SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NZD1

- GPC5D_HUMAN

UniProt

Q9NZD1 - GPC5D_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
G-protein coupled receptor family C group 5 member D
Gene
GPRC5D
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. G-protein coupled receptor activity Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

G-protein coupled receptor, Receptor, Transducer

Names & Taxonomyi

Protein namesi
Recommended name:
G-protein coupled receptor family C group 5 member D
Gene namesi
Name:GPRC5D
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:13310. GPRC5D.

Subcellular locationi

Cell membrane; Multi-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2727Extracellular Reviewed prediction
Add
BLAST
Transmembranei28 – 4821Helical; Name=1; Reviewed prediction
Add
BLAST
Topological domaini49 – 6315Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei64 – 8421Helical; Name=2; Reviewed prediction
Add
BLAST
Topological domaini85 – 939Extracellular Reviewed prediction
Transmembranei94 – 11421Helical; Name=3; Reviewed prediction
Add
BLAST
Topological domaini115 – 1239Cytoplasmic Reviewed prediction
Transmembranei124 – 14421Helical; Name=4; Reviewed prediction
Add
BLAST
Topological domaini145 – 16723Extracellular Reviewed prediction
Add
BLAST
Transmembranei168 – 18821Helical; Name=5; Reviewed prediction
Add
BLAST
Topological domaini189 – 20416Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei205 – 22521Helical; Name=6; Reviewed prediction
Add
BLAST
Topological domaini226 – 23914Extracellular Reviewed prediction
Add
BLAST
Transmembranei240 – 26021Helical; Name=7; Reviewed prediction
Add
BLAST
Topological domaini261 – 34585Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA28940.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 345345G-protein coupled receptor family C group 5 member D
PRO_0000206897Add
BLAST

Proteomic databases

PaxDbiQ9NZD1.
PRIDEiQ9NZD1.

PTM databases

PhosphoSiteiQ9NZD1.

Expressioni

Tissue specificityi

Widely expressed in the peripheral system. Expression pattern is high in pancreas, medium in kidney, small intestine, spleen and testis, low in lung, colon, leukocyte, prostate and thymus and not detectable in brain, heart, liver, placenta, skeletal muscle and ovary.1 Publication

Gene expression databases

ArrayExpressiQ9NZD1.
BgeeiQ9NZD1.
CleanExiHS_GPRC5D.
GenevestigatoriQ9NZD1.

Structurei

3D structure databases

ProteinModelPortaliQ9NZD1.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG44023.
HOGENOMiHOG000116197.
HOVERGENiHBG049967.
InParanoidiQ9NZD1.
KOiK04621.
OMAiLVTNAWV.
OrthoDBiEOG7RRF79.
PhylomeDBiQ9NZD1.
TreeFamiTF321410.

Family and domain databases

InterProiIPR017978. GPCR_3_C.
[Graphical view]
PfamiPF00003. 7tm_3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NZD1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MYKDCIESTG DYFLLCDAEG PWGIILESLA ILGIVVTILL LLAFLFLMRK    50
IQDCSQWNVL PTQLLFLLSV LGLFGLAFAF IIELNQQTAP VRYFLFGVLF 100
ALCFSCLLAH ASNLVKLVRG CVSFSWTTIL CIAIGCSLLQ IIIATEYVTL 150
IMTRGMMFVN MTPCQLNVDF VVLLVYVLFL MALTFFVSKA TFCGPCENWK 200
QHGRLIFITV LFSIIIWVVW ISMLLRGNPQ FQRQPQWDDP VVCIALVTNA 250
WVFLLLYIVP ELCILYRSCR QECPLQGNAC PVTAYQHSFQ VENQELSRAR 300
DSDGAEEDVA LTSYGTPIQP QTVDPTQECF IPQAKLSPQQ DAGGV 345
Length:345
Mass (Da):38,791
Last modified:October 1, 2000 - v1
Checksum:i14B09E4C5E9F9B49
GO
Isoform 2 (identifier: Q9NZD1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     299-300: AR → DC
     301-345: Missing.

