Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NZI2

- KCIP1_HUMAN

UniProt

Q9NZI2 - KCIP1_HUMAN

Protein

Kv channel-interacting protein 1

Gene

KCNIP1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 121 (01 Oct 2014)
      Sequence version 2 (16 Aug 2005)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Probably modulates channels density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner. In vitro, modulates KCND1/Kv4.1 and KCND2/Kv4.2 currents. Seems to be involved in KCND2 trafficking to the cell surface.3 Publications

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi146 – 157121Add
    BLAST
    Calcium bindingi194 – 205122Add
    BLAST

    GO - Molecular functioni

    1. calcium ion binding Source: Ensembl
    2. potassium channel activity Source: UniProtKB-KW
    3. potassium channel regulator activity Source: Ensembl
    4. protein binding Source: IntAct
    5. voltage-gated ion channel activity Source: UniProtKB-KW

    GO - Biological processi

    1. detection of calcium ion Source: ProtInc
    2. positive regulation of action potential Source: Ensembl
    3. signal transduction Source: ProtInc
    4. synaptic transmission Source: ProtInc

    Keywords - Molecular functioni

    Ion channel, Potassium channel, Voltage-gated channel

    Keywords - Biological processi

    Ion transport, Potassium transport, Transport

    Keywords - Ligandi

    Calcium, Metal-binding, Potassium

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Kv channel-interacting protein 1
    Short name:
    KChIP1
    Alternative name(s):
    A-type potassium channel modulatory protein 1
    Potassium channel-interacting protein 1
    Vesicle APC-binding protein
    Gene namesi
    Name:KCNIP1
    Synonyms:KCHIP1, VABP
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:15521. KCNIP1.

    Subcellular locationi

    Cell membrane By similarity; Peripheral membrane protein By similarity

    GO - Cellular componenti

    1. dendrite Source: Ensembl
    2. neuronal cell body Source: Ensembl
    3. plasma membrane Source: UniProtKB-SubCell
    4. potassium channel complex Source: Ensembl

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA30041.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 227227Kv channel-interacting protein 1PRO_0000073818Add
    BLAST

    Proteomic databases

    MaxQBiQ9NZI2.
    PaxDbiQ9NZI2.
    PRIDEiQ9NZI2.

    Expressioni

    Tissue specificityi

    Isoform 1 and isoform 2 are expressed in brain and kidney. Isoform 1 is also expressed in liver, pancreas, skeletal muscle, small intestine and testis. Isoform 2 is also expressed in lung, pancreas, leukocytes, prostate and thymus.

    Gene expression databases

    ArrayExpressiQ9NZI2.
    BgeeiQ9NZI2.
    CleanExiHS_KCNIP1.
    GenevestigatoriQ9NZI2.

    Organism-specific databases

    HPAiHPA022864.

    Interactioni

    Subunit structurei

    Component of heteromultimeric potassium channels. Interacts with KCND3 and the N-terminal domain of KCND2. Probably part of a complex consisting of KCNIP1, KCNIP2 isoform 3 and KCND2. Self-associates to form homodimers and homotetramers. Interacts with KCNIP2 isoform 3 in a calcium-dependent manner. Interacts with Naja atra venom CTX3.6 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    KCND2Q9NZV84EBI-2120635,EBI-1646745
    KCNIP2Q9NS61-34EBI-2120635,EBI-1053010

    Protein-protein interaction databases

    BioGridi119044. 3 interactions.
    DIPiDIP-29246N.
    IntActiQ9NZI2. 2 interactions.
    STRINGi9606.ENSP00000395323.

