Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NZI2

- KCIP1_HUMAN

UniProt

Q9NZI2 - KCIP1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Kv channel-interacting protein 1

Gene

KCNIP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Seems to be involved in KCND2 trafficking to the cell surface.3 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi146 – 157121Add
BLAST
Calcium bindingi194 – 205122Add
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: Ensembl
  2. potassium channel activity Source: UniProtKB-KW
  3. potassium channel regulator activity Source: Ensembl
  4. voltage-gated ion channel activity Source: UniProtKB-KW

GO - Biological processi

  1. detection of calcium ion Source: ProtInc
  2. positive regulation of action potential Source: Ensembl
  3. signal transduction Source: ProtInc
  4. synaptic transmission Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Ion channel, Potassium channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Potassium transport, Transport

Keywords - Ligandi

Calcium, Metal-binding, Potassium

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 1
Short name:
KChIP1
Alternative name(s):
A-type potassium channel modulatory protein 1
Potassium channel-interacting protein 1
Vesicle APC-binding protein
Gene namesi
Name:KCNIP1
Synonyms:KCHIP1, VABP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:15521. KCNIP1.

Subcellular locationi

Cell membrane By similarity; Peripheral membrane protein By similarity

GO - Cellular componenti

  1. dendrite Source: Ensembl
  2. neuronal cell body Source: Ensembl
  3. plasma membrane Source: UniProtKB-KW
  4. potassium channel complex Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA30041.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 227227Kv channel-interacting protein 1PRO_0000073818Add
BLAST

Proteomic databases

MaxQBiQ9NZI2.
PaxDbiQ9NZI2.
PRIDEiQ9NZI2.

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.

Gene expression databases

BgeeiQ9NZI2.
CleanExiHS_KCNIP1.
ExpressionAtlasiQ9NZI2. baseline and differential.
GenevestigatoriQ9NZI2.

Organism-specific databases

HPAiHPA022864.

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels. Interacts with KCND3 and the N-terminal domain of KCND2. Probably part of a complex consisting of KCNIP1, KCNIP2 isoform 3 and KCND2. Self-associates to form homodimers and homotetramers. Interacts with KCNIP2 isoform 3 in a calcium-dependent manner. Interacts with Naja atra venom CTX3.6 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
KCND2Q9NZV84EBI-2120635,EBI-1646745
KCNIP2Q9NS61-34EBI-2120635,EBI-1053010

Protein-protein interaction databases

BioGridi119044. 4 interactions.
DIPiDIP-29246N.
IntActiQ9NZI2. 2 interactions.
STRINGi9606.ENSP00000395323.

Structurei

Secondary structure

1
227
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi50 – 567
Beta strandi57 – 593
Helixi61 – 7414
Turni76 – 783
Helixi82 – 909
Beta strandi93 – 964
Helixi99 – 10911
Beta strandi112 – 1165
Helixi119 – 13113
Helixi134 – 14512
Beta strandi151 – 1533
Helixi155 – 16915
Helixi175 – 1773
Beta strandi179 – 1813
Helixi182 – 19312
Beta strandi198 – 2014
Helixi203 – 2119
Helixi214 – 22512

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1S1EX-ray2.30A1-227[»]
2I2RX-ray3.35E/F/G/H/M/N/O/P48-227[»]
2NZ0X-ray3.20A/C49-227[»]
ProteinModelPortaliQ9NZI2.
SMRiQ9NZI2. Positions 49-227.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NZI2.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini38 – 9457EF-hand 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Domaini97 – 13236EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini133 – 16836EF-hand 3PROSITE-ProRule annotationAdd
BLAST
Domaini181 – 21636EF-hand 4PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni214 – 22714Interaction with KCND2By similarityAdd
BLAST

Sequence similaritiesi

Belongs to the recoverin family.Curated
Contains 4 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiCOG5126.
GeneTreeiENSGT00760000118820.
HOGENOMiHOG000233019.
HOVERGENiHBG108179.
InParanoidiQ9NZI2.
OMAiKQHVDAF.
OrthoDBiEOG7GJ6F3.
PhylomeDBiQ9NZI2.
TreeFamiTF318560.