Show »
Length:300
Mass (Da):34,095
Checksum:iDC99870AB178A061
GO
Isoform 3 (identifier: Q9NZD1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     299-345: ARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV → GTFLGDSGSREVLLQEKQEKNHAVG

Show »
Length:323
Mass (Da):36,559
Checksum:iFEF5CB0A1066B28E
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti18 – 181A → D.
Corresponds to variant rs3741822 [ dbSNP | Ensembl ].
VAR_018297

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei299 – 34547ARDSD…DAGGV → GTFLGDSGSREVLLQEKQEK NHAVG in isoform 3.
VSP_010008Add
BLAST
Alternative sequencei299 – 3002AR → DC in isoform 2.
VSP_010006
Alternative sequencei301 – 34545Missing in isoform 2.
VSP_010007Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF209923 mRNA. Translation: AAF72873.1.
AB099817 mRNA. Translation: BAC79169.1.
AB083629 Genomic DNA. Translation: BAB89342.1.
BC069341 mRNA. Translation: AAH69341.1.
BC107077 mRNA. Translation: AAI07078.1.
BC107078 mRNA. Translation: AAI07079.1.
CCDSiCCDS8658.1. [Q9NZD1-1]
RefSeqiNP_061124.1. NM_018654.1. [Q9NZD1-1]
XP_005253478.1. XM_005253421.1. [Q9NZD1-1]
UniGeneiHs.644599.

Genome annotation databases

EnsembliENST00000228887; ENSP00000228887; ENSG00000111291. [Q9NZD1-1]
ENST00000396333; ENSP00000379624; ENSG00000111291. [Q9NZD1-2]
GeneIDi55507.
KEGGihsa:55507.
UCSCiuc010shp.2. human. [Q9NZD1-1]

Polymorphism databases

DMDMi46396015.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF209923 mRNA. Translation: AAF72873.1 .
AB099817 mRNA. Translation: BAC79169.1 .
AB083629 Genomic DNA. Translation: BAB89342.1 .
BC069341 mRNA. Translation: AAH69341.1 .
BC107077 mRNA. Translation: AAI07078.1 .
BC107078 mRNA. Translation: AAI07079.1 .
CCDSi CCDS8658.1. [Q9NZD1-1 ]
RefSeqi NP_061124.1. NM_018654.1. [Q9NZD1-1 ]
XP_005253478.1. XM_005253421.1. [Q9NZD1-1 ]
UniGenei Hs.644599.

3D structure databases

ProteinModelPortali Q9NZD1.
ModBasei Search...
MobiDBi Search...

Protein family/group databases

GPCRDBi Search...

PTM databases

PhosphoSitei Q9NZD1.

Polymorphism databases

DMDMi 46396015.

Proteomic databases

PaxDbi Q9NZD1.
PRIDEi Q9NZD1.

Protocols and materials databases

DNASUi 55507.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000228887 ; ENSP00000228887 ; ENSG00000111291 . [Q9NZD1-1 ]
ENST00000396333 ; ENSP00000379624 ; ENSG00000111291 . [Q9NZD1-2 ]
GeneIDi 55507.
KEGGi hsa:55507.
UCSCi uc010shp.2. human. [Q9NZD1-1 ]

Organism-specific databases

CTDi 55507.
GeneCardsi GC12M013093.
HGNCi HGNC:13310. GPRC5D.
MIMi 607437. gene.
neXtProti NX_Q9NZD1.
PharmGKBi PA28940.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG44023.
HOGENOMi HOG000116197.
HOVERGENi HBG049967.
InParanoidi Q9NZD1.
KOi K04621.
OMAi LVTNAWV.
OrthoDBi EOG7RRF79.
PhylomeDBi Q9NZD1.
TreeFami TF321410.

Miscellaneous databases

GeneWikii GPRC5D.
GenomeRNAii 55507.
NextBioi 59907.
PROi Q9NZD1.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9NZD1.
Bgeei Q9NZD1.
CleanExi HS_GPRC5D.
Genevestigatori Q9NZD1.

Family and domain databases

InterProi IPR017978. GPCR_3_C.
[Graphical view ]
Pfami PF00003. 7tm_3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a human orphan family C G-protein coupled receptor GPRC5D."
    Braeuner-Osborne H., Jensen A.A., Sheppard P.O., Brodin B., Krogsgaard-Larsen P., O'Hara P.
    Biochim. Biophys. Acta 1518:237-248(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.
    Tissue: Testis.
  2. "Characterization of GPRC5D, a member of RAIG family in hard keratinized structures."
    Inoue S., Nanbu T., Shimomura T.
    Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: Skin.
  3. "Identification of G protein-coupled receptor genes from the human genome sequence."
    Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S.
    FEBS Lett. 520:97-101(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 3).
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

Entry informationi

Entry nameiGPC5D_HUMAN
AccessioniPrimary (citable) accession number: Q9NZD1
Secondary accession number(s): Q3KNV3, Q7Z5J9, Q8TDS6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 13, 2004
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 96 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi