Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

G-protein coupled receptor family C group 5 member D

Gene

GPRC5D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

BioCyciZFISH:ENSG00000111291-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
G-protein coupled receptor family C group 5 member D
Gene namesi
Name:GPRC5D
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:13310. GPRC5D.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 27ExtracellularSequence analysisAdd BLAST27
Transmembranei28 – 48Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini49 – 63CytoplasmicSequence analysisAdd BLAST15
Transmembranei64 – 84Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini85 – 93ExtracellularSequence analysis9
Transmembranei94 – 114Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini115 – 123CytoplasmicSequence analysis9
Transmembranei124 – 144Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini145 – 167ExtracellularSequence analysisAdd BLAST23
Transmembranei168 – 188Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini189 – 204CytoplasmicSequence analysisAdd BLAST16
Transmembranei205 – 225Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini226 – 239ExtracellularSequence analysisAdd BLAST14
Transmembranei240 – 260Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini261 – 345CytoplasmicSequence analysisAdd BLAST85

GO - Cellular componenti

  • integral component of membrane Source: UniProtKB-KW
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi55507.
OpenTargetsiENSG00000111291.
PharmGKBiPA28940.

Polymorphism and mutation databases

BioMutaiGPRC5D.
DMDMi46396015.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002068971 – 345G-protein coupled receptor family C group 5 member DAdd BLAST345

Proteomic databases

PaxDbiQ9NZD1.
PeptideAtlasiQ9NZD1.
PRIDEiQ9NZD1.

PTM databases

iPTMnetiQ9NZD1.
PhosphoSitePlusiQ9NZD1.

Expressioni

Tissue specificityi

Widely expressed in the peripheral system. Expression pattern is high in pancreas, medium in kidney, small intestine, spleen and testis, low in lung, colon, leukocyte, prostate and thymus and not detectable in brain, heart, liver, placenta, skeletal muscle and ovary.1 Publication

Gene expression databases

BgeeiENSG00000111291.
CleanExiHS_GPRC5D.
ExpressionAtlasiQ9NZD1. baseline and differential.
GenevisibleiQ9NZD1. HS.

Organism-specific databases

HPAiHPA071909.

Interactioni

Protein-protein interaction databases

BioGridi120687. 2 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ9NZD1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IK8H. Eukaryota.
ENOG411157H. LUCA.
GeneTreeiENSGT00520000055551.
HOGENOMiHOG000116197.
HOVERGENiHBG049967.
InParanoidiQ9NZD1.
KOiK04621.
OMAiLVTNAWV.
OrthoDBiEOG091G0DAG.
PhylomeDBiQ9NZD1.
TreeFamiTF321410.

Family and domain databases

InterProiIPR017978. GPCR_3_C.
[Graphical view]
PfamiPF00003. 7tm_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NZD1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MYKDCIESTG DYFLLCDAEG PWGIILESLA ILGIVVTILL LLAFLFLMRK
60 70 80 90 100
IQDCSQWNVL PTQLLFLLSV LGLFGLAFAF IIELNQQTAP VRYFLFGVLF
110 120 130 140 150
ALCFSCLLAH ASNLVKLVRG CVSFSWTTIL CIAIGCSLLQ IIIATEYVTL
160 170 180 190 200
IMTRGMMFVN MTPCQLNVDF VVLLVYVLFL MALTFFVSKA TFCGPCENWK
210 220 230 240 250
QHGRLIFITV LFSIIIWVVW ISMLLRGNPQ FQRQPQWDDP VVCIALVTNA
260 270 280 290 300
WVFLLLYIVP ELCILYRSCR QECPLQGNAC PVTAYQHSFQ VENQELSRAR
310 320 330 340
DSDGAEEDVA LTSYGTPIQP QTVDPTQECF IPQAKLSPQQ DAGGV
Length:345
Mass (Da):38,791
Last modified:October 1, 2000 - v1
Checksum:i14B09E4C5E9F9B49
GO
Isoform 2 (identifier: Q9NZD1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     299-300: AR → DC
     301-345: Missing.

