Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NZD1

- GPC5D_HUMAN

UniProt

Q9NZD1 - GPC5D_HUMAN

Protein

G-protein coupled receptor family C group 5 member D

Gene

GPRC5D

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 97 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. G-protein coupled receptor activity Source: UniProtKB-KW

    Keywords - Molecular functioni

    G-protein coupled receptor, Receptor, Transducer

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    G-protein coupled receptor family C group 5 member D
    Gene namesi
    Name:GPRC5D
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:13310. GPRC5D.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA28940.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 345345G-protein coupled receptor family C group 5 member DPRO_0000206897Add
    BLAST

    Proteomic databases

    PaxDbiQ9NZD1.
    PRIDEiQ9NZD1.

    PTM databases

    PhosphoSiteiQ9NZD1.

    Expressioni

    Tissue specificityi

    Widely expressed in the peripheral system. Expression pattern is high in pancreas, medium in kidney, small intestine, spleen and testis, low in lung, colon, leukocyte, prostate and thymus and not detectable in brain, heart, liver, placenta, skeletal muscle and ovary.1 Publication

    Gene expression databases

    ArrayExpressiQ9NZD1.
    BgeeiQ9NZD1.
    CleanExiHS_GPRC5D.
    GenevestigatoriQ9NZD1.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NZD1.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 2727ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini49 – 6315CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini85 – 939ExtracellularSequence Analysis
    Topological domaini115 – 1239CytoplasmicSequence Analysis
    Topological domaini145 – 16723ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini189 – 20416CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini226 – 23914ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini261 – 34585CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei28 – 4821Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei64 – 8421Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei94 – 11421Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei124 – 14421Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei168 – 18821Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei205 – 22521Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei240 – 26021Helical; Name=7Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG44023.
    HOGENOMiHOG000116197.
    HOVERGENiHBG049967.
    InParanoidiQ9NZD1.
    KOiK04621.
    OMAiLVTNAWV.
    OrthoDBiEOG7RRF79.
    PhylomeDBiQ9NZD1.
    TreeFamiTF321410.

    Family and domain databases

    InterProiIPR017978. GPCR_3_C.
    [Graphical view]
    PfamiPF00003. 7tm_3. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NZD1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MYKDCIESTG DYFLLCDAEG PWGIILESLA ILGIVVTILL LLAFLFLMRK    50
    IQDCSQWNVL PTQLLFLLSV LGLFGLAFAF IIELNQQTAP VRYFLFGVLF 100
    ALCFSCLLAH ASNLVKLVRG CVSFSWTTIL CIAIGCSLLQ IIIATEYVTL 150
    IMTRGMMFVN MTPCQLNVDF VVLLVYVLFL MALTFFVSKA TFCGPCENWK 200
    QHGRLIFITV LFSIIIWVVW ISMLLRGNPQ FQRQPQWDDP VVCIALVTNA 250
    WVFLLLYIVP ELCILYRSCR QECPLQGNAC PVTAYQHSFQ VENQELSRAR 300
    DSDGAEEDVA LTSYGTPIQP QTVDPTQECF IPQAKLSPQQ DAGGV 345
    Length:345
    Mass (Da):38,791
    Last modified:October 1, 2000 - v1
    Checksum:i14B09E4C5E9F9B49
    GO
    Isoform 2 (identifier: Q9NZD1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         299-300: AR → DC
         301-345: Missing.

    Show »
    Length:300
    Mass (Da):34,095
    Checksum:iDC99870AB178A061
    GO
    Isoform 3 (identifier: Q9NZD1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         299-345: ARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV → GTFLGDSGSREVLLQEKQEKNHAVG

    Show »
    Length:323
    Mass (Da):36,559
    Checksum:iFEF5CB0A1066B28E
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti18 – 181A → D.
    Corresponds to variant rs3741822 [ dbSNP | Ensembl ].
    VAR_018297

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei299 – 34547ARDSD…DAGGV → GTFLGDSGSREVLLQEKQEK NHAVG in isoform 3. CuratedVSP_010008Add
    BLAST
    Alternative sequencei299 – 3002AR → DC in isoform 2. 1 PublicationVSP_010006
    Alternative sequencei301 – 34545Missing in isoform 2. 1 PublicationVSP_010007Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF209923 mRNA. Translation: AAF72873.1.
    AB099817 mRNA. Translation: BAC79169.1.
    AB083629 Genomic DNA. Translation: BAB89342.1.
    BC069341 mRNA. Translation: AAH69341.1.
    BC107077 mRNA. Translation: AAI07078.1.
    BC107078 mRNA. Translation: AAI07079.1.
    CCDSiCCDS8658.1. [Q9NZD1-1]
    RefSeqiNP_061124.1. NM_018654.1. [Q9NZD1-1]
    XP_005253478.1. XM_005253421.1. [Q9NZD1-1]
    UniGeneiHs.644599.