    Structurei

    Secondary structure

    1
    227
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi50 – 567
    Beta strandi57 – 593
    Helixi61 – 7414
    Turni76 – 783
    Helixi82 – 909
    Beta strandi93 – 964
    Helixi99 – 10911
    Beta strandi112 – 1165
    Helixi119 – 13113
    Helixi134 – 14512
    Beta strandi151 – 1533
    Helixi155 – 16915
    Helixi175 – 1773
    Beta strandi179 – 1813
    Helixi182 – 19312
    Beta strandi198 – 2014
    Helixi203 – 2119
    Helixi214 – 22512

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1S1EX-ray2.30A1-227[»]
    2I2RX-ray3.35E/F/G/H/M/N/O/P48-227[»]
    2NZ0X-ray3.20A/C49-227[»]
    ProteinModelPortaliQ9NZI2.
    SMRiQ9NZI2. Positions 49-227.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9NZI2.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini38 – 9457EF-hand 1; degeneratePROSITE-ProRule annotationAdd
    BLAST
    Domaini97 – 13236EF-hand 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini133 – 16836EF-hand 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini181 – 21636EF-hand 4PROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni214 – 22714Interaction with KCND2By similarityAdd
    BLAST

    Sequence similaritiesi

    Belongs to the recoverin family.Curated
    Contains 4 EF-hand domains.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiCOG5126.
    HOGENOMiHOG000233019.
    HOVERGENiHBG108179.
    InParanoidiQ9NZI2.
    OMAiKQHVDAF.
    OrthoDBiEOG7GJ6F3.
    PhylomeDBiQ9NZI2.
    TreeFamiTF318560.

    Family and domain databases

    Gene3Di1.10.238.10. 3 hits.
    InterProiIPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR028846. Recoverin.
    [Graphical view]
    PANTHERiPTHR23055. PTHR23055. 1 hit.
    PfamiPF13499. EF-hand_7. 1 hit.
    [Graphical view]
    SMARTiSM00054. EFh. 3 hits.
    [Graphical view]
    PROSITEiPS00018. EF_HAND_1. 2 hits.
    PS50222. EF_HAND_2. 3 hits.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NZI2-1) [UniParc]FASTAAdd to Basket

    Also known as: KCHIP1b

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MGAVMGTFSS LQTKQRRPSK DIAWWYYQYQ RDKIEDELEM TMVCHRPEGL    50
    EQLEAQTNFT KRELQVLYRG FKNECPSGVV NEDTFKQIYA QFFPHGDAST 100
    YAHYLFNAFD TTQTGSVKFE DFVTALSILL RGTVHEKLRW TFNLYDINKD 150
    GYINKEEMMD IVKAIYDMMG KYTYPVLKED TPRQHVDVFF QKMDKNKDGI 200
    VTLDEFLESC QEDDNIMRSL QLFQNVM 227
    Length:227
    Mass (Da):26,817
    Last modified:August 16, 2005 - v2
    Checksum:iD39DD5F8EA13B0FD
    GO
    Isoform 2 (identifier: Q9NZI2-2) [UniParc]FASTAAdd to Basket

    Also known as: KCHIP1a

    The sequence of this isoform differs from the canonical sequence as follows:
         21-31: Missing.
         93-130: Missing.

    Show »
    Length:178
    Mass (Da):21,036
    Checksum:i8D1E9F2FEB2D5502
    GO
    Isoform 3 (identifier: Q9NZI2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-39: Missing.

    Show »
    Length:188
    Mass (Da):22,079
    Checksum:i5712C89FF2FA0176
    GO
    Isoform 4 (identifier: Q9NZI2-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: MGAVMGTFSSLQTKQRRPSKDIAWWYYQYQR → MSGCSKRCKLGFVKFAQTIFKLITGTLSK

    Show »
    Length:225
    Mass (Da):26,227
    Checksum:i15705CD8C4385B7B
    GO
    Isoform 5 (identifier: Q9NZI2-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         21-31: Missing.
         96-96: G → GALPCLEGSPCVEFLPPSPALLFCLV

    Show »
    Length:241
    Mass (Da):27,842
    Checksum:i856A1EC2DEE17668
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti116 – 1161S → P in BAH13550. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 3939Missing in isoform 3. 1 PublicationVSP_015043Add
    BLAST
    Alternative sequencei1 – 3131MGAVM…YQYQR → MSGCSKRCKLGFVKFAQTIF KLITGTLSK in isoform 4. 2 PublicationsVSP_041511Add
    BLAST
    Alternative sequencei21 – 3111Missing in isoform 2 and isoform 5. 4 PublicationsVSP_015044Add
    BLAST
    Alternative sequencei93 – 13038Missing in isoform 2. 4 PublicationsVSP_047686Add
    BLAST
    Alternative sequencei96 – 961G → GALPCLEGSPCVEFLPPSPA LLFCLV in isoform 5. 1 PublicationVSP_047687

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF199597 mRNA. Translation: AAF33682.1.
    AY170821 mRNA. Translation: AAN77491.1.
    DQ148476 mRNA. Translation: AAZ77793.1.
    DQ148477 mRNA. Translation: AAZ77794.1.
    DQ148478 mRNA. Translation: AAZ77795.1.
    DQ148479 mRNA. Translation: AAZ77796.1.
    AY780424 mRNA. Translation: AAV51968.1.
    AK301775 mRNA. Translation: BAH13550.1.
    AC008619 Genomic DNA. No translation available.
    AC008719 Genomic DNA. No translation available.
    AC027306 Genomic DNA. No translation available.
    AC027312 Genomic DNA. No translation available.
    AC034199 Genomic DNA. No translation available.
    AC113432 Genomic DNA. No translation available.
    AC134820 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW61470.1.
    BC050375 mRNA. Translation: AAH50375.1.
    CCDSiCCDS34285.1. [Q9NZI2-4]
    CCDS34286.1. [Q9NZI2-1]
    CCDS64312.1. [Q9NZI2-5]
    CCDS64313.1. [Q9NZI2-3]
    RefSeqiNP_001030009.1. NM_001034837.2. [Q9NZI2-1]
    NP_001030010.1. NM_001034838.2. [Q9NZI2-4]
    NP_001265268.1. NM_001278339.1. [Q9NZI2-5]
    NP_001265269.1. NM_001278340.1. [Q9NZI2-3]
    NP_055407.1. NM_014592.3.
    UniGeneiHs.484111.

    Genome annotation databases

    EnsembliENST00000328939; ENSP00000329686; ENSG00000182132.
    ENST00000377360; ENSP00000366577; ENSG00000182132. [Q9NZI2-4]
    ENST00000390656; ENSP00000375071; ENSG00000182132.
    ENST00000411494; ENSP00000395323; ENSG00000182132. [Q9NZI2-1]
    ENST00000434108; ENSP00000414886; ENSG00000182132. [Q9NZI2-5]
    ENST00000520740; ENSP00000431102; ENSG00000182132. [Q9NZI2-3]
    GeneIDi30820.
    KEGGihsa:30820.
    UCSCiuc003mas.3. human. [Q9NZI2-1]
    uc003mat.3. human. [Q9NZI2-2]

