Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NZH8 (IL36G_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 110. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Interleukin-36 gamma
Alternative name(s):
IL-1-related protein 2
Short name=IL-1RP2
Interleukin-1 epsilon
Short name=IL-1 epsilon
Interleukin-1 family member 9
Short name=IL-1F9
Interleukin-1 homolog 1
Short name=IL-1H1
Gene names
Name:IL36G
Synonyms:IL1E, IL1F9, IL1H1, IL1RP2
ORF Names:UNQ2456/PRO5737
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length169 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Function as an agonist of NF-kappa B activation through the orphan IL-1-receptor-related protein 2/IL1RL2. Could constitute part of an independent signaling system analogous to interleukin-1 alpha (IL-1A), beta (IL-1B) receptor agonist and interleukin-1 receptor type I (IL-1R1), that is present in epithelial barriers and takes part in local inflammatory response.

Subcellular location

Secreted.

Tissue specificity

Highly expressed in tissues containing epithelial cells: skin, lung, stomach and esophagus. In skin is expressed only in keratinocytes but not in fibroblasts, endothelial cells or melanocytes. Up-regulated in lesional psoriasis skin.

Induction

By TNF and by IFNG/IFN-gamma in keratinocytes.

Sequence similarities

Belongs to the IL-1 family.

Ontologies

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NZH8-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NZH8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     19-54: MCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPV → I
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 169169Interleukin-36 gamma
PRO_0000153648

Natural variations

Alternative sequence19 – 5436MCKPI…SVTPV → I in isoform 2.
VSP_013002
Natural variant691Q → K.
Corresponds to variant rs6707930 [ dbSNP | Ensembl ].
VAR_024505

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: F00A9243706F4154

FASTA16918,721
        10         20         30         40         50         60 
MRGTPGDADG GGRAVYQSMC KPITGTINDL NQQVWTLQGQ NLVAVPRSDS VTPVTVAVIT 

        70         80         90        100        110        120 
CKYPEALEQG RGDPIYLGIQ NPEMCLYCEK VGEQPTLQLK EQKIMDLYGQ PEPVKPFLFY 

       130        140        150        160 
RAKTGRTSTL ESVAFPDWFI ASSKRDQPII LTSELGKSYN TAFELNIND 

« Hide

Isoform 2 [UniParc].

Checksum: D5369C5AD44A9752
Show »

FASTA13414,928

References

« Hide 'large scale' references
[1]"Identification and initial characterization of four novel members of the interleukin-1 family."
Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N., Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L., Young P.R.
J. Biol. Chem. 275:10308-10314(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Keratinocyte.
[2]"Two novel IL-1 family members, IL-1 delta and IL-1 epsilon, function as an antagonist and agonist of NF-kappa B activation through the orphan IL-1 receptor-related protein 2."
Debets R., Timans J.C., Homey B., Zurawski S., Sana T.R., Lo S., Wagner J., Edwards G., Clifford T., Menon S., Bazan J.F., Kastelein R.A.
J. Immunol. 167:1440-1446(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), CHARACTERIZATION.
Tissue: Epithelium.
[3]"Identification and gene organization of three novel members of the IL-1 family on human chromosome 2."
Busfield S.J., Comrack C.A., Yu G., Chickering T.W., Smutko J.S., Zhou H., Leiby K.R., Holmgren L.M., Gearing D.P., Pan Y.
Genomics 66:213-216(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[4]"A sequence-based map of the nine genes of the human interleukin-1 cluster."
Nicklin M.J.H., Barton J.L., Nguyen M., Fitzgerald M.G., Duff W.G., Kornman K.
Genomics 79:718-725(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[5]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[6]SeattleSNPs variation discovery resource
Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
[7]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
+Additional computationally mapped references.

Web resources

Wikipedia

Interleukin-1 entry

SeattleSNPs

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF200492 mRNA. Translation: AAF69248.1.
AF206696 mRNA. Translation: AAG35670.1.
BN000002 Genomic DNA. Translation: CAD29874.1.
AY359111 mRNA. Translation: AAQ89469.1.
AY968311 Genomic DNA. Translation: AAX59035.1.
AC016724 Genomic DNA. Translation: AAY14987.1.
BC096721 mRNA. Translation: AAH96721.1.
BC098130 mRNA. Translation: AAH98130.1.
BC098155 mRNA. Translation: AAH98155.1.
BC098337 mRNA. Translation: AAH98337.1.
CCDSCCDS2108.1. [Q9NZH8-1]
CCDS62992.1. [Q9NZH8-2]
RefSeqNP_001265497.1. NM_001278568.1. [Q9NZH8-2]
NP_062564.1. NM_019618.3. [Q9NZH8-1]
UniGeneHs.211238.

3D structure databases

ProteinModelPortalQ9NZH8.
SMRQ9NZH8. Positions 27-153.
ModBaseSearch...
MobiDBSearch...

PTM databases

PhosphoSiteQ9NZH8.

Proteomic databases

PaxDbQ9NZH8.
PRIDEQ9NZH8.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000259205; ENSP00000259205; ENSG00000136688. [Q9NZH8-1]
ENST00000376489; ENSP00000365672; ENSG00000136688. [Q9NZH8-2]
GeneID56300.
KEGGhsa:56300.
UCSCuc002tio.1. human. [Q9NZH8-1]
uc010fkr.1. human. [Q9NZH8-2]

Organism-specific databases

CTD56300.
GeneCardsGC02P113731.
HGNCHGNC:15741. IL36G.
MIM605542. gene.
neXtProtNX_Q9NZH8.
PharmGKBPA38395.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG39912.
HOVERGENHBG052100.
InParanoidQ9NZH8.
KOK05487.
OMAVITCKYP.
PhylomeDBQ9NZH8.
TreeFamTF300203.

Enzyme and pathway databases

SignaLinkQ9NZH8.

Gene expression databases

ArrayExpressQ9NZH8.
BgeeQ9NZH8.
CleanExHS_IL1F9.
GenevestigatorQ9NZH8.

Family and domain databases

InterProIPR008996. Cytokine_IL1-like.
IPR000975. IL-1_fam.
IPR003297. IL-1RA/IL-36.
IPR027163. IL-36_alpha/gamma.
[Graphical view]
PANTHERPTHR10078:SF14. PTHR10078:SF14. 1 hit.
PfamPF00340. IL1. 1 hit.
[Graphical view]
PRINTSPR00264. INTERLEUKIN1.
PR01360. INTRLEUKIN1X.
SUPFAMSSF50353. SSF50353. 1 hit.
ProtoNetSearch...

Other

GeneWikiIL1F9.
GenomeRNAi56300.
NextBio61963.
PROQ9NZH8.
SOURCESearch...

Entry information

Entry nameIL36G_HUMAN
AccessionPrimary (citable) accession number: Q9NZH8
Secondary accession number(s): Q56B91, Q6UVX7, Q7RTZ9
Entry history
Integrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM