Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NZD1 (GPC5D_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
G-protein coupled receptor family C group 5 member D
Gene names
Name:GPRC5D
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length345 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Cell membrane; Multi-pass membrane protein Ref.1.

Tissue specificity

Widely expressed in the peripheral system. Expression pattern is high in pancreas, medium in kidney, small intestine, spleen and testis, low in lung, colon, leukocyte, prostate and thymus and not detectable in brain, heart, liver, placenta, skeletal muscle and ovary. Ref.1

Sequence similarities

Belongs to the G-protein coupled receptor 3 family.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NZD1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NZD1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     299-300: AR → DC
     301-345: Missing.
Isoform 3 (identifier: Q9NZD1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     299-345: ARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV → GTFLGDSGSREVLLQEKQEKNHAVG

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 345345G-protein coupled receptor family C group 5 member D
PRO_0000206897

Regions

Topological domain1 – 2727Extracellular Potential
Transmembrane28 – 4821Helical; Name=1; Potential
Topological domain49 – 6315Cytoplasmic Potential
Transmembrane64 – 8421Helical; Name=2; Potential
Topological domain85 – 939Extracellular Potential
Transmembrane94 – 11421Helical; Name=3; Potential
Topological domain115 – 1239Cytoplasmic Potential
Transmembrane124 – 14421Helical; Name=4; Potential
Topological domain145 – 16723Extracellular Potential
Transmembrane168 – 18821Helical; Name=5; Potential
Topological domain189 – 20416Cytoplasmic Potential
Transmembrane205 – 22521Helical; Name=6; Potential
Topological domain226 – 23914Extracellular Potential
Transmembrane240 – 26021Helical; Name=7; Potential
Topological domain261 – 34585Cytoplasmic Potential

Natural variations

Alternative sequence299 – 34547ARDSD…DAGGV → GTFLGDSGSREVLLQEKQEK NHAVG in isoform 3.
VSP_010008
Alternative sequence299 – 3002AR → DC in isoform 2.
VSP_010006
Alternative sequence301 – 34545Missing in isoform 2.
VSP_010007
Natural variant181A → D.
Corresponds to variant rs3741822 [ dbSNP | Ensembl ].
VAR_018297

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 14B09E4C5E9F9B49

FASTA34538,791
        10         20         30         40         50         60 
MYKDCIESTG DYFLLCDAEG PWGIILESLA ILGIVVTILL LLAFLFLMRK IQDCSQWNVL 

        70         80         90        100        110        120 
PTQLLFLLSV LGLFGLAFAF IIELNQQTAP VRYFLFGVLF ALCFSCLLAH ASNLVKLVRG 

       130        140        150        160        170        180 
CVSFSWTTIL CIAIGCSLLQ IIIATEYVTL IMTRGMMFVN MTPCQLNVDF VVLLVYVLFL 

       190        200        210        220        230        240 
MALTFFVSKA TFCGPCENWK QHGRLIFITV LFSIIIWVVW ISMLLRGNPQ FQRQPQWDDP 

       250        260        270        280        290        300 
VVCIALVTNA WVFLLLYIVP ELCILYRSCR QECPLQGNAC PVTAYQHSFQ VENQELSRAR 

       310        320        330        340 
DSDGAEEDVA LTSYGTPIQP QTVDPTQECF IPQAKLSPQQ DAGGV 

« Hide

Isoform 2 [UniParc].

Checksum: DC99870AB178A061
Show »

FASTA30034,095
Isoform 3 [UniParc].

Checksum: FEF5CB0A1066B28E
Show »

FASTA32336,559

References

« Hide 'large scale' references
[1]"Cloning and characterization of a human orphan family C G-protein coupled receptor GPRC5D."
Braeuner-Osborne H., Jensen A.A., Sheppard P.O., Brodin B., Krogsgaard-Larsen P., O'Hara P.
Biochim. Biophys. Acta 1518:237-248(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.
Tissue: Testis.
[2]"Characterization of GPRC5D, a member of RAIG family in hard keratinized structures."
Inoue S., Nanbu T., Shimomura T.
Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
Tissue: Skin.
[3]"Identification of G protein-coupled receptor genes from the human genome sequence."
Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S.
FEBS Lett. 520:97-101(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 3).
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF209923 mRNA. Translation: AAF72873.1.
AB099817 mRNA. Translation: BAC79169.1.
AB083629 Genomic DNA. Translation: BAB89342.1.
BC069341 mRNA. Translation: AAH69341.1.
BC107077 mRNA. Translation: AAI07078.1.
BC107078 mRNA. Translation: AAI07079.1.
CCDSCCDS8658.1. [Q9NZD1-1]
RefSeqNP_061124.1. NM_018654.1. [Q9NZD1-1]
XP_005253478.1. XM_005253421.1. [Q9NZD1-1]
UniGeneHs.644599.

3D structure databases

ProteinModelPortalQ9NZD1.
ModBaseSearch...
MobiDBSearch...

Protein family/group databases

GPCRDBSearch...

PTM databases

PhosphoSiteQ9NZD1.

Polymorphism databases

DMDM46396015.

Proteomic databases

PaxDbQ9NZD1.
PRIDEQ9NZD1.

Protocols and materials databases

DNASU55507.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000228887; ENSP00000228887; ENSG00000111291. [Q9NZD1-1]
ENST00000396333; ENSP00000379624; ENSG00000111291. [Q9NZD1-2]
GeneID55507.
KEGGhsa:55507.
UCSCuc010shp.2. human. [Q9NZD1-1]

Organism-specific databases

CTD55507.
GeneCardsGC12M013093.
HGNCHGNC:13310. GPRC5D.
MIM607437. gene.
neXtProtNX_Q9NZD1.
PharmGKBPA28940.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG44023.
HOGENOMHOG000116197.
HOVERGENHBG049967.
InParanoidQ9NZD1.
KOK04621.
OMALVTNAWV.
OrthoDBEOG7RRF79.
PhylomeDBQ9NZD1.
TreeFamTF321410.

Gene expression databases

ArrayExpressQ9NZD1.
BgeeQ9NZD1.
CleanExHS_GPRC5D.
GenevestigatorQ9NZD1.

Family and domain databases

InterProIPR017978. GPCR_3_C.
[Graphical view]
PfamPF00003. 7tm_3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiGPRC5D.
GenomeRNAi55507.
NextBio59907.
PROQ9NZD1.
SOURCESearch...

Entry information

Entry nameGPC5D_HUMAN
AccessionPrimary (citable) accession number: Q9NZD1
Secondary accession number(s): Q3KNV3, Q7Z5J9, Q8TDS6
Entry history
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM

7-transmembrane G-linked receptors

List of 7-transmembrane G-linked receptor entries