    Polymorphism databases

    DMDMi73621122.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF199597 mRNA. Translation: AAF33682.1 .
    AY170821 mRNA. Translation: AAN77491.1 .
    DQ148476 mRNA. Translation: AAZ77793.1 .
    DQ148477 mRNA. Translation: AAZ77794.1 .
    DQ148478 mRNA. Translation: AAZ77795.1 .
    DQ148479 mRNA. Translation: AAZ77796.1 .
    AY780424 mRNA. Translation: AAV51968.1 .
    AK301775 mRNA. Translation: BAH13550.1 .
    AC008619 Genomic DNA. No translation available.
    AC008719 Genomic DNA. No translation available.
    AC027306 Genomic DNA. No translation available.
    AC027312 Genomic DNA. No translation available.
    AC034199 Genomic DNA. No translation available.
    AC113432 Genomic DNA. No translation available.
    AC134820 Genomic DNA. No translation available.
    CH471062 Genomic DNA. Translation: EAW61470.1 .
    BC050375 mRNA. Translation: AAH50375.1 .
    CCDSi CCDS34285.1. [Q9NZI2-4 ]
    CCDS34286.1. [Q9NZI2-1 ]
    CCDS64312.1. [Q9NZI2-5 ]
    CCDS64313.1. [Q9NZI2-3 ]
    RefSeqi NP_001030009.1. NM_001034837.2. [Q9NZI2-1 ]
    NP_001030010.1. NM_001034838.2. [Q9NZI2-4 ]
    NP_001265268.1. NM_001278339.1. [Q9NZI2-5 ]
    NP_001265269.1. NM_001278340.1. [Q9NZI2-3 ]
    NP_055407.1. NM_014592.3.
    UniGenei Hs.484111.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1S1E X-ray 2.30 A 1-227 [» ]
    2I2R X-ray 3.35 E/F/G/H/M/N/O/P 48-227 [» ]
    2NZ0 X-ray 3.20 A/C 49-227 [» ]
    ProteinModelPortali Q9NZI2.
    SMRi Q9NZI2. Positions 49-227.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119044. 3 interactions.
    DIPi DIP-29246N.
    IntActi Q9NZI2. 2 interactions.
    STRINGi 9606.ENSP00000395323.

    Polymorphism databases

    DMDMi 73621122.

    Proteomic databases

    MaxQBi Q9NZI2.
    PaxDbi Q9NZI2.
    PRIDEi Q9NZI2.

    Protocols and materials databases

    DNASUi 30820.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000328939 ; ENSP00000329686 ; ENSG00000182132 .
    ENST00000377360 ; ENSP00000366577 ; ENSG00000182132 . [Q9NZI2-4 ]
    ENST00000390656 ; ENSP00000375071 ; ENSG00000182132 .
    ENST00000411494 ; ENSP00000395323 ; ENSG00000182132 . [Q9NZI2-1 ]
    ENST00000434108 ; ENSP00000414886 ; ENSG00000182132 . [Q9NZI2-5 ]
    ENST00000520740 ; ENSP00000431102 ; ENSG00000182132 . [Q9NZI2-3 ]
    GeneIDi 30820.
    KEGGi hsa:30820.
    UCSCi uc003mas.3. human. [Q9NZI2-1 ]
    uc003mat.3. human. [Q9NZI2-2 ]

    Organism-specific databases

    CTDi 30820.
    GeneCardsi GC05P169780.
    HGNCi HGNC:15521. KCNIP1.
    HPAi HPA022864.
    MIMi 604660. gene.
    neXtProti NX_Q9NZI2.
    PharmGKBi PA30041.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5126.
    HOGENOMi HOG000233019.
    HOVERGENi HBG108179.
    InParanoidi Q9NZI2.
    OMAi KQHVDAF.
    OrthoDBi EOG7GJ6F3.
    PhylomeDBi Q9NZI2.
    TreeFami TF318560.

    Miscellaneous databases

    ChiTaRSi KCNIP1. human.
    EvolutionaryTracei Q9NZI2.
    GeneWikii KCNIP1.
    GenomeRNAii 30820.
    NextBioi 52920.
    PROi Q9NZI2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NZI2.
    Bgeei Q9NZI2.
    CleanExi HS_KCNIP1.
    Genevestigatori Q9NZI2.