Family and domain databases

Gene3Di1.10.238.10. 3 hits.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view]
PANTHERiPTHR23055. PTHR23055. 1 hit.
PfamiPF13499. EF-hand_7. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NZI2-1) [UniParc]FASTAAdd to Basket

Also known as: KCHIP1b

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGAVMGTFSS LQTKQRRPSK DIAWWYYQYQ RDKIEDELEM TMVCHRPEGL
60 70 80 90 100
EQLEAQTNFT KRELQVLYRG FKNECPSGVV NEDTFKQIYA QFFPHGDAST
110 120 130 140 150
YAHYLFNAFD TTQTGSVKFE DFVTALSILL RGTVHEKLRW TFNLYDINKD
160 170 180 190 200
GYINKEEMMD IVKAIYDMMG KYTYPVLKED TPRQHVDVFF QKMDKNKDGI
210 220
VTLDEFLESC QEDDNIMRSL QLFQNVM
Length:227
Mass (Da):26,817
Last modified:August 16, 2005 - v2
Checksum:iD39DD5F8EA13B0FD
GO
Isoform 2 (identifier: Q9NZI2-2) [UniParc]FASTAAdd to Basket

Also known as: KCHIP1a

The sequence of this isoform differs from the canonical sequence as follows:
     21-31: Missing.
     93-130: Missing.

Show »
Length:178
Mass (Da):21,036
Checksum:i8D1E9F2FEB2D5502
GO
Isoform 3 (identifier: Q9NZI2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-39: Missing.

Show »
Length:188
Mass (Da):22,079
Checksum:i5712C89FF2FA0176
GO
Isoform 4 (identifier: Q9NZI2-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQR → MSGCSKRCKLGFVKFAQTIFKLITGTLSK

Show »
Length:225
Mass (Da):26,227
Checksum:i15705CD8C4385B7B
GO
Isoform 5 (identifier: Q9NZI2-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-31: Missing.
     96-96: G → GALPCLEGSPCVEFLPPSPALLFCLV

Show »
Length:241
Mass (Da):27,842
Checksum:i856A1EC2DEE17668
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti116 – 1161S → P in BAH13550. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3939Missing in isoform 3. 1 PublicationVSP_015043Add
BLAST
Alternative sequencei1 – 3131MGAVM…YQYQR → MSGCSKRCKLGFVKFAQTIF KLITGTLSK in isoform 4. 2 PublicationsVSP_041511Add
BLAST
Alternative sequencei21 – 3111Missing in isoform 2 and isoform 5. 4 PublicationsVSP_015044Add
BLAST
Alternative sequencei93 – 13038Missing in isoform 2. 4 PublicationsVSP_047686Add
BLAST
Alternative sequencei96 – 961G → GALPCLEGSPCVEFLPPSPA LLFCLV in isoform 5. 1 PublicationVSP_047687

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF199597 mRNA. Translation: AAF33682.1.
AY170821 mRNA. Translation: AAN77491.1.
DQ148476 mRNA. Translation: AAZ77793.1.
DQ148477 mRNA. Translation: AAZ77794.1.
DQ148478 mRNA. Translation: AAZ77795.1.
DQ148479 mRNA. Translation: AAZ77796.1.
AY780424 mRNA. Translation: AAV51968.1.
AK301775 mRNA. Translation: BAH13550.1.
AC008619 Genomic DNA. No translation available.
AC008719 Genomic DNA. No translation available.
AC027306 Genomic DNA. No translation available.
AC027312 Genomic DNA. No translation available.
AC034199 Genomic DNA. No translation available.
AC113432 Genomic DNA. No translation available.
AC134820 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61470.1.
BC050375 mRNA. Translation: AAH50375.1.
CCDSiCCDS34285.1. [Q9NZI2-4]
CCDS34286.1. [Q9NZI2-1]
CCDS64312.1. [Q9NZI2-5]
CCDS64313.1. [Q9NZI2-3]
RefSeqiNP_001030009.1. NM_001034837.2. [Q9NZI2-1]
NP_001030010.1. NM_001034838.2. [Q9NZI2-4]
NP_001265268.1. NM_001278339.1. [Q9NZI2-5]
NP_001265269.1. NM_001278340.1. [Q9NZI2-3]
NP_055407.1. NM_014592.3.
UniGeneiHs.484111.

