Q9NZD1 (GPC5D_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: G-protein coupled receptor family C group 5 member D | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 345 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | |
| Tissue specificity | Widely expressed in the peripheral system. Expression pattern is high in pancreas, medium in kidney, small intestine, spleen and testis, low in lung, colon, leukocyte, prostate and thymus and not detectable in brain, heart, liver, placenta, skeletal muscle and ovary. Ref.1 |
| Sequence similarities | Belongs to the G-protein coupled receptor 3 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | G-protein coupled receptor Receptor Transducer |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneNon-traceable author statement Ref.1. Source: UniProtKB |
| Molecular_function | G-protein coupled receptor activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NZD1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NZD1-2) The sequence of this isoform differs from the canonical sequence as follows: 299-300: AR → DC 301-345: Missing. | ||||||
| Isoform 3 (identifier: Q9NZD1-3) The sequence of this isoform differs from the canonical sequence as follows: 299-345: ARDSDGAEEDVALTSYGTPIQPQTVDPTQECFIPQAKLSPQQDAGGV → GTFLGDSGSREVLLQEKQEKNHAVG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 345 | 345 | G-protein coupled receptor family C group 5 member D | PRO_0000206897 | |||||
Regions | |||||||||
| Topological domain | 1 – 27 | 27 | Extracellular Potential | ||||||
| Transmembrane | 28 – 48 | 21 | Helical; Name=1; Potential | ||||||
| Topological domain | 49 – 63 | 15 | Cytoplasmic Potential | ||||||
| Transmembrane | 64 – 84 | 21 | Helical; Name=2; Potential | ||||||
| Topological domain | 85 – 93 | 9 | Extracellular Potential | ||||||
| Transmembrane | 94 – 114 | 21 | Helical; Name=3; Potential | ||||||
| Topological domain | 115 – 123 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 124 – 144 | 21 | Helical; Name=4; Potential | ||||||
| Topological domain | 145 – 167 | 23 | Extracellular Potential | ||||||
| Transmembrane | 168 – 188 | 21 | Helical; Name=5; Potential | ||||||
| Topological domain | 189 – 204 | 16 | Cytoplasmic Potential | ||||||
| Transmembrane | 205 – 225 | 21 | Helical; Name=6; Potential | ||||||
| Topological domain | 226 – 239 | 14 | Extracellular Potential | ||||||
| Transmembrane | 240 – 260 | 21 | Helical; Name=7; Potential | ||||||
| Topological domain | 261 – 345 | 85 | Cytoplasmic Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 299 – 345 | 47 | ARDSD…DAGGV → GTFLGDSGSREVLLQEKQEK NHAVG in isoform 3. | VSP_010008 | |||||
| Alternative sequence | 299 – 300 | 2 | AR → DC in isoform 2. | VSP_010006 | |||||
| Alternative sequence | 301 – 345 | 45 | Missing in isoform 2. | VSP_010007 | |||||
| Natural variant | 18 | 1 | A → D. Corresponds to variant rs3741822 [ dbSNP | Ensembl ]. | VAR_018297 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a human orphan family C G-protein coupled receptor GPRC5D." Braeuner-Osborne H., Jensen A.A., Sheppard P.O., Brodin B., Krogsgaard-Larsen P., O'Hara P. Biochim. Biophys. Acta 1518:237-248(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION. Tissue: Testis. |
| [2] | "Characterization of GPRC5D, a member of RAIG family in hard keratinized structures." Inoue S., Nanbu T., Shimomura T. Submitted (JAN-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: Skin. |
| [3] | "Identification of G protein-coupled receptor genes from the human genome sequence." Takeda S., Kadowaki S., Haga T., Takaesu H., Mitaku S. FEBS Lett. 520:97-101(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 3). |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF209923 mRNA. Translation: AAF72873.1. AB099817 mRNA. Translation: BAC79169.1. AB083629 Genomic DNA. Translation: BAB89342.1. BC069341 mRNA. Translation: AAH69341.1. BC107077 mRNA. Translation: AAI07078.1. BC107078 mRNA. Translation: AAI07079.1. |
| IPI | IPI00032870. IPI00382997. IPI00410023. |
| RefSeq | NP_061124.1. NM_018654.1. |
| UniGene | Hs.644599. |
3D structure databases | |
| ProteinModelPortal | Q9NZD1. |
| ModBase | Search... |
Protein family/group databases | |
| GPCRDB | Search... |
PTM databases | |
| PhosphoSite | Q9NZD1. |
Polymorphism databases | |
| DMDM | 46396015. |
Proteomic databases | |
| PaxDb | Q9NZD1. |
| PRIDE | Q9NZD1. |
Protocols and materials databases | |
| DNASU | 55507. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000228887; ENSP00000228887; ENSG00000111291. ENST00000396333; ENSP00000379624; ENSG00000111291. |
| GeneID | 55507. |
| KEGG | hsa:55507. |
| UCSC | uc010shp.2. human. |
Organism-specific databases | |
| CTD | 55507. |
| GeneCards | GC12M013093. |
| HGNC | HGNC:13310. GPRC5D. |
| MIM | 607437. gene. |
| neXtProt | NX_Q9NZD1. |
| PharmGKB | PA28940. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG44023. |
| HOGENOM | HOG000116197. |
| HOVERGEN | HBG049967. |
| InParanoid | Q9NZD1. |
| KO | K04621. |
| OMA | LVTNAWV. |
| OrthoDB | EOG4RXZ0S. |
| PhylomeDB | Q9NZD1. |
Gene expression databases | |
| ArrayExpress | Q9NZD1. |
| Bgee | Q9NZD1. |
| CleanEx | HS_GPRC5D. |
| Genevestigator | Q9NZD1. |
| GermOnline | ENSG00000111291. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR017978. GPCR_3_C. [Graphical view] |
| Pfam | PF00003. 7tm_3. 1 hit. [Graphical view] |
| PROSITE | PS00979. G_PROTEIN_RECEP_F3_1. False negative. PS00980. G_PROTEIN_RECEP_F3_2. False negative. PS00981. G_PROTEIN_RECEP_F3_3. False negative. PS50259. G_PROTEIN_RECEP_F3_4. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 55507. |
| NextBio | 59907. |
| SOURCE | Search... |
Entry information
| Entry name | GPC5D_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NZD1 Secondary accession number(s): Q3KNV3, Q7Z5J9, Q8TDS6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| 7-transmembrane G-linked receptors List of 7-transmembrane G-linked receptor entries |
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
