Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NZH6

- IL37_HUMAN

UniProt

Q9NZH6 - IL37_HUMAN

Protein

Interleukin-37

Gene

IL37

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 122 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.2 Publications

    GO - Molecular functioni

    1. interleukin-1 receptor binding Source: UniProtKB

    GO - Biological processi

    1. immune response Source: UniProtKB
    2. inflammatory response Source: InterPro

    Keywords - Molecular functioni

    Cytokine

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Interleukin-37
    Alternative name(s):
    FIL1 zeta
    IL-1X
    Interleukin-1 family member 7
    Short name:
    IL-1F7
    Interleukin-1 homolog 4
    Short name:
    IL-1H
    Short name:
    IL-1H4
    Interleukin-1 zeta
    Short name:
    IL-1 zeta
    Interleukin-1-related protein
    Short name:
    IL-1RP1
    Interleukin-23
    Short name:
    IL-37
    Gene namesi
    Name:IL37
    Synonyms:FIL1Z, IL1F7, IL1H4, IL1RP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:15563. IL37.

    Subcellular locationi

    Cytoplasmcytosol. Nucleus. Secreted
    Note: Stimulation with IL1B leads to colocalization with SMAD3 mostly in perinuclear regions. Only the CASP1-cleaved mature form translocates into the nucleus upon LPS stimulation.

    GO - Cellular componenti

    1. cytosol Source: UniProtKB-SubCell
    2. extracellular region Source: UniProtKB
    3. extracellular space Source: UniProtKB-KW
    4. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38390.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Propeptidei1 – 4545Removed in mature form1 PublicationPRO_0000015335Add
    BLAST
    Chaini46 – 218173Interleukin-37PRO_0000015336Add
    BLAST

    Post-translational modificationi

    Proteolytically converted to the mature form by CASP1.

    Proteomic databases

    PaxDbiQ9NZH6.
    PRIDEiQ9NZH6.

    Miscellaneous databases

    PMAP-CutDBQ9NZH6.

    Expressioni

    Tissue specificityi

    In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.2 Publications

    Inductioni

    Highly induced by bacterial lipopolysaccharides (LPS) and TGFB1, more moderately by IFNG, IL18, IL1B, TNF and the dinucleotide CpG (at protein level). Constitutive expression in bone marrow macrophages is down-regulated in the presence of IL4 and CSF2. Induced by phorbol myristate acetate (PMA) in different cell lines.2 Publications

    Gene expression databases

    BgeeiQ9NZH6.
    CleanExiHS_IL1F7.
    GenevestigatoriQ9NZH6.

    Organism-specific databases

    HPAiHPA054371.
    HPA057950.

    Interactioni

    Subunit structurei

    Interacts with SMAD3. Binds IL18R1, but not to IL1R1, with lower affinity than IL18, and does not seem to act as a receptor antagonist for IL18.2 Publications

    Protein-protein interaction databases

    BioGridi118054. 4 interactions.
    IntActiQ9NZH6. 1 interaction.
    MINTiMINT-1208512.
    STRINGi9606.ENSP00000263326.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NZH6.
    SMRiQ9NZH6. Positions 60-192.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the IL-1 family.Curated

    Phylogenomic databases

    eggNOGiNOG78218.
    HOVERGENiHBG052101.
    InParanoidiQ9NZH6.
    KOiK05485.
    OMAiISTVLCG.
    OrthoDBiEOG7RRF8N.
    PhylomeDBiQ9NZH6.
    TreeFamiTF300203.

    Family and domain databases

    InterProiIPR008996. Cytokine_IL1-like.
    IPR000975. IL-1_fam.
    IPR003297. IL-1RA/IL-36.
    IPR027169. IL-37.
    [Graphical view]
    PANTHERiPTHR10078:SF9. PTHR10078:SF9. 1 hit.
    PfamiPF00340. IL1. 1 hit.
    [Graphical view]
    PRINTSiPR00264. INTERLEUKIN1.
    PR01360. INTRLEUKIN1X.
    SUPFAMiSSF50353. SSF50353. 1 hit.