Genome annotation databases

EnsembliENST00000328939; ENSP00000329686; ENSG00000182132.
ENST00000377360; ENSP00000366577; ENSG00000182132. [Q9NZI2-4]
ENST00000411494; ENSP00000395323; ENSG00000182132. [Q9NZI2-1]
ENST00000434108; ENSP00000414886; ENSG00000182132. [Q9NZI2-5]
ENST00000520740; ENSP00000431102; ENSG00000182132. [Q9NZI2-3]
GeneIDi30820.
KEGGihsa:30820.
UCSCiuc003mas.3. human. [Q9NZI2-1]
uc003mat.3. human. [Q9NZI2-2]

Polymorphism databases

DMDMi73621122.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF199597 mRNA. Translation: AAF33682.1 .
AY170821 mRNA. Translation: AAN77491.1 .
DQ148476 mRNA. Translation: AAZ77793.1 .
DQ148477 mRNA. Translation: AAZ77794.1 .
DQ148478 mRNA. Translation: AAZ77795.1 .
DQ148479 mRNA. Translation: AAZ77796.1 .
AY780424 mRNA. Translation: AAV51968.1 .
AK301775 mRNA. Translation: BAH13550.1 .
AC008619 Genomic DNA. No translation available.
AC008719 Genomic DNA. No translation available.
AC027306 Genomic DNA. No translation available.
AC027312 Genomic DNA. No translation available.
AC034199 Genomic DNA. No translation available.
AC113432 Genomic DNA. No translation available.
AC134820 Genomic DNA. No translation available.
CH471062 Genomic DNA. Translation: EAW61470.1 .
BC050375 mRNA. Translation: AAH50375.1 .
CCDSi CCDS34285.1. [Q9NZI2-4 ]
CCDS34286.1. [Q9NZI2-1 ]
CCDS64312.1. [Q9NZI2-5 ]
CCDS64313.1. [Q9NZI2-3 ]
RefSeqi NP_001030009.1. NM_001034837.2. [Q9NZI2-1 ]
NP_001030010.1. NM_001034838.2. [Q9NZI2-4 ]
NP_001265268.1. NM_001278339.1. [Q9NZI2-5 ]
NP_001265269.1. NM_001278340.1. [Q9NZI2-3 ]
NP_055407.1. NM_014592.3.
UniGenei Hs.484111.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1S1E X-ray 2.30 A 1-227 [» ]
2I2R X-ray 3.35 E/F/G/H/M/N/O/P 48-227 [» ]
2NZ0 X-ray 3.20 A/C 49-227 [» ]
ProteinModelPortali Q9NZI2.
SMRi Q9NZI2. Positions 49-227.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119044. 4 interactions.
DIPi DIP-29246N.
IntActi Q9NZI2. 2 interactions.
STRINGi 9606.ENSP00000395323.

Polymorphism databases

DMDMi 73621122.

Proteomic databases

MaxQBi Q9NZI2.
PaxDbi Q9NZI2.
PRIDEi Q9NZI2.

Protocols and materials databases

DNASUi 30820.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000328939 ; ENSP00000329686 ; ENSG00000182132 .
ENST00000377360 ; ENSP00000366577 ; ENSG00000182132 . [Q9NZI2-4 ]
ENST00000411494 ; ENSP00000395323 ; ENSG00000182132 . [Q9NZI2-1 ]
ENST00000434108 ; ENSP00000414886 ; ENSG00000182132 . [Q9NZI2-5 ]
ENST00000520740 ; ENSP00000431102 ; ENSG00000182132 . [Q9NZI2-3 ]
GeneIDi 30820.
KEGGi hsa:30820.
UCSCi uc003mas.3. human. [Q9NZI2-1 ]
uc003mat.3. human. [Q9NZI2-2 ]

Organism-specific databases

CTDi 30820.
GeneCardsi GC05P169780.
HGNCi HGNC:15521. KCNIP1.
HPAi HPA022864.
MIMi 604660. gene.
neXtProti NX_Q9NZI2.
PharmGKBi PA30041.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5126.
GeneTreei ENSGT00760000118820.
HOGENOMi HOG000233019.
HOVERGENi HBG108179.
InParanoidi Q9NZI2.
OMAi KQHVDAF.
OrthoDBi EOG7GJ6F3.
PhylomeDBi Q9NZI2.
TreeFami TF318560.

