Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NZH8

- IL36G_HUMAN

UniProt

Q9NZH8 - IL36G_HUMAN

Protein

Interleukin-36 gamma

Gene

IL36G

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response.

    GO - Biological processi

    1. cell-cell signaling Source: ProtInc
    2. immune response Source: InterPro
    3. inflammatory response Source: InterPro
    4. positive regulation of interleukin-6 production Source: Ensembl

    Keywords - Molecular functioni

    Cytokine

    Enzyme and pathway databases

    SignaLinkiQ9NZH8.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Interleukin-36 gamma
    Alternative name(s):
    IL-1-related protein 2
    Short name:
    IL-1RP2
    Interleukin-1 epsilon
    Short name:
    IL-1 epsilon
    Interleukin-1 family member 9
    Short name:
    IL-1F9
    Interleukin-1 homolog 1
    Short name:
    IL-1H1
    Gene namesi
    Name:IL36G
    Synonyms:IL1E, IL1F9, IL1H1, IL1RP2
    ORF Names:UNQ2456/PRO5737
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:15741. IL36G.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular space Source: UniProtKB-KW

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38395.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 169169Interleukin-36 gammaPRO_0000153648Add
    BLAST

    Proteomic databases

    PaxDbiQ9NZH8.
    PRIDEiQ9NZH8.

    PTM databases

    PhosphoSiteiQ9NZH8.

    Expressioni

    Tissue specificityi

    Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin.

    Inductioni

    By TNF and by IFNG/IFN-gamma in keratinocytes.

    Gene expression databases

    ArrayExpressiQ9NZH8.
    BgeeiQ9NZH8.
    CleanExiHS_IL1F9.
    GenevestigatoriQ9NZH8.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NZH8.
    SMRiQ9NZH8. Positions 27-153.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the IL-1 family.Curated

    Phylogenomic databases

    eggNOGiNOG39912.
    HOVERGENiHBG052100.
    InParanoidiQ9NZH8.
    KOiK05487.
    OMAiVITCKYP.
    PhylomeDBiQ9NZH8.
    TreeFamiTF300203.

    Family and domain databases

    InterProiIPR008996. Cytokine_IL1-like.
    IPR000975. IL-1_fam.
    IPR003297. IL-1RA/IL-36.
    IPR027163. IL-36_alpha/gamma.
    [Graphical view]
    PANTHERiPTHR10078:SF14. PTHR10078:SF14. 1 hit.
    PfamiPF00340. IL1. 1 hit.
    [Graphical view]
    PRINTSiPR00264. INTERLEUKIN1.
    PR01360. INTRLEUKIN1X.
    SUPFAMiSSF50353. SSF50353. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NZH8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRGTPGDADG GGRAVYQSMC KPITGTINDL NQQVWTLQGQ NLVAVPRSDS    50
    VTPVTVAVIT CKYPEALEQG RGDPIYLGIQ NPEMCLYCEK VGEQPTLQLK 100
    EQKIMDLYGQ PEPVKPFLFY RAKTGRTSTL ESVAFPDWFI ASSKRDQPII 150
    LTSELGKSYN TAFELNIND 169
    Length:169
    Mass (Da):18,721
    Last modified:October 1, 2000 - v1
    Checksum:iF00A9243706F4154
    GO
    Isoform 2 (identifier: Q9NZH8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         19-54: MCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPV → I

    Note: No experimental confirmation available.

    Show »
    Length:134
    Mass (Da):14,928
    Checksum:iD5369C5AD44A9752
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti69 – 691Q → K.
    Corresponds to variant rs6707930 [ dbSNP | Ensembl ].
    VAR_024505

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei19 – 5436MCKPI…SVTPV → I in isoform 2. 1 PublicationVSP_013002Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF200492 mRNA. Translation: AAF69248.1.
    AF206696 mRNA. Translation: AAG35670.1.
    BN000002 Genomic DNA. Translation: CAD29874.1.
    AY359111 mRNA. Translation: AAQ89469.1.
    AY968311 Genomic DNA. Translation: AAX59035.1.
    AC016724 Genomic DNA. Translation: AAY14987.1.
    BC096721 mRNA. Translation: AAH96721.1.
    BC098130 mRNA. Translation: AAH98130.1.
    BC098155 mRNA. Translation: AAH98155.1.
    BC098337 mRNA. Translation: AAH98337.1.
    CCDSiCCDS2108.1. [Q9NZH8-1]
    CCDS62992.1. [Q9NZH8-2]
    RefSeqiNP_001265497.1. NM_001278568.1. [Q9NZH8-2]
    NP_062564.1. NM_019618.3. [Q9NZH8-1]
    UniGeneiHs.211238.

