Q9NZI2 (KCIP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Kv channel-interacting protein 1 Short name=KChIP1 Alternative name(s): A-type potassium channel modulatory protein 1 Potassium channel-interacting protein 1 Vesicle APC-binding protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 227 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Seems to be involved in KCND2 trafficking to the cell surface. Ref.1 Ref.10 Ref.11 |
| Subunit structure | Component of heteromultimeric potassium channels. Interacts with KCND3 and the N-terminal domain of KCND2. Probably part of a complex consisting of KCNIP1, KCNIP2 isoform 3 and KCND2. Self-associates to form homodimers and homotetramers. Interacts with KCNIP2 isoform 3 in a calcium-dependent manner. Interacts with Naja atra venom CTX3. Ref.1 Ref.12 Ref.13 Ref.14 Ref.15 |
| Subcellular location | Cell membrane; Peripheral membrane protein By similarity. |
| Tissue specificity | Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus. Ref.9 |
| Sequence similarities | Belongs to the recoverin family. Contains 4 EF-hand domains. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| KCND2 | Q9NZV8 | 4 | EBI-2120635,EBI-1646745 | |
| KCNIP2 | Q9NS61-3 | 4 | EBI-2120635,EBI-1053010 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NZI2-1) Also known as: KCHIP1b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NZI2-2) Also known as: KCHIP1a; The sequence of this isoform differs from the canonical sequence as follows: 21-31: Missing. | ||||||
| Isoform 3 (identifier: Q9NZI2-3) The sequence of this isoform differs from the canonical sequence as follows: 1-39: Missing. | ||||||
| Isoform 4 (identifier: Q9NZI2-4) The sequence of this isoform differs from the canonical sequence as follows: 1-31: MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQR → MSGCSKRCKLGFVKFAQTIFKLITGTLSK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 227 | 227 | Kv channel-interacting protein 1 | PRO_0000073818 | |||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 38 – 94 | 57 | EF-hand 1; degenerate | ||||||||||||||||||||||||||||||||||||||||
| Domain | 97 – 132 | 36 | EF-hand 2 | ||||||||||||||||||||||||||||||||||||||||
| Domain | 133 – 168 | 36 | EF-hand 3 | ||||||||||||||||||||||||||||||||||||||||
| Domain | 181 – 216 | 36 | EF-hand 4 | ||||||||||||||||||||||||||||||||||||||||
| Calcium binding | 146 – 157 | 12 | 1 Ref.15 | ||||||||||||||||||||||||||||||||||||||||
| Calcium binding | 194 – 205 | 12 | 2 Ref.15 | ||||||||||||||||||||||||||||||||||||||||
| Region | 214 – 227 | 14 | Interaction with KCND2 By similarity | ||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 39 | 39 | Missing in isoform 3. | VSP_015043 | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 31 | 31 | MGAVM…YQYQR → MSGCSKRCKLGFVKFAQTIF KLITGTLSK in isoform 4. | VSP_041511 | |||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 21 – 31 | 11 | Missing in isoform 2. | VSP_015044 | |||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 116 | 1 | S → P in BAH13550. Ref.5 | ||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||
| Helix | 50 – 56 | 7 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 57 – 59 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 61 – 74 | 14 | |||||||||||||||||||||||||||||||||||||||||
| Turn | 76 – 78 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 82 – 90 | 9 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 93 – 96 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 99 – 109 | 11 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 112 – 116 | 5 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 131 | 13 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 134 – 145 | 12 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 151 – 153 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 155 – 169 | 15 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 177 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 179 – 181 | 3 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 182 – 193 | 12 | |||||||||||||||||||||||||||||||||||||||||
| Beta strand | 198 – 201 | 4 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 203 – 211 | 9 | |||||||||||||||||||||||||||||||||||||||||
| Helix | 214 – 225 | 12 | |||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Modulation of A-type potassium channels by a family of calcium sensors." An W.F., Bowlby M.R., Betty M., Cao J., Ling H.-P., Mendoza G., Hinson J.W., Mattsson K.I., Strassle B.W., Trimmer J.S., Rhodes K.J. Nature 403:553-556(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH KCND2. |
| [2] | "Molecular cloning of human VABP gene." Xia K., Fang H.Y., Zhong X.Y., Xia J.H., Zhang Z.H. Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Structure, alternative splicing, and expression of the human and mouse KCNIP gene family." Pruunsild P., Timmusk T. Genomics 86:581-593(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), ALTERNATIVE SPLICING. |
| [4] | "Study on mutations in KCNIP1 gene." Zheng L., Jun X.X., Yue F.F., Min L.Y., Ming S.Y., Jun Y.F. Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Testis. |
| [6] | "The DNA sequence and comparative analysis of human chromosome 5." Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S. Rubin E.M.Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [9] | "Differential modulation of Kv4 kinetics by KCHIP1 splice variants." Van Hoorick D., Raes A., Keysers W., Mayeur E., Snyders D.J. Mol. Cell. Neurosci. 24:357-366(2003) [PubMed] [Europe PMC] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), TISSUE SPECIFICITY (ISOFORMS 1 AND 2). |