    Sequences (5)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform B (identifier: Q9NZH6-1) [UniParc]FASTAAdd to Basket

    Also known as: IL-1F7b, IL-HLa

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSFVGENSGV KMGSEDWEKD EPQCCLEDPA GSPLEPGPSL PTMNFVHTSP    50
    KVKNLNPKKF SIHDQDHKVL VLDSGNLIAV PDKNYIRPEI FFALASSLSS 100
    ASAEKGSPIL LGVSKGEFCL YCDKDKGQSH PSLQLKKEKL MKLAAQKESA 150
    RRPFIFYRAQ VGSWNMLESA AHPGWFICTS CNCNEPVGVT DKFENRKHIE 200
    FSFQPVCKAE MSPSEVSD 218

    Note: The name IL-HL refers to isoform B containing polymorphisms Val-31 and Ala-42.1 Publication

    Length:218
    Mass (Da):24,126
    Last modified:October 1, 2000 - v1
    Checksum:i96E089310D2CEA68
    GO
    Isoform A (identifier: Q9NZH6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-49: MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTS → MSGCDRRETETKGKNSFKKRLRG

    Show »
    Length:192
    Mass (Da):21,543
    Checksum:i4AF584C81802F612
    GO
    Isoform C (identifier: Q9NZH6-3) [UniParc]FASTAAdd to Basket

    Also known as: IL-HS

    The sequence of this isoform differs from the canonical sequence as follows:
         49-89: SPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPE → K

    Show »
    Length:178
    Mass (Da):19,604
    Checksum:iD9BE1DD4858C4932
    GO
    Isoform D (identifier: Q9NZH6-4) [UniParc]FASTAAdd to Basket

    Also known as: IL1F7d

    The sequence of this isoform differs from the canonical sequence as follows:
         28-49: DPAGSPLEPGPSLPTMNFVHTS → G

    Show »
    Length:197
    Mass (Da):21,950
    Checksum:i55BEA6540008B67A
    GO
    Isoform E (identifier: Q9NZH6-5) [UniParc]FASTAAdd to Basket

    Also known as: IL1F7e

    The sequence of this isoform differs from the canonical sequence as follows:
         28-88: Missing.

    Show »
    Length:157
    Mass (Da):17,459
    Checksum:i5EA5EA10CF309086
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti31 – 311G → V.3 Publications
    Corresponds to variant rs3811046 [ dbSNP | Ensembl ].
    VAR_014260
    Natural varianti42 – 421T → A.3 Publications
    Corresponds to variant rs3811047 [ dbSNP | Ensembl ].
    VAR_014261
    Natural varianti50 – 501P → R.
    Corresponds to variant rs2708943 [ dbSNP | Ensembl ].
    VAR_049574
    Natural varianti54 – 541N → S.
    Corresponds to variant rs2723183 [ dbSNP | Ensembl ].
    VAR_049575
    Natural varianti108 – 1081P → L.1 Publication
    Corresponds to variant rs2723187 [ dbSNP | Ensembl ].
    VAR_023334
    Natural varianti152 – 1521R → W.1 Publication
    Corresponds to variant rs28947200 [ dbSNP | Ensembl ].
    VAR_023335
    Natural varianti164 – 1641W → R.1 Publication
    Corresponds to variant rs2708947 [ dbSNP | Ensembl ].
    VAR_023336
    Natural varianti218 – 2181D → N.1 Publication
    Corresponds to variant rs2723192 [ dbSNP | Ensembl ].
    VAR_023337

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4949MSFVG…FVHTS → MSGCDRRETETKGKNSFKKR LRG in isoform A. 1 PublicationVSP_002653Add
    BLAST
    Alternative sequencei28 – 8861Missing in isoform E. 1 PublicationVSP_002655Add
    BLAST
    Alternative sequencei28 – 4922DPAGS…FVHTS → G in isoform D. 2 PublicationsVSP_002654Add
    BLAST
    Alternative sequencei49 – 8941SPKVK…YIRPE → K in isoform C. 1 PublicationVSP_002656Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF200496 mRNA. Translation: AAF69252.1.
    AF167368 mRNA. Translation: AAG29344.1.
    AF251118 mRNA. Translation: AAG14420.1.
    AF251119 mRNA. Translation: AAG14421.1.
    AF251120 mRNA. Translation: AAG14422.1.
    AF201832 mRNA. Translation: AAF25212.1.
    AY071840 mRNA. Translation: AAL67151.1.
    AY071841 mRNA. Translation: AAL67154.1.
    AY973625 Genomic DNA. Translation: AAX59036.1.
    AB451333 mRNA. Translation: BAG70147.1.
    AB451478 mRNA. Translation: BAG70292.1.
    AC079753 Genomic DNA. Translation: AAX88889.1.
    CH471217 Genomic DNA. Translation: EAW73609.1.
    BC020637 mRNA. Translation: AAH20637.1.
    CCDSiCCDS2103.1. [Q9NZH6-1]
    CCDS2104.1. [Q9NZH6-4]
    CCDS2105.1. [Q9NZH6-5]
    CCDS2106.1. [Q9NZH6-3]
    CCDS2107.1. [Q9NZH6-2]
    RefSeqiNP_055254.2. NM_014439.3. [Q9NZH6-1]
    NP_775294.1. NM_173202.1. [Q9NZH6-4]
    NP_775295.1. NM_173203.1. [Q9NZH6-5]
    NP_775296.1. NM_173204.1. [Q9NZH6-3]
    NP_775297.1. NM_173205.1. [Q9NZH6-2]
    UniGeneiHs.166371.

