome annotation databases

EnsembliENST00000377360; ENSP00000366577; ENSG00000182132. [Q9NZI2-4]
ENST00000411494; ENSP00000395323; ENSG00000182132. [Q9NZI2-1]
ENST00000434108; ENSP00000414886; ENSG00000182132. [Q9NZI2-5]
ENST00000520740; ENSP00000431102; ENSG00000182132. [Q9NZI2-3]
GeneIDi30820.
KEGGihsa:30820.
UCSCiuc003map.5. human. [Q9NZI2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF199597 mRNA. Translation: AAF33682.1.
AY170821 mRNA. Translation: AAN77491.1.
DQ148476 mRNA. Translation: AAZ77793.1.
DQ148477 mRNA. Translation: AAZ77794.1.
DQ148478 mRNA. Translation: AAZ77795.1.
DQ148479 mRNA. Translation: AAZ77796.1.
AY780424 mRNA. Translation: AAV51968.1.
AK301775 mRNA. Translation: BAH13550.1.
AC008619 Genomic DNA. No translation available.
AC008719 Genomic DNA. No translation available.
AC027306 Genomic DNA. No translation available.
AC027312 Genomic DNA. No translation available.
AC034199 Genomic DNA. No translation available.
AC113432 Genomic DNA. No translation available.
AC134820 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61470.1.
BC050375 mRNA. Translation: AAH50375.1.
CCDSiCCDS34285.1. [Q9NZI2-4]
CCDS34286.1. [Q9NZI2-1]
CCDS64312.1. [Q9NZI2-5]
CCDS64313.1. [Q9NZI2-3]
RefSeqiNP_001030009.1. NM_001034837.2. [Q9NZI2-1]
NP_001030010.1. NM_001034838.2. [Q9NZI2-4]
NP_001265268.1. NM_001278339.1. [Q9NZI2-5]
NP_001265269.1. NM_001278340.1. [Q9NZI2-3]
NP_055407.1. NM_014592.3.
XP_016864896.1. XM_017009407.1. [Q9NZI2-4]
UniGeneiHs.484111.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1S1EX-ray2.30A1-227[»]
2I2RX-ray3.35E/F/G/H/M/N/O/P48-227[»]
2NZ0X-ray3.20A/C49-227[»]
ProteinModelPortaliQ9NZI2.
SMRiQ9NZI2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119044. 5 interactors.
DIPiDIP-29246N.
IntActiQ9NZI2. 3 interactors.
STRINGi9606.ENSP00000395323.

Polymorphism and mutation databases

DMDMi73621122.

Proteomic databases

PaxDbiQ9NZI2.
PRIDEiQ9NZI2.

Protocols and materials databases

DNASUi30820.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000377360; ENSP00000366577; ENSG00000182132. [Q9NZI2-4]
ENST00000411494; ENSP00000395323; ENSG00000182132. [Q9NZI2-1]
ENST00000434108; ENSP00000414886; ENSG00000182132. [Q9NZI2-5]
ENST00000520740; ENSP00000431102; ENSG00000182132. [Q9NZI2-3]
GeneIDi30820.
KEGGihsa:30820.
UCSCiuc003map.5. human. [Q9NZI2-1]

Organism-specific databases

CTDi30820.
DisGeNETi30820.
GeneCardsiKCNIP1.
HGNCiHGNC:15521. KCNIP1.
HPAiHPA022864.
MIMi604660. gene.
neXtProtiNX_Q9NZI2.
OpenTargetsiENSG00000182132.
PharmGKBiPA30041.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0044. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00760000118820.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ9NZI2.
OMAiTDAPKQH.
OrthoDBiEOG091G11T4.
PhylomeDBiQ9NZI2.
TreeFamiTF318560.

Enzyme and pathway databases

BioCyciZFISH:G66-33457-MONOMER.
ReactomeiR-HSA-5576894. Phase 1 - inactivation of fast Na+ channels.

Miscellaneous databases

ChiTaRSiKCNIP1. human.
EvolutionaryTraceiQ9NZI2.
GeneWikiiKCNIP1.
GenomeRNAii30820.
PROiQ9NZI2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000182132.
CleanExiHS_KCNIP1.
ExpressionAtlasiQ9NZI2. baseline and differential.
GenevisibleiQ9NZI2. HS.

Family and domain databases

CDDicd00051. EFh. 2 hits.
Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
PF13833. EF-hand_8. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiKCIP1_HUMAN
AccessioniPrimary (citable) accession number: Q9NZI2
Secondary accession number(s): B7Z7B4
, Q3YAD0, Q3YAD1, Q3YAD2, Q3YAD3, Q5U822
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: November 30, 2016
This is version 141 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.