    Genome annotation databases

    EnsembliENST00000228887; ENSP00000228887; ENSG00000111291. [Q9NZD1-1]
    ENST00000396333; ENSP00000379624; ENSG00000111291. [Q9NZD1-2]
    GeneIDi55507.
    KEGGihsa:55507.
    UCSCiuc010shp.2. human. [Q9NZD1-1]

    Polymorphism databases

    DMDMi46396015.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF209923 mRNA. Translation: AAF72873.1 .
    AB099817 mRNA. Translation: BAC79169.1 .
    AB083629 Genomic DNA. Translation: BAB89342.1 .
    BC069341 mRNA. Translation: AAH69341.1 .
    BC107077 mRNA. Translation: AAI07078.1 .
    BC107078 mRNA. Translation: AAI07079.1 .
    CCDSi CCDS8658.1. [Q9NZD1-1 ]
    RefSeqi NP_061124.1. NM_018654.1. [Q9NZD1-1 ]
    XP_005253478.1. XM_005253421.1. [Q9NZD1-1 ]
    UniGenei Hs.644599.

    3D structure databases

    ProteinModelPortali Q9NZD1.
    ModBasei Search...
    MobiDBi Search...

    Protein family/group databases

    GPCRDBi Search...

    PTM databases

    PhosphoSitei Q9NZD1.

    Polymorphism databases

    DMDMi 46396015.

    Proteomic databases

    PaxDbi Q9NZD1.
    PRIDEi Q9NZD1.

    Protocols and materials databases

    DNASUi 55507.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000228887 ; ENSP00000228887 ; ENSG00000111291 . [Q9NZD1-1 ]
    ENST00000396333 ; ENSP00000379624 ; ENSG00000111291 . [Q9NZD1-2 ]
    GeneIDi 55507.
    KEGGi hsa:55507.
    UCSCi uc010shp.2. human. [Q9NZD1-1 ]

    Organism-specific databases

    CTDi 55507.
    GeneCardsi GC12M013093.
    HGNCi HGNC:13310. GPRC5D.
    MIMi 607437. gene.
    neXtProti NX_Q9NZD1.
    PharmGKBi PA28940.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG44023.
    HOGENOMi HOG000116197.
    HOVERGENi HBG049967.
    InParanoidi Q9NZD1.
    KOi K04621.
    OMAi LVTNAWV.
    OrthoDBi EOG7RRF79.
    PhylomeDBi Q9NZD1.
    TreeFami TF321410.

    Miscellaneous databases

    GeneWikii GPRC5D.
    GenomeRNAii 55507.
    NextBioi 59907.
    PROi Q9NZD1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NZD1.
    Bgeei Q9NZD1.
    CleanExi HS_GPRC5D.
    Genevestigatori Q9NZD1.

    Family and domain databases

    InterProi IPR017978. GPCR_3_C.
    [Graphical view ]
    Pfami PF00003. 7tm_3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and characterization of a human orphan family C G-protein coupled receptor GPRC5D."
      Braeuner-Osborne H., Jensen A.A., Sheppard P.O., Brodin B., Krogsgaard-Larsen P., O'Hara P.
      Biochim. Biophys. Acta 1518:237-248(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.
      Tissue: Testis.
    2. "Characterization of GPRC5D, a member of RAIG family in hard keratinized structures."
      Inoue S., Nanbu T., Shimomura T.
      Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
      Tissue: Skin.
    3. "Identification of G protein-coupled receptor genes from the human genome sequence."
      Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S.
      FEBS Lett. 520:97-101(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 3).
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).

    Entry informationi

    Entry nameiGPC5D_HUMAN
    AccessioniPrimary (citable) accession number: Q9NZD1
    Secondary accession number(s): Q3KNV3, Q7Z5J9, Q8TDS6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 13, 2004
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 97 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. 7-transmembrane G-linked receptors
      List of 7-transmembrane G-linked receptor entries
    2. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    3. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    4. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    5. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3