| [10] | "Different effects of the Ca(2+)-binding protein, KChIP1, on two Kv4 subfamily members, Kv4.1 and Kv4.2." Nakamura T.Y., Nandi S., Pountney D.J., Artman M., Rudy B., Coetzee W.A. FEBS Lett. 499:205-209(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels." Shibata R., Misonou H., Campomanes C.R., Anderson A.E., Schrader L.A., Doliveira L.C., Carroll K.I., Sweatt J.D., Rhodes K.J., Trimmer J.S. J. Biol. Chem. 278:36445-36454(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [12] | "Evidence showing an intermolecular interaction between KChIP proteins and Taiwan cobra cardiotoxins." Lin Y.-L., Lin S.-R., Wu T.T., Chang L.-S. Biochem. Biophys. Res. Commun. 319:720-724(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SNAKE CTX3. |
| [13] | "Protein-protein interactions of KChIP proteins and Kv4.2." Lin Y.-L., Chen C.Y., Cheng C.P., Chang L.S. Biochem. Biophys. Res. Commun. 321:606-610(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH KCNIP2 AND KCDN2, HOMOOLIGOMERIZATION. |
| [14] | "Two N-terminal domains of Kv4 K(+) channels regulate binding to and modulation by KChIP1." Scannevin R.H., Wang K., Jow F., Megules J., Kopsco D.C., Edris W., Carroll K.C., Lu Q., Xu W., Xu Z., Katz A.H., Olland S., Lin L., Taylor M., Stahl M., Malakian K., Somers W., Mosyak L. Rhodes K.J.Neuron 41:587-598(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) (ISOFORM 2), INTERACTION WITH KCDN2 AND KCDN3. |
| [15] | "Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer." Pioletti M., Findeisen F., Hura G.L., Minor D.L. Jr. Nat. Struct. Mol. Biol. 13:987-995(2006) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.35 ANGSTROMS) OF 48-227 IN COMPLEX WITH KCND3, SUBUNIT, CALCIUM-BINDING. |
| [16] | "Structural basis for modulation of Kv4 K+ channels by auxiliary KChIP subunits." Wang H., Yan Y., Liu Q., Huang Y., Shen Y., Chen L., Chen Y., Yang Q., Hao Q., Wang K., Chai J. Nat. Neurosci. 10:32-39(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 49-227 IN COMPLEX WITH KCND3. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF199597 mRNA. Translation: AAF33682.1. AY170821 mRNA. Translation: AAN77491.1. DQ148477 mRNA. Translation: AAZ77794.1. AY780424 mRNA. Translation: AAV51968.1. AK301775 mRNA. Translation: BAH13550.1. AC008619 Genomic DNA. No translation available. AC008719 Genomic DNA. No translation available. AC027306 Genomic DNA. No translation available. AC027312 Genomic DNA. No translation available. AC034199 Genomic DNA. No translation available. AC113432 Genomic DNA. No translation available. AC134820 Genomic DNA. No translation available. CH471062 Genomic DNA. Translation: EAW61470.1. BC050375 mRNA. Translation: AAH50375.1. | ||||||||||||||||||||||||
| IPI | IPI00433691. IPI00641978. IPI00645089. IPI00845317. | ||||||||||||||||||||||||
| RefSeq | NP_001030009.1. NM_001034837.1. NP_055407.1. NM_014592.2. | ||||||||||||||||||||||||
| UniGene | Hs.484111. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q9NZI2. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-29246N. | ||||||||||||||||||||||||
| IntAct | Q9NZI2. 2 interactions. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000395323. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 73621122. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q9NZI2. | ||||||||||||||||||||||||
| PRIDE | Q9NZI2. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| DNASU | 30820. | ||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000328939; ENSP00000329686; ENSG00000182132. ENST00000377360; ENSP00000366577; ENSG00000182132. ENST00000390656; ENSP00000375071; ENSG00000182132. ENST00000411494; ENSP00000395323; ENSG00000182132. ENST00000520740; ENSP00000431102; ENSG00000182132. | ||||||||||||||||||||||||
| GeneID | 30820. | ||||||||||||||||||||||||
| KEGG | hsa:30820. | ||||||||||||||||||||||||
| UCSC | uc003mas.3. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 30820. | ||||||||||||||||||||||||
| GeneCards | GC05P169780. | ||||||||||||||||||||||||
| HGNC | HGNC:15521. KCNIP1. | ||||||||||||||||||||||||
| HPA | HPA022864. | ||||||||||||||||||||||||
| MIM | 604660. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q9NZI2. | ||||||||||||||||||||||||
| PharmGKB | PA30041. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | COG5126. | ||||||||||||||||||||||||
| HOGENOM | HOG000233019. | ||||||||||||||||||||||||
| HOVERGEN | HBG108179. | ||||||||||||||||||||||||
| InParanoid | Q9NZI2. | ||||||||||||||||||||||||
| OMA | NFNKREL. | ||||||||||||||||||||||||
| OrthoDB | EOG4N8R5P. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q9NZI2. | ||||||||||||||||||||||||
| Bgee | Q9NZI2. | ||||||||||||||||||||||||
| CleanEx | HS_KCNIP1. | ||||||||||||||||||||||||
| Genevestigator | Q9NZI2. | ||||||||||||||||||||||||
| GermOnline | ENSG00000182132. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| Gene3D | 1.10.238.10. 3 hits. | ||||||||||||||||||||||||
| InterPro | IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR002048. EF_hand_dom. IPR001125. Recoverin. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF13499. EF_hand_5. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR00450. RECOVERIN. | ||||||||||||||||||||||||
| SMART | SM00054. EFh. 3 hits. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 3 hits. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | KCNIP1. human. | ||||||||||||||||||||||||
| EvolutionaryTrace | Q9NZI2. | ||||||||||||||||||||||||
| GenomeRNAi | 30820. | ||||||||||||||||||||||||
| NextBio | 52920. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | KCIP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NZI2 Secondary accession number(s): B7Z7B4, Q3YAD2, Q5U822 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 5 Human chromosome 5: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