    Genome annotation databases

    EnsembliENST00000263326; ENSP00000263326; ENSG00000125571. [Q9NZH6-1]
    ENST00000311328; ENSP00000309883; ENSG00000125571. [Q9NZH6-2]
    ENST00000349806; ENSP00000263328; ENSG00000125571. [Q9NZH6-5]
    ENST00000352179; ENSP00000263327; ENSG00000125571. [Q9NZH6-4]
    ENST00000353225; ENSP00000309208; ENSG00000125571. [Q9NZH6-3]
    GeneIDi27178.
    KEGGihsa:27178.
    UCSCiuc002tij.3. human. [Q9NZH6-1]
    uc002tik.3. human. [Q9NZH6-4]
    uc002til.3. human. [Q9NZH6-3]
    uc002tim.3. human. [Q9NZH6-5]
    uc002tin.3. human. [Q9NZH6-2]

    Polymorphism databases

    DMDMi25008593.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Web resourcesi

    Wikipedia

    Interleukin-1 entry

    SeattleSNPs

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF200496 mRNA. Translation: AAF69252.1 .
    AF167368 mRNA. Translation: AAG29344.1 .
    AF251118 mRNA. Translation: AAG14420.1 .
    AF251119 mRNA. Translation: AAG14421.1 .
    AF251120 mRNA. Translation: AAG14422.1 .
    AF201832 mRNA. Translation: AAF25212.1 .
    AY071840 mRNA. Translation: AAL67151.1 .
    AY071841 mRNA. Translation: AAL67154.1 .
    AY973625 Genomic DNA. Translation: AAX59036.1 .
    AB451333 mRNA. Translation: BAG70147.1 .
    AB451478 mRNA. Translation: BAG70292.1 .
    AC079753 Genomic DNA. Translation: AAX88889.1 .
    CH471217 Genomic DNA. Translation: EAW73609.1 .
    BC020637 mRNA. Translation: AAH20637.1 .
    CCDSi CCDS2103.1. [Q9NZH6-1 ]
    CCDS2104.1. [Q9NZH6-4 ]
    CCDS2105.1. [Q9NZH6-5 ]
    CCDS2106.1. [Q9NZH6-3 ]
    CCDS2107.1. [Q9NZH6-2 ]
    RefSeqi NP_055254.2. NM_014439.3. [Q9NZH6-1 ]
    NP_775294.1. NM_173202.1. [Q9NZH6-4 ]
    NP_775295.1. NM_173203.1. [Q9NZH6-5 ]
    NP_775296.1. NM_173204.1. [Q9NZH6-3 ]
    NP_775297.1. NM_173205.1. [Q9NZH6-2 ]
    UniGenei Hs.166371.

    3D structure databases

    ProteinModelPortali Q9NZH6.
    SMRi Q9NZH6. Positions 60-192.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 118054. 4 interactions.
    IntActi Q9NZH6. 1 interaction.
    MINTi MINT-1208512.
    STRINGi 9606.ENSP00000263326.

    Polymorphism databases

    DMDMi 25008593.

    Proteomic databases

    PaxDbi Q9NZH6.
    PRIDEi Q9NZH6.