    Genome annotation databases

    EnsembliENST00000259205; ENSP00000259205; ENSG00000136688. [Q9NZH8-1]
    ENST00000376489; ENSP00000365672; ENSG00000136688. [Q9NZH8-2]
    GeneIDi56300.
    KEGGihsa:56300.
    UCSCiuc002tio.1. human. [Q9NZH8-1]
    uc010fkr.1. human. [Q9NZH8-2]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Interleukin-1 entry

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF200492 mRNA. Translation: AAF69248.1 .
    AF206696 mRNA. Translation: AAG35670.1 .
    BN000002 Genomic DNA. Translation: CAD29874.1 .
    AY359111 mRNA. Translation: AAQ89469.1 .
    AY968311 Genomic DNA. Translation: AAX59035.1 .
    AC016724 Genomic DNA. Translation: AAY14987.1 .
    BC096721 mRNA. Translation: AAH96721.1 .
    BC098130 mRNA. Translation: AAH98130.1 .
    BC098155 mRNA. Translation: AAH98155.1 .
    BC098337 mRNA. Translation: AAH98337.1 .
    CCDSi CCDS2108.1. [Q9NZH8-1 ]
    CCDS62992.1. [Q9NZH8-2 ]
    RefSeqi NP_001265497.1. NM_001278568.1. [Q9NZH8-2 ]
    NP_062564.1. NM_019618.3. [Q9NZH8-1 ]
    UniGenei Hs.211238.

    3D structure databases

    ProteinModelPortali Q9NZH8.
    SMRi Q9NZH8. Positions 27-153.
    ModBasei Search...
    MobiDBi Search...

    PTM databases

    PhosphoSitei Q9NZH8.

    Proteomic databases

    PaxDbi Q9NZH8.
    PRIDEi Q9NZH8.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000259205 ; ENSP00000259205 ; ENSG00000136688 . [Q9NZH8-1 ]
    ENST00000376489 ; ENSP00000365672 ; ENSG00000136688 . [Q9NZH8-2 ]
    GeneIDi 56300.
    KEGGi hsa:56300.
    UCSCi uc002tio.1. human. [Q9NZH8-1 ]
    uc010fkr.1. human. [Q9NZH8-2 ]

    Organism-specific databases

    CTDi 56300.
    GeneCardsi GC02P113731.
    HGNCi HGNC:15741. IL36G.
    MIMi 605542. gene.
    neXtProti NX_Q9NZH8.
    PharmGKBi PA38395.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG39912.
    HOVERGENi HBG052100.
    InParanoidi Q9NZH8.
    KOi K05487.
    OMAi VITCKYP.
    PhylomeDBi Q9NZH8.
    TreeFami TF300203.

    Enzyme and pathway databases

    SignaLinki Q9NZH8.

    Miscellaneous databases

    GeneWikii IL1F9.
    GenomeRNAii 56300.
    NextBioi 61963.
    PROi Q9NZH8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NZH8.
    Bgeei Q9NZH8.
    CleanExi HS_IL1F9.
    Genevestigatori Q9NZH8.

    Family and domain databases

    InterProi IPR008996. Cytokine_IL1-like.
    IPR000975. IL-1_fam.
    IPR003297. IL-1RA/IL-36.
    IPR027163. IL-36_alpha/gamma.
    [Graphical view ]
    PANTHERi PTHR10078:SF14. PTHR10078:SF14. 1 hit.
    Pfami PF00340. IL1. 1 hit.
    [Graphical view ]
    PRINTSi PR00264. INTERLEUKIN1.
    PR01360. INTRLEUKIN1X.
    SUPFAMi SSF50353. SSF50353. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification and initial characterization of four novel members of the interleukin-1 family."
      Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N., Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L., Young P.R.
      J. Biol. Chem. 275:10308-10314(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Keratinocyte.
    2. "Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2."
      Debets R., Timans J.C., Homey B., Zurawski S., Sana T.R., Lo S., Wagner J., Edwards G., Clifford T., Menon S., Bazan J.F., Kastelein R.A.
      J. Immunol. 167:1440-1446(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
      Tissue: Epithelium.
    3. "Identification and gene organization of three novel members of the IL-1 family on human chromosome 2."
      Busfield S.J., Comrack C.A., Yu G., Chickering T.W., Smutko J.S., Zhou H., Leiby K.R., Holmgren L.M., Gearing D.P., Pan Y.
      Genomics 66:213-216(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    4. "A sequence-based map of the nine genes of the human interleukin-1 cluster."
      Nicklin M.J.H., Barton J.L., Nguyen M., Fitzgerald M.G., Duff W.G., Kornman K.
      Genomics 79:718-725(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    6. SeattleSNPs variation discovery resource
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
    7. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

    Entry informationi

    Entry nameiIL36G_HUMAN
    AccessioniPrimary (citable) accession number: Q9NZH8
    Secondary accession number(s): Q56B91, Q6UVX7, Q7RTZ9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 8, 2002
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 111 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3