Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Interleukin-37

Gene

IL37

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.2 Publications

GO - Molecular functioni

  1. cytokine activity Source: GO_Central
  2. interleukin-1 receptor binding Source: UniProtKB

GO - Biological processi

  1. cytokine-mediated signaling pathway Source: GO_Central
  2. immune response Source: UniProtKB
  3. inflammatory response Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Cytokine

Names & Taxonomyi

Protein namesi
Recommended name:
Interleukin-37
Alternative name(s):
FIL1 zeta
IL-1X
Interleukin-1 family member 7
Short name:
IL-1F7
Interleukin-1 homolog 4
Short name:
IL-1H
Short name:
IL-1H4
Interleukin-1 zeta
Short name:
IL-1 zeta
Interleukin-1-related protein
Short name:
IL-1RP1
Interleukin-23
Short name:
IL-37
Gene namesi
Name:IL37
Synonyms:FIL1Z, IL1F7, IL1H4, IL1RP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:15563. IL37.

Subcellular locationi

Cytoplasmcytosol. Nucleus. Secreted
Note: Stimulation with IL1B leads to colocalization with SMAD3 mostly in perinuclear regions. Only the CASP1-cleaved mature form translocates into the nucleus upon LPS stimulation.

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. cytosol Source: UniProtKB-SubCell
  3. extracellular region Source: UniProtKB
  4. extracellular space Source: GO_Central
  5. nucleolus Source: HPA
  6. nucleoplasm Source: HPA
  7. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus, Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38390.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Propeptidei1 – 4545Removed in mature form1 PublicationPRO_0000015335Add
BLAST
Chaini46 – 218173Interleukin-37PRO_0000015336Add
BLAST

Post-translational modificationi

Proteolytically converted to the mature form by CASP1.

Proteomic databases

PaxDbiQ9NZH6.
PRIDEiQ9NZH6.

Miscellaneous databases

PMAP-CutDBQ9NZH6.

Expressioni

Tissue specificityi

In general, low constitutive expression, if any, in healthy tissues; high expression in inflammatory counterparts, including in synovial tissues from individuals with active rheumatoid arthritis. Isoform A, isoform B and isoform C are expressed in testis, colon, placenta, lung and lymph node. Isoform D and isoform E were found only in testis and bone marrow. Whereas only isoform A is found in brain, only isoform B in kidney and only isoform C in heart.2 Publications

Inductioni

Highly induced by bacterial lipopolysaccharides (LPS) and TGFB1, more moderately by IFNG, IL18, IL1B, TNF and the dinucleotide CpG (at protein level). Constitutive expression in bone marrow macrophages is down-regulated in the presence of IL4 and CSF2. Induced by phorbol myristate acetate (PMA) in different cell lines.2 Publications

Gene expression databases

BgeeiQ9NZH6.
CleanExiHS_IL1F7.
GenevestigatoriQ9NZH6.

Organism-specific databases

HPAiHPA054371.
HPA057950.

Interactioni

Subunit structurei

Interacts with SMAD3. Binds IL18R1, but not to IL1R1, with lower affinity than IL18, and does not seem to act as a receptor antagonist for IL18.2 Publications

Protein-protein interaction databases

BioGridi118054. 6 interactions.
IntActiQ9NZH6. 1 interaction.
MINTiMINT-1208512.
STRINGi9606.ENSP00000263326.

Structurei

3D structure databases

ProteinModelPortaliQ9NZH6.
SMRiQ9NZH6. Positions 60-192.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the IL-1 family.Curated

Phylogenomic databases

eggNOGiNOG78218.
GeneTreeiENSGT00530000062899.
HOVERGENiHBG052101.
InParanoidiQ9NZH6.
KOiK05485.
OMAiRKHTEFS.
OrthoDBiEOG7RRF8N.
PhylomeDBiQ9NZH6.
TreeFamiTF300203.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR000975. IL-1_fam.
IPR003297. IL-1RA/IL-36.
IPR027169. IL-37.
[Graphical view]
PANTHERiPTHR10078:SF9. PTHR10078:SF9. 1 hit.
PfamiPF00340. IL1. 1 hit.
[Graphical view]
PRINTSiPR00264. INTERLEUKIN1.
PR01360. INTRLEUKIN1X.
SUPFAMiSSF50353. SSF50353. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform B (identifier: Q9NZH6-1) [UniParc]FASTAAdd to basket

Also known as: IL-1F7b, IL-HLa

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSFVGENSGV KMGSEDWEKD EPQCCLEDPA GSPLEPGPSL PTMNFVHTSP
60 70 80 90 100
KVKNLNPKKF SIHDQDHKVL VLDSGNLIAV PDKNYIRPEI FFALASSLSS
110 120 130 140 150
ASAEKGSPIL LGVSKGEFCL YCDKDKGQSH PSLQLKKEKL MKLAAQKESA
160 170 180 190 200
RRPFIFYRAQ VGSWNMLESA AHPGWFICTS CNCNEPVGVT DKFENRKHIE
210
FSFQPVCKAE MSPSEVSD

Note: The name IL-HL refers to isoform B containing polymorphisms Val-31 and Ala-42.1 Publication

Length:218
Mass (Da):24,126
Last modified:October 1, 2000 - v1
Checksum:i96E089310D2CEA68
GO
Isoform A (identifier: Q9NZH6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-49: MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTS → MSGCDRRETETKGKNSFKKRLRG

Show »
Length:192
Mass (Da):21,543
Checksum:i4AF584C81802F612
GO
Isoform C (identifier: Q9NZH6-3) [UniParc]FASTAAdd to basket

Also known as: IL-HS

The sequence of this isoform differs from the canonical sequence as follows:
     49-89: SPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPE → K

Show »
Length:178
Mass (Da):19,604
Checksum:iD9BE1DD4858C4932
GO
Isoform D (identifier: Q9NZH6-4) [UniParc]FASTAAdd to basket

Also known as: IL1F7d

The sequence of this isoform differs from the canonical sequence as follows:
     28-49: DPAGSPLEPGPSLPTMNFVHTS → G

Show »
Length:197
Mass (Da):21,950
Checksum:i55BEA6540008B67A
GO
Isoform E (identifier: Q9NZH6-5) [UniParc]FASTAAdd to basket

Also known as: IL1F7e

The sequence of this isoform differs from the canonical sequence as follows:
     28-88: Missing.

Show »
Length:157
Mass (Da):17,459
Checksum:i5EA5EA10CF309086
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti31 – 311G → V.3 Publications
Corresponds to variant rs3811046 [ dbSNP | Ensembl ].
VAR_014260
Natural varianti42 – 421T → A.3 Publications
Corresponds to variant rs3811047 [ dbSNP | Ensembl ].
VAR_014261
Natural varianti50 – 501P → R.
Corresponds to variant rs2708943 [ dbSNP | Ensembl ].
VAR_049574
Natural varianti54 – 541N → S.
Corresponds to variant rs2723183 [ dbSNP | Ensembl ].
VAR_049575
Natural varianti108 – 1081P → L.1 Publication
Corresponds to variant rs2723187 [ dbSNP | Ensembl ].
VAR_023334
Natural varianti152 – 1521R → W.1 Publication
Corresponds to variant rs28947200 [ dbSNP | Ensembl ].
VAR_023335
Natural varianti164 – 1641W → R.1 Publication
Corresponds to variant rs2708947 [ dbSNP | Ensembl ].
VAR_023336
Natural varianti218 – 2181D → N.1 Publication
Corresponds to variant rs2723192 [ dbSNP | Ensembl ].
VAR_023337

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4949MSFVG…FVHTS → MSGCDRRETETKGKNSFKKR LRG in isoform A. 1 PublicationVSP_002653Add
BLAST
Alternative sequencei28 – 8861Missing in isoform E. 1 PublicationVSP_002655Add
BLAST
Alternative sequencei28 – 4922DPAGS…FVHTS → G in isoform D. 2 PublicationsVSP_002654Add
BLAST
Alternative sequencei49 – 8941SPKVK…YIRPE → K in isoform C. 1 PublicationVSP_002656Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF200496 mRNA. Translation: AAF69252.1.
AF167368 mRNA. Translation: AAG29344.1.
AF251118 mRNA. Translation: AAG14420.1.
AF251119 mRNA. Translation: AAG14421.1.
AF251120 mRNA. Translation: AAG14422.1.
AF201832 mRNA. Translation: AAF25212.1.
AY071840 mRNA. Translation: AAL67151.1.
AY071841 mRNA. Translation: AAL67154.1.
AY973625 Genomic DNA. Translation: AAX59036.1.
AB451333 mRNA. Translation: BAG70147.1.
AB451478 mRNA. Translation: BAG70292.1.
AC079753 Genomic DNA. Translation: AAX88889.1.
CH471217 Genomic DNA. Translation: EAW73609.1.
BC020637 mRNA. Translation: AAH20637.1.
CCDSiCCDS2103.1. [Q9NZH6-1]
CCDS2104.1. [Q9NZH6-4]
CCDS2105.1. [Q9NZH6-5]
CCDS2106.1. [Q9NZH6-3]
CCDS2107.1. [Q9NZH6-2]
RefSeqiNP_055254.2. NM_014439.3. [Q9NZH6-1]
NP_775294.1. NM_173202.1. [Q9NZH6-4]
NP_775295.1. NM_173203.1. [Q9NZH6-5]
NP_775296.1. NM_173204.1. [Q9NZH6-3]
NP_775297.1. NM_173205.1. [Q9NZH6-2]
UniGeneiHs.166371.

Genome annotation databases

EnsembliENST00000263326; ENSP00000263326; ENSG00000125571. [Q9NZH6-1]
ENST00000311328; ENSP00000309883; ENSG00000125571. [Q9NZH6-2]
ENST00000349806; ENSP00000263328; ENSG00000125571. [Q9NZH6-5]
ENST00000352179; ENSP00000263327; ENSG00000125571. [Q9NZH6-4]
ENST00000353225; ENSP00000309208; ENSG00000125571. [Q9NZH6-3]
GeneIDi27178.
KEGGihsa:27178.
UCSCiuc002tij.3. human. [Q9NZH6-1]
uc002tik.3. human. [Q9NZH6-4]
uc002til.3. human. [Q9NZH6-3]
uc002tim.3. human. [Q9NZH6-5]
uc002tin.3. human. [Q9NZH6-2]

Polymorphism databases

DMDMi25008593.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Wikipedia

Interleukin-1 entry

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF200496 mRNA. Translation: AAF69252.1.
AF167368 mRNA. Translation: AAG29344.1.
AF251118 mRNA. Translation: AAG14420.1.
AF251119 mRNA. Translation: AAG14421.1.
AF251120 mRNA. Translation: AAG14422.1.
AF201832 mRNA. Translation: AAF25212.1.
AY071840 mRNA. Translation: AAL67151.1.
AY071841 mRNA. Translation: AAL67154.1.
AY973625 Genomic DNA. Translation: AAX59036.1.
AB451333 mRNA. Translation: BAG70147.1.
AB451478 mRNA. Translation: BAG70292.1.
AC079753 Genomic DNA. Translation: AAX88889.1.
CH471217 Genomic DNA. Translation: EAW73609.1.
BC020637 mRNA. Translation: AAH20637.1.
CCDSiCCDS2103.1. [Q9NZH6-1]
CCDS2104.1. [Q9NZH6-4]
CCDS2105.1. [Q9NZH6-5]
CCDS2106.1. [Q9NZH6-3]
CCDS2107.1. [Q9NZH6-2]
RefSeqiNP_055254.2. NM_014439.3. [Q9NZH6-1]
NP_775294.1. NM_173202.1. [Q9NZH6-4]
NP_775295.1. NM_173203.1. [Q9NZH6-5]
NP_775296.1. NM_173204.1. [Q9NZH6-3]
NP_775297.1. NM_173205.1. [Q9NZH6-2]
UniGeneiHs.166371.

3D structure databases

ProteinModelPortaliQ9NZH6.
SMRiQ9NZH6. Positions 60-192.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118054. 6 interactions.
IntActiQ9NZH6. 1 interaction.
MINTiMINT-1208512.
STRINGi9606.ENSP00000263326.

Polymorphism databases

DMDMi25008593.

Proteomic databases

PaxDbiQ9NZH6.
PRIDEiQ9NZH6.

Protocols and materials databases

DNASUi27178.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263326; ENSP00000263326; ENSG00000125571. [Q9NZH6-1]
ENST00000311328; ENSP00000309883; ENSG00000125571. [Q9NZH6-2]
ENST00000349806; ENSP00000263328; ENSG00000125571. [Q9NZH6-5]
ENST00000352179; ENSP00000263327; ENSG00000125571. [Q9NZH6-4]
ENST00000353225; ENSP00000309208; ENSG00000125571. [Q9NZH6-3]
GeneIDi27178.
KEGGihsa:27178.
UCSCiuc002tij.3. human. [Q9NZH6-1]
uc002tik.3. human. [Q9NZH6-4]
uc002til.3. human. [Q9NZH6-3]
uc002tim.3. human. [Q9NZH6-5]
uc002tin.3. human. [Q9NZH6-2]

Organism-specific databases

CTDi27178.
GeneCardsiGC02P113672.
HGNCiHGNC:15563. IL37.
HPAiHPA054371.
HPA057950.
MIMi605510. gene.
neXtProtiNX_Q9NZH6.
PharmGKBiPA38390.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG78218.
GeneTreeiENSGT00530000062899.
HOVERGENiHBG052101.
InParanoidiQ9NZH6.
KOiK05485.
OMAiRKHTEFS.
OrthoDBiEOG7RRF8N.
PhylomeDBiQ9NZH6.
TreeFamiTF300203.

Miscellaneous databases

GeneWikiiIL1F7.
GenomeRNAii27178.
NextBioi49992.
PMAP-CutDBQ9NZH6.
PROiQ9NZH6.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NZH6.
CleanExiHS_IL1F7.
GenevestigatoriQ9NZH6.

Family and domain databases

InterProiIPR008996. Cytokine_IL1-like.
IPR000975. IL-1_fam.
IPR003297. IL-1RA/IL-36.
IPR027169. IL-37.
[Graphical view]
PANTHERiPTHR10078:SF9. PTHR10078:SF9. 1 hit.
PfamiPF00340. IL1. 1 hit.
[Graphical view]
PRINTSiPR00264. INTERLEUKIN1.
PR01360. INTRLEUKIN1X.
SUPFAMiSSF50353. SSF50353. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification and initial characterization of four novel members of the interleukin-1 family."
    Kumar S., McDonnell P.C., Lehr R., Tierney L., Tzimas M.N., Griswold D.E., Capper E.A., Tal-Singer R., Wells G.I., Doyle M.L., Young P.R.
    J. Biol. Chem. 275:10308-10314(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
    Tissue: Fetal B-cell, Fetal colon, Fetal lung and Fetal testis.
  2. Manoj P.P., Mantovani A., Muzio M.
    Submitted (JUL-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM B).
    Tissue: Colon carcinoma.
  3. "IL-1H, an interleukin 1-related protein that binds IL-18 receptor/IL-1Rrp."
    Pan G., Risser P., Mao W., Baldwin D.T., Zhong A.W., Filvaroff E., Yansura D., Lewis L., Eigenbrot C., Henzel W.J., Vandlen R.
    Cytokine 13:1-7(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS B AND C), PROTEIN SEQUENCE OF 46-54, INTERACTION WITH IL18R1, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANTS VAL-31 AND ALA-42.
  4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A).
  5. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS D AND E).
  6. SeattleSNPs variation discovery resource
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS VAL-31; ALA-42; LEU-108; TRP-152; ARG-164 AND ASN-218.
  7. "Human protein factory for converting the transcriptome into an in vitro-expressed proteome."
    Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B.
    , Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.
    Nat. Methods 5:1011-1017(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM D).
  8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), VARIANTS VAL-31 AND ALA-42.
    Tissue: Placenta.
  11. "The IL-1 family member 7b translocates to the nucleus and down-regulates proinflammatory cytokines."
    Sharma S., Kulk N., Nold M.F., Graf R., Kim S.H., Reinhardt D., Dinarello C.A., Bufler P.
    J. Immunol. 180:5477-5482(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, MATURATION BY CASP1, INDUCTION.
  12. Cited for: FUNCTION, INTERACTION WITH SMAD3, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION.

Entry informationi

Entry nameiIL37_HUMAN
AccessioniPrimary (citable) accession number: Q9NZH6
Secondary accession number(s): B5BU97
, Q56AP9, Q8TD04, Q8TD05, Q9HBF2, Q9HBF3, Q9UHA6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 8, 2002
Last sequence update: October 1, 2000
Last modified: February 4, 2015
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.