Miscellaneous databases

ChiTaRSi KCNIP1. human.
EvolutionaryTracei Q9NZI2.
GeneWikii KCNIP1.
GenomeRNAii 30820.
NextBioi 52920.
PROi Q9NZI2.
SOURCEi Search...

Gene expression databases

Bgeei Q9NZI2.
CleanExi HS_KCNIP1.
ExpressionAtlasi Q9NZI2. baseline and differential.
Genevestigatori Q9NZI2.

Family and domain databases

Gene3Di 1.10.238.10. 3 hits.
InterProi IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR028846. Recoverin.
[Graphical view ]
PANTHERi PTHR23055. PTHR23055. 1 hit.
Pfami PF13499. EF-hand_7. 1 hit.
[Graphical view ]
SMARTi SM00054. EFh. 3 hits.
[Graphical view ]
PROSITEi PS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH KCND2.
  2. "Molecular cloning of human VABP gene."
    Xia K., Fang H.Y., Zhong X.Y., Xia J.H., Zhang Z.H.
    Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "Structure, alternative splicing, and expression of the human and mouse KCNIP gene family."
    Pruunsild P., Timmusk T.
    Genomics 86:581-593(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4 AND 5), ALTERNATIVE SPLICING.
  4. "Study on mutations in KCNIP1 gene."
    Zheng L., Jun X.X., Yue F.F., Min L.Y., Ming S.Y., Jun Y.F.
    Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Testis.
  6. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  9. "Differential modulation of Kv4 kinetics by KCHIP1 splice variants."
    Van Hoorick D., Raes A., Keysers W., Mayeur E., Snyders D.J.
    Mol. Cell. Neurosci. 24:357-366(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), TISSUE SPECIFICITY (ISOFORMS 1 AND 2).
  10. "Different effects of the Ca(2+)-binding protein, KChIP1, on two Kv4 subfamily members, Kv4.1 and Kv4.2."
    Nakamura T.Y., Nandi S., Pountney D.J., Artman M., Rudy B., Coetzee W.A.
    FEBS Lett. 499:205-209(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels."
    Shibata R., Misonou H., Campomanes C.R., Anderson A.E., Schrader L.A., Doliveira L.C., Carroll K.I., Sweatt J.D., Rhodes K.J., Trimmer J.S.
    J. Biol. Chem. 278:36445-36454(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  12. "Evidence showing an intermolecular interaction between KChIP proteins and Taiwan cobra cardiotoxins."
    Lin Y.-L., Lin S.-R., Wu T.T., Chang L.-S.
    Biochem. Biophys. Res. Commun. 319:720-724(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SNAKE CTX3.
  13. "Protein-protein interactions of KChIP proteins and Kv4.2."
    Lin Y.-L., Chen C.Y., Cheng C.P., Chang L.S.
    Biochem. Biophys. Res. Commun. 321:606-610(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KCNIP2 AND KCDN2, HOMOOLIGOMERIZATION.
  14. Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) (ISOFORM 2), INTERACTION WITH KCDN2 AND KCDN3.
  15. "Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer."
    Pioletti M., Findeisen F., Hura G.L., Minor D.L. Jr.
    Nat. Struct. Mol. Biol. 13:987-995(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.35 ANGSTROMS) OF 48-227 IN COMPLEX WITH KCND3, SUBUNIT, CALCIUM-BINDING.
  16. "Structural basis for modulation of Kv4 K+ channels by auxiliary KChIP subunits."
    Wang H., Yan Y., Liu Q., Huang Y., Shen Y., Chen L., Chen Y., Yang Q., Hao Q., Wang K., Chai J.
    Nat. Neurosci. 10:32-39(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 49-227 IN COMPLEX WITH KCND3.

Entry informationi

Entry nameiKCIP1_HUMAN
AccessioniPrimary (citable) accession number: Q9NZI2
Secondary accession number(s): B7Z7B4
, Q3YAD0, Q3YAD1, Q3YAD2, Q3YAD3, Q5U822
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: October 29, 2014
This is version 122 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3