SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NZH8

- IL36G_HUMAN

UniProt

Q9NZH8 - IL36G_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Interleukin-36 gamma
Gene
IL36G, IL1E, IL1F9, IL1H1, IL1RP2, UNQ2456/PRO5737
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response.

GO - Biological processi

  1. cell-cell signaling Source: ProtInc
  2. immune response Source: InterPro
  3. inflammatory response Source: InterPro
  4. positive regulation of interleukin-6 production Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Enzyme and pathway databases

SignaLinkiQ9NZH8.

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-36 gamma
Alternative name(s):
IL-1-related protein 2
Short name:
IL-1RP2
Interleukin-1 epsilon
Short name:
IL-1 epsilon
Interleukin-1 family member 9
Short name:
IL-1F9
Interleukin-1 homolog 1
Short name:
IL-1H1
Gene namesi
Name:IL36G
Synonyms:IL1E, IL1F9, IL1H1, IL1RP2
ORF Names:UNQ2456/PRO5737
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:15741. IL36G.

Subcellular locationi

GO - Cellular componenti

  1. extracellular space Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38395.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 169169Interleukin-36 gamma
PRO_0000153648Add
BLAST

Proteomic databases

PaxDbiQ9NZH8.
PRIDEiQ9NZH8.

PTM databases

PhosphoSiteiQ9NZH8.

Expressioni

Tissue specificityi

Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin.

Inductioni

By TNF and by IFNG/IFN-gamma in keratinocytes.

Gene expression databases

ArrayExpressiQ9NZH8.
BgeeiQ9NZH8.
CleanExiHS_IL1F9.
GenevestigatoriQ9NZH8.

Structurei

3D structure databases

ProteinModelPortaliQ9NZH8.
SMRiQ9NZH8. Positions 27-153.

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-1 family.

Phylogenomic databases

eggNOGiNOG39912.
HOVERGENiHBG052100.
InParanoidiQ9NZH8.
KOiK05487.
OMAiVITCKYP.
PhylomeDBiQ9NZH8.
TreeFamiTF300203.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR000975. IL-1_fam.
IPR003297. IL-1RA/IL-36.
IPR027163. IL-36_alpha/gamma.
[Graphical view]
PANTHERiPTHR10078:SF14. PTHR10078:SF14. 1 hit.
PfamiPF00340. IL1. 1 hit.
[Graphical view]
PRINTSiPR00264. INTERLEUKIN1.
PR01360. INTRLEUKIN1X.
SUPFAMiSSF50353. SSF50353. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NZH8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRGTPGDADG GGRAVYQSMC KPITGTINDL NQQVWTLQGQ NLVAVPRSDS    50
VTPVTVAVIT CKYPEALEQG RGDPIYLGIQ NPEMCLYCEK VGEQPTLQLK 100
EQKIMDLYGQ PEPVKPFLFY RAKTGRTSTL ESVAFPDWFI ASSKRDQPII 150
LTSELGKSYN TAFELNIND 169
Length:169
Mass (Da):18,721
Last modified:October 1, 2000 - v1
Checksum:iF00A9243706F4154
GO
Isoform 2 (identifier: Q9NZH8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     19-54: MCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPV → I

Note: No experimental confirmation available.

Show »
Length:134
Mass (Da):14,928
Checksum:iD5369C5AD44A9752
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti69 – 691Q → K.
Corresponds to variant rs6707930 [ dbSNP | Ensembl ].
VAR_024505

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei19 – 5436MCKPI…SVTPV → I in isoform 2.
VSP_013002Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF200492 mRNA. Translation: AAF69248.1.
AF206696 mRNA. Translation: AAG35670.1.
BN000002 Genomic DNA. Translation: CAD29874.1.
AY359111 mRNA. Translation: AAQ89469.1.
AY968311 Genomic DNA. Translation: AAX59035.1.
AC016724 Genomic DNA. Translation: AAY14987.1.
BC096721 mRNA. Translation: AAH96721.1.
BC098130 mRNA. Translation: AAH98130.1.
BC098155 mRNA. Translation: AAH98155.1.
BC098337 mRNA. Translation: AAH98337.1.
CCDSiCCDS2108.1. [Q9NZH8-1]
CCDS62992.1. [Q9NZH8-2]
RefSeqiNP_001265497.1. NM_001278568.1. [Q9NZH8-2]
NP_062564.1. NM_019618.3. [Q9NZH8-1]
UniGeneiHs.211238.