    Family and domain databases

    Gene3Di 1.10.238.10. 3 hits.
    InterProi IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR028846. Recoverin.
    [Graphical view ]
    PANTHERi PTHR23055. PTHR23055. 1 hit.
    Pfami PF13499. EF-hand_7. 1 hit.
    [Graphical view ]
    SMARTi SM00054. EFh. 3 hits.
    [Graphical view ]
    PROSITEi PS00018. EF_HAND_1. 2 hits.
    PS50222. EF_HAND_2. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH KCND2.
    2. "Molecular cloning of human VABP gene."
      Xia K., Fang H.Y., Zhong X.Y., Xia J.H., Zhang Z.H.
      Submitted (OCT-2002) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. "Structure, alternative splicing, and expression of the human and mouse KCNIP gene family."
      Pruunsild P., Timmusk T.
      Genomics 86:581-593(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 4 AND 5), ALTERNATIVE SPLICING.
    4. "Study on mutations in KCNIP1 gene."
      Zheng L., Jun X.X., Yue F.F., Min L.Y., Ming S.Y., Jun Y.F.
      Submitted (OCT-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
      Tissue: Testis.
    6. "The DNA sequence and comparative analysis of human chromosome 5."
      Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
      , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
      Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    9. "Differential modulation of Kv4 kinetics by KCHIP1 splice variants."
      Van Hoorick D., Raes A., Keysers W., Mayeur E., Snyders D.J.
      Mol. Cell. Neurosci. 24:357-366(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: PARTIAL NUCLEOTIDE SEQUENCE [GENOMIC DNA], ALTERNATIVE SPLICING (ISOFORM 1), TISSUE SPECIFICITY (ISOFORMS 1 AND 2).
    10. "Different effects of the Ca(2+)-binding protein, KChIP1, on two Kv4 subfamily members, Kv4.1 and Kv4.2."
      Nakamura T.Y., Nandi S., Pountney D.J., Artman M., Rudy B., Coetzee W.A.
      FEBS Lett. 499:205-209(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    11. "A fundamental role for KChIPs in determining the molecular properties and trafficking of Kv4.2 potassium channels."
      Shibata R., Misonou H., Campomanes C.R., Anderson A.E., Schrader L.A., Doliveira L.C., Carroll K.I., Sweatt J.D., Rhodes K.J., Trimmer J.S.
      J. Biol. Chem. 278:36445-36454(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    12. "Evidence showing an intermolecular interaction between KChIP proteins and Taiwan cobra cardiotoxins."
      Lin Y.-L., Lin S.-R., Wu T.T., Chang L.-S.
      Biochem. Biophys. Res. Commun. 319:720-724(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH SNAKE CTX3.
    13. "Protein-protein interactions of KChIP proteins and Kv4.2."
      Lin Y.-L., Chen C.Y., Cheng C.P., Chang L.S.
      Biochem. Biophys. Res. Commun. 321:606-610(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH KCNIP2 AND KCDN2, HOMOOLIGOMERIZATION.
    14. Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) (ISOFORM 2), INTERACTION WITH KCDN2 AND KCDN3.
    15. "Three-dimensional structure of the KChIP1-Kv4.3 T1 complex reveals a cross-shaped octamer."
      Pioletti M., Findeisen F., Hura G.L., Minor D.L. Jr.
      Nat. Struct. Mol. Biol. 13:987-995(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.35 ANGSTROMS) OF 48-227 IN COMPLEX WITH KCND3, SUBUNIT, CALCIUM-BINDING.
    16. "Structural basis for modulation of Kv4 K+ channels by auxiliary KChIP subunits."
      Wang H., Yan Y., Liu Q., Huang Y., Shen Y., Chen L., Chen Y., Yang Q., Hao Q., Wang K., Chai J.
      Nat. Neurosci. 10:32-39(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.2 ANGSTROMS) OF 49-227 IN COMPLEX WITH KCND3.

    Entry informationi

    Entry nameiKCIP1_HUMAN
    AccessioniPrimary (citable) accession number: Q9NZI2
    Secondary accession number(s): B7Z7B4
    , Q3YAD0, Q3YAD1, Q3YAD2, Q3YAD3, Q5U822
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 16, 2005
    Last sequence update: August 16, 2005
    Last modified: October 1, 2014
    This is version 121 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3