Show »
Length:300
Mass (Da):34,095
Checksum:iDC99870AB178A061
GO
Isoform 3 (identifier: Q9NZD1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     299-345: ARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV → GTFLGDSGSREVLLQEKQEKNHAVG

Show »
Length:323
Mass (Da):36,559
Checksum:iFEF5CB0A1066B28E
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_01829718A → D.Corresponds to variant rs3741822dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_010008299 – 345ARDSD…DAGGV → GTFLGDSGSREVLLQEKQEK NHAVG in isoform 3. CuratedAdd BLAST47
Alternative sequenceiVSP_010006299 – 300AR → DC in isoform 2. 1 Publication2
Alternative sequenceiVSP_010007301 – 345Missing in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF209923 mRNA. Translation: AAF72873.1.
AB099817 mRNA. Translation: BAC79169.1.
AB083629 Genomic DNA. Translation: BAB89342.1.
BC069341 mRNA. Translation: AAH69341.1.
BC107077 mRNA. Translation: AAI07078.1.
BC107078 mRNA. Translation: AAI07079.1.
CCDSiCCDS8658.1. [Q9NZD1-1]
RefSeqiNP_061124.1. NM_018654.1. [Q9NZD1-1]
XP_005253478.1. XM_005253421.3. [Q9NZD1-1]
XP_016875071.1. XM_017019582.1. [Q9NZD1-1]
XP_016875072.1. XM_017019583.1. [Q9NZD1-2]
UniGeneiHs.644599.

Genome annotation databases

EnsembliENST00000228887; ENSP00000228887; ENSG00000111291. [Q9NZD1-1]
ENST00000396333; ENSP00000379624; ENSG00000111291. [Q9NZD1-2]
GeneIDi55507.
KEGGihsa:55507.
UCSCiuc010shp.2. human. [Q9NZD1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF209923 mRNA. Translation: AAF72873.1.
AB099817 mRNA. Translation: BAC79169.1.
AB083629 Genomic DNA. Translation: BAB89342.1.
BC069341 mRNA. Translation: AAH69341.1.
BC107077 mRNA. Translation: AAI07078.1.
BC107078 mRNA. Translation: AAI07079.1.
CCDSiCCDS8658.1. [Q9NZD1-1]
RefSeqiNP_061124.1. NM_018654.1. [Q9NZD1-1]
XP_005253478.1. XM_005253421.3. [Q9NZD1-1]
XP_016875071.1. XM_017019582.1. [Q9NZD1-1]
XP_016875072.1. XM_017019583.1. [Q9NZD1-2]
UniGeneiHs.644599.

3D structure databases

ProteinModelPortaliQ9NZD1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120687. 2 interactors.

Protein family/group databases

GPCRDBiSearch...

PTM databases

iPTMnetiQ9NZD1.
PhosphoSitePlusiQ9NZD1.

Polymorphism and mutation databases

BioMutaiGPRC5D.
DMDMi46396015.

Proteomic databases

PaxDbiQ9NZD1.
PeptideAtlasiQ9NZD1.
PRIDEiQ9NZD1.

Protocols and materials databases

DNASUi55507.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000228887; ENSP00000228887; ENSG00000111291. [Q9NZD1-1]
ENST00000396333; ENSP00000379624; ENSG00000111291. [Q9NZD1-2]
GeneIDi55507.
KEGGihsa:55507.
UCSCiuc010shp.2. human. [Q9NZD1-1]

Organism-specific databases

CTDi55507.
DisGeNETi55507.
GeneCardsiGPRC5D.
HGNCiHGNC:13310. GPRC5D.
HPAiHPA071909.
MIMi607437. gene.
neXtProtiNX_Q9NZD1.
OpenTargetsiENSG00000111291.
PharmGKBiPA28940.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IK8H. Eukaryota.
ENOG411157H. LUCA.
GeneTreeiENSGT00520000055551.
HOGENOMiHOG000116197.
HOVERGENiHBG049967.
InParanoidiQ9NZD1.
KOiK04621.
OMAiLVTNAWV.
OrthoDBiEOG091G0DAG.
PhylomeDBiQ9NZD1.
TreeFamiTF321410.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000111291-MONOMER.

Miscellaneous databases

GeneWikiiGPRC5D.
GenomeRNAii55507.
PROiQ9NZD1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111291.
CleanExiHS_GPRC5D.
ExpressionAtlasiQ9NZD1. baseline and differential.
GenevisibleiQ9NZD1. HS.

Family and domain databases

InterProiIPR017978. GPCR_3_C.
[Graphical view]
PfamiPF00003. 7tm_3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGPC5D_HUMAN
AccessioniPrimary (citable) accession number: Q9NZD1
Secondary accession number(s): Q3KNV3, Q7Z5J9, Q8TDS6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: October 1, 2000
Last modified: November 2, 2016
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.