Genome annotation databases

EnsembliENST00000259205; ENSP00000259205; ENSG00000136688. [Q9NZH8-1]
ENST00000376489; ENSP00000365672; ENSG00000136688. [Q9NZH8-2]
GeneIDi56300.
KEGGihsa:56300.
UCSCiuc002tio.1. human. [Q9NZH8-1]
uc010fkr.1. human. [Q9NZH8-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Interleukin-1 entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF200492 mRNA. Translation: AAF69248.1 .
AF206696 mRNA. Translation: AAG35670.1 .
BN000002 Genomic DNA. Translation: CAD29874.1 .
AY359111 mRNA. Translation: AAQ89469.1 .
AY968311 Genomic DNA. Translation: AAX59035.1 .
AC016724 Genomic DNA. Translation: AAY14987.1 .
BC096721 mRNA. Translation: AAH96721.1 .
BC098130 mRNA. Translation: AAH98130.1 .
BC098155 mRNA. Translation: AAH98155.1 .
BC098337 mRNA. Translation: AAH98337.1 .
CCDSi CCDS2108.1. [Q9NZH8-1 ]
CCDS62992.1. [Q9NZH8-2 ]
RefSeqi NP_001265497.1. NM_001278568.1. [Q9NZH8-2 ]
NP_062564.1. NM_019618.3. [Q9NZH8-1 ]
UniGenei Hs.211238.

3D structure databases

ProteinModelPortali Q9NZH8.
SMRi Q9NZH8. Positions 27-153.
ModBasei Search...
MobiDBi Search...

PTM databases

PhosphoSitei Q9NZH8.

Proteomic databases

PaxDbi Q9NZH8.
PRIDEi Q9NZH8.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000259205 ; ENSP00000259205 ; ENSG00000136688 . [Q9NZH8-1 ]
ENST00000376489 ; ENSP00000365672 ; ENSG00000136688 . [Q9NZH8-2 ]
GeneIDi 56300.
KEGGi hsa:56300.
UCSCi uc002tio.1. human. [Q9NZH8-1 ]
uc010fkr.1. human. [Q9NZH8-2 ]

Organism-specific databases

CTDi 56300.
GeneCardsi GC02P113731.
HGNCi HGNC:15741. IL36G.
MIMi 605542. gene.
neXtProti NX_Q9NZH8.
PharmGKBi PA38395.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG39912.
HOVERGENi HBG052100.
InParanoidi Q9NZH8.
KOi K05487.
OMAi VITCKYP.
PhylomeDBi Q9NZH8.
TreeFami TF300203.

Enzyme and pathway databases

SignaLinki Q9NZH8.

Miscellaneous databases

GeneWikii IL1F9.
GenomeRNAii 56300.
NextBioi 61963.
PROi Q9NZH8.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9NZH8.
Bgeei Q9NZH8.
CleanExi HS_IL1F9.
Genevestigatori Q9NZH8.

Family and domain databases

InterProi IPR008996. Cytokine_IL1-like.
IPR000975. IL-1_fam.
IPR003297. IL-1RA/IL-36.
IPR027163. IL-36_alpha/gamma.
[Graphical view ]
PANTHERi PTHR10078:SF14. PTHR10078:SF14. 1 hit.
Pfami PF00340. IL1. 1 hit.
[Graphical view ]
PRINTSi PR00264. INTERLEUKIN1.
PR01360. INTRLEUKIN1X.
SUPFAMi SSF50353. SSF50353. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and initial characterization of four novel members of the interleukin-1 family."
    Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N., Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L., Young P.R.
    J. Biol. Chem. 275:10308-10314(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Keratinocyte.
  2. "Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2."
    Debets R., Timans J.C., Homey B., Zurawski S., Sana T.R., Lo S., Wagner J., Edwards G., Clifford T., Menon S., Bazan J.F., Kastelein R.A.
    J. Immunol. 167:1440-1446(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
    Tissue: Epithelium.
  3. "Identification and gene organization of three novel members of the IL-1 family on human chromosome 2."
    Busfield S.J., Comrack C.A., Yu G., Chickering T.W., Smutko J.S., Zhou H., Leiby K.R., Holmgren L.M., Gearing D.P., Pan Y.
    Genomics 66:213-216(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  4. "A sequence-based map of the nine genes of the human interleukin-1 cluster."
    Nicklin M.J.H., Barton J.L., Nguyen M., Fitzgerald M.G., Duff W.G., Kornman K.
    Genomics 79:718-725(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  6. SeattleSNPs variation discovery resource
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiIL36G_HUMAN
AccessioniPrimary (citable) accession number: Q9NZH8
Secondary accession number(s): Q56B91, Q6UVX7, Q7RTZ9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi