Reviewed,
UniProtKB/Swiss-Prot Q9NZH8 (IL1F9_HUMAN)
Last modified
March 2, 2010.
Version 78.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Interleukin-1 family member 9 Short name=IL-1F9 Alternative name(s): Interleukin-1 homolog 1 Short name=IL-1H1 Interleukin-1 epsilon Short name=IL-1 epsilon IL-1-related protein 2 Short name=IL-1RP2 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 169 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response. |
| Subcellular location | |
| Tissue specificity | Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin. |
| Induction | By TNF-alpha and by IFN-gamma in keratinocytes. |
| Sequence similarities | Belongs to the IL-1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Cytokine |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | cell-cell signaling Ref.1 Traceable author statement. Source: ProtInc |
| Cellular component | extracellular space Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | cytokine activity Inferred from electronic annotation. Source: UniProtKB-KW interleukin-1 receptor antagonist activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NZH8-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NZH8-2) The sequence of this isoform differs from the canonical sequence as follows: 19-54: MCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPV → I | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification and initial characterization of four novel members of the interleukin-1 family." Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N., Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L., Young P.R. J. Biol. Chem. 275:10308-10314(2000) [PubMed: 10744718] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Keratinocyte. |
| [2] | "Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2." Debets R., Timans J.C., Homey B., Zurawski S., Sana T.R., Lo S., Wagner J., Edwards G., Clifford T., Menon S., Bazan J.F., Kastelein R.A. J. Immunol. 167:1440-1446(2001) [PubMed: 11466363] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION. Tissue: Epithelium. |
| [3] | "Identification and gene organization of three novel members of the IL-1 family on human chromosome 2." Busfield S.J., Comrack C.A., Yu G., Chickering T.W., Smutko J.S., Zhou H., Leiby K.R., Holmgren L.M., Gearing D.P., Pan Y. Genomics 66:213-216(2000) [PubMed: 10860666] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [4] | "A sequence-based map of the nine genes of the human interleukin-1 cluster." Nicklin M.J.H., Barton J.L., Nguyen M., Fitzgerald M.G., Duff W.G., Kornman K. Genomics 79:718-725(2002) [PubMed: 11991722] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [5] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed: 12975309] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | SeattleSNPs variation discovery resource Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA]. |
| [7] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF200492 mRNA. Translation: AAF69248.1. AF206696 mRNA. Translation: AAG35670.1. BN000002 Genomic DNA. Translation: CAD29874.1. AY359111 mRNA. Translation: AAQ89469.1. AY968311 Genomic DNA. Translation: AAX59035.1. AC016724 Genomic DNA. Translation: AAY14987.1. BC096721 mRNA. Translation: AAH96721.1. BC098130 mRNA. Translation: AAH98130.1. BC098155 mRNA. Translation: AAH98155.1. BC098337 mRNA. Translation: AAH98337.1. |
| IPI | IPI00021343. IPI00432063. |
| RefSeq | NP_062564.1. |
| UniGene | Hs.211238 |
3D structure databases | |
| SMR | Q9NZH8. Positions 24-166. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9NZH8. |
PTM databases | |
| PhosphoSite | Q9NZH8. |
Proteomic databases | |
| PRIDE | Q9NZH8. |
Genome annotation databases | |
| Ensembl | ENST00000259205; ENSP00000259205; ENSG00000136688; Homo sapiens. [Genome view] |
| GeneID | 56300. |
| KEGG | hsa:56300. |
| UCSC | uc002tio.1. human. uc010fkr.1. human. |
Organism-specific databases | |
| CTD | 56300. |
| GeneCards | GC02P113451. |
| H-InvDB | HIX0029828. |
| HGNC | HGNC:15741. IL1F9. |
| MIM | 605542. gene. |
| PharmGKB | PA38395. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG15159. |
| HOGENOM | HBG281875. |
| HOVERGEN | HBG052100. |
| InParanoid | Q9NZH8. |
| OMA | PCKYPES. |
| PhylomeDB | Q9NZH8. |
Gene expression databases | |
| ArrayExpress | Q9NZH8. |
| Bgee | Q9NZH8. |
| CleanEx | HS_IL1F9. |
| Genevestigator | Q9NZH8. |
| GermOnline | ENSG00000136688. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR008996. Cytokine_IL1-like. IPR003297. IL_rcpt_IL1RA. IPR000975. Interleukin_1. [Graphical view] |
| Pfam | PF00340. IL1. 1 hit. [Graphical view] |
| PRINTS | PR00264. INTERLEUKIN1. PR01360. INTRLEUKIN1X. |
| SMART | SM00125. IL1. 1 hit. [Graphical view] |
| SUPFAM | SSF50353. Cytok_IL1_like. 1 hit. |
| PROSITE | PS00253. INTERLEUKIN_1. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 61963. |
| SOURCE | Search... |
Entry information
| Entry name | IL1F9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NZH8 Secondary accession number(s): Q56B91, Q6UVX7, Q7RTZ9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