    Protocols and materials databases

    DNASUi 27178.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000263326 ; ENSP00000263326 ; ENSG00000125571 . [Q9NZH6-1 ]
    ENST00000311328 ; ENSP00000309883 ; ENSG00000125571 . [Q9NZH6-2 ]
    ENST00000349806 ; ENSP00000263328 ; ENSG00000125571 . [Q9NZH6-5 ]
    ENST00000352179 ; ENSP00000263327 ; ENSG00000125571 . [Q9NZH6-4 ]
    ENST00000353225 ; ENSP00000309208 ; ENSG00000125571 . [Q9NZH6-3 ]
    GeneIDi 27178.
    KEGGi hsa:27178.
    UCSCi uc002tij.3. human. [Q9NZH6-1 ]
    uc002tik.3. human. [Q9NZH6-4 ]
    uc002til.3. human. [Q9NZH6-3 ]
    uc002tim.3. human. [Q9NZH6-5 ]
    uc002tin.3. human. [Q9NZH6-2 ]

    Organism-specific databases

    CTDi 27178.
    GeneCardsi GC02P113672.
    HGNCi HGNC:15563. IL37.
    HPAi HPA054371.
    HPA057950.
    MIMi 605510. gene.
    neXtProti NX_Q9NZH6.
    PharmGKBi PA38390.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG78218.
    HOVERGENi HBG052101.
    InParanoidi Q9NZH6.
    KOi K05485.
    OMAi ISTVLCG.
    OrthoDBi EOG7RRF8N.
    PhylomeDBi Q9NZH6.
    TreeFami TF300203.

    Miscellaneous databases

    GeneWikii IL1F7.
    GenomeRNAii 27178.
    NextBioi 49992.
    PMAP-CutDB Q9NZH6.
    PROi Q9NZH6.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9NZH6.
    CleanExi HS_IL1F7.
    Genevestigatori Q9NZH6.

    Family and domain databases

    InterProi IPR008996. Cytokine_IL1-like.
    IPR000975. IL-1_fam.
    IPR003297. IL-1RA/IL-36.
    IPR027169. IL-37.
    [Graphical view ]
    PANTHERi PTHR10078:SF9. PTHR10078:SF9. 1 hit.
    Pfami PF00340. IL1. 1 hit.
    [Graphical view ]
    PRINTSi PR00264. INTERLEUKIN1.
    PR01360. INTRLEUKIN1X.
    SUPFAMi SSF50353. SSF50353. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Identification and initial characterization of four novel members of the interleukin-1 family."
      Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N., Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L., Young P.R.
      J. Biol. Chem. 275:10308-10314(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
      Tissue: Fetal B-cell, Fetal colon, Fetal lung and Fetal testis.
    2. Manoj P.P., Mantovani A., Muzio M.
      Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
      Tissue: Colon carcinoma.
    3. "IL-1H, an interleukin 1-related protein that binds IL-18 receptor/IL-1Rrp."
      Pan G., Risser P., Mao W., Baldwin D.T., Zhong A.W., Filvaroff E., Yansura D., Lewis L., Eigenbrot C., Henzel W.J., Vandlen R.
      Cytokine 13:1-7(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B AND C), PROTEIN SEQUENCE OF 46-54, INTERACTION WITH IL18R1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS VAL-31 AND ALA-42.
    4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
    5. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS D AND E).
    6. SeattleSNPs variation discovery resource
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-31; ALA-42; LEU-108; TRP-152; ARG-164 AND ASN-218.
    7. "Human protein factory for converting the transcriptome into an in vitro-expressed proteome."
      Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.
      , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.
      Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D).
    8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), VARIANTS VAL-31 AND ALA-42.
      Tissue: Placenta.
    11. "The IL-1 family member 7b translocates to the nucleus and down-regulates proinflammatory cytokines."
      Sharma S., Kulk N., Nold M.F., Graf R., Kim S.H., Reinhardt D., Dinarello C.A., Bufler P.
      J. Immunol. 180:5477-5482(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, MATURATION BY CASP1, INDUCTION.
    12. Cited for: FUNCTION, INTERACTION WITH SMAD3, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.

    Entry informationi

    Entry nameiIL37_HUMAN
    AccessioniPrimary (citable) accession number: Q9NZH6
    Secondary accession number(s): B5BU97
    , Q56AP9, Q8TD04, Q8TD05, Q9HBF2, Q9HBF3, Q9UHA6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 8, 2002
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 122 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Direct protein sequencing, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3