Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Chloride intracellular channel protein 5

Gene

CLIC5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for normal hearing (PubMed:24781754). It is necessary for the formation of stereocilia in the inner ear and normal development of the organ of Corti (By similarity). Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture (PubMed:15184393, PubMed:18028448, PubMed:20335315).By similarity4 Publications

GO - Molecular functioni

GO - Biological processi

  • auditory receptor cell stereocilium organization Source: Ensembl
  • chloride transport Source: UniProtKB
  • diet induced thermogenesis Source: Ensembl
  • female pregnancy Source: ProtInc
  • neuromuscular process controlling balance Source: Ensembl
  • protein localization Source: Ensembl
  • sensory perception of sound Source: UniProtKB
  • transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Chloride channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Hearing, Ion transport, Transport

Keywords - Ligandi

Chloride

Names & Taxonomyi

Protein namesi
Recommended name:
Chloride intracellular channel protein 5
Gene namesi
Name:CLIC5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:13517. CLIC5.

Subcellular locationi

Isoform 1 :
Isoform 2 :

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei193 – 21321Helical; Note=After insertion into the membraneSequence AnalysisAdd
BLAST

GO - Cellular componenti

  • actin cytoskeleton Source: UniProtKB
  • cell cortex Source: UniProtKB-SubCell
  • chloride channel complex Source: UniProtKB-KW
  • extracellular exosome Source: UniProtKB
  • Golgi apparatus Source: UniProtKB
  • microtubule organizing center Source: UniProtKB-SubCell
  • stereocilium Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane

Pathology & Biotechi

Involvement in diseasei

Deafness, autosomal recessive, 103 (DFNB103)1 Publication

The disease is caused by mutations affecting the gene represented in this entry.

Disease descriptionA form of sensorineural deafness with onset in early childhood. Hearing impairment progresses from mild to severe or even profound before the second decade, and is accompanied by vestibular areflexia.

See also OMIM:616042

Keywords - Diseasei

Deafness, Non-syndromic deafness

Organism-specific databases

MIMi616042. phenotype.
Orphaneti90636. Autosomal recessive non-syndromic sensorineural deafness type DFNB.
PharmGKBiPA26592.

Polymorphism and mutation databases

BioMutaiCLIC5.
DMDMi215274174.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 410410Chloride intracellular channel protein 5PRO_0000144214Add
BLAST

Proteomic databases

MaxQBiQ9NZA1.
PaxDbiQ9NZA1.
PRIDEiQ9NZA1.

2D gel databases

OGPiQ9NZA1.

PTM databases

PhosphoSiteiQ9NZA1.

Expressioni

Tissue specificityi

Widely expressed in both fetal and adult human tissues (PubMed:24781754). Isoform 1 is expressed in renal glomeruli endothelial cells and podocytes (at protein level).2 Publications

Gene expression databases

BgeeiQ9NZA1.
CleanExiHS_CLIC5.
ExpressionAtlasiQ9NZA1. baseline and differential.
GenevisibleiQ9NZA1. HS.

Interactioni

Subunit structurei

Component of a multimeric complex consisting of several cytoskeletal proteins, including actin, ezrin, alpha-actinin, gelsolin, and IQGAP1. Interacts with AKAP9.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SRCP005232EBI-5658997,EBI-848039From a different organism.

Protein-protein interaction databases

BioGridi119781. 6 interactions.
IntActiQ9NZA1. 6 interactions.
MINTiMINT-4540449.
STRINGi9606.ENSP00000185206.

Structurei

3D structure databases

ProteinModelPortaliQ9NZA1.
SMRiQ9NZA1. Positions 173-407.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini260 – 400141GST C-terminalAdd
BLAST

Domaini

Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion (By similarity).By similarity

Sequence similaritiesi

Belongs to the chloride channel CLIC family.Curated
Contains 1 GST C-terminal domain.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG282171.
GeneTreeiENSGT00550000074477.
HOGENOMiHOG000065740.
HOVERGENiHBG050995.
InParanoidiQ9NZA1.
KOiK05025.
OMAiANGDDRD.
OrthoDBiEOG7X3QR3.
PhylomeDBiQ9NZA1.
TreeFamiTF315438.

Family and domain databases

Gene3Di1.20.1050.10. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR002946. CLIC.
IPR030264. CLIC-5.
IPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PANTHERiPTHR11260:SF152. PTHR11260:SF152. 1 hit.
PfamiPF13417. GST_N_3. 1 hit.
[Graphical view]
PRINTSiPR01263. INTCLCHANNEL.
SUPFAMiSSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
TIGRFAMsiTIGR00862. O-ClC. 1 hit.
PROSITEiPS50405. GST_CTER. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q9NZA1-1) [UniParc]FASTAAdd to basket

Also known as: CLIC5B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNDEDYSTIY DTIQNERTYE VPDQPEENES PHYDDVHEYL RPENDLYATQ
60 70 80 90 100
LNTHEYDFVS VYTIKGEETS LASVQSEDRG YLLPDEIYSE LQEAHPGEPQ
110 120 130 140 150
EDRGISMEGL YSSTQDQQLC AAELQENGSV MKEDLPSPSS FTIQHSKAFS
160 170 180 190 200
TTKYSCYSDA EGLEEKEGAH MNPEIYLFVK AGIDGESIGN CPFSQRLFMI
210 220 230 240 250
LWLKGVVFNV TTVDLKRKPA DLHNLAPGTH PPFLTFNGDV KTDVNKIEEF
260 270 280 290 300
LEETLTPEKY PKLAAKHRES NTAGIDIFSK FSAYIKNTKQ QNNAALERGL
310 320 330 340 350
TKALKKLDDY LNTPLPEEID ANTCGEDKGS RRKFLDGDEL TLADCNLLPK
360 370 380 390 400
LHVVKIVAKK YRNYDIPAEM TGLWRYLKNA YARDEFTNTC AADSEIELAY
410
ADVAKRLSRS
Length:410
Mass (Da):46,503
Last modified:November 25, 2008 - v3
Checksum:iE26D307775F8354C
GO
Isoform 1 (identifier: Q9NZA1-2) [UniParc]FASTAAdd to basket

Also known as: CLIC5A

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-180: AEGLEEKEGAHMNPEIYLFVK → MTDSATANGDDRDPEIELFVK

Show »
Length:251
Mass (Da):28,179
Checksum:i1E8658EB7687C60D
GO
Isoform 3 (identifier: Q9NZA1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MNDEDYSTIYDTIQNER → MTDSATANGDDRDPEIE
     18-176: Missing.
     356-410: IVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS → EQVPLKGMI

Note: No experimental confirmation available.
Show »
Length:205
Mass (Da):22,830
Checksum:i5F6C595B3B4842F2
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti201 – 2011L → F in AAK52083 (PubMed:12163479).Curated
Isoform 1 (identifier: Q9NZA1-2)
Sequence conflicti12 – 121R → S in AAF66928 (PubMed:10793131).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti114 – 1141T → A.
Corresponds to variant rs723580 [ dbSNP | Ensembl ].
VAR_059208
Natural varianti257 – 2571P → H.
Corresponds to variant rs35822882 [ dbSNP | Ensembl ].
VAR_047541

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 159159Missing in isoform 1. 3 PublicationsVSP_000869Add
BLAST
Alternative sequencei1 – 1717MNDED…IQNER → MTDSATANGDDRDPEIE in isoform 3. 1 PublicationVSP_044889Add
BLAST
Alternative sequencei18 – 176159Missing in isoform 3. 1 PublicationVSP_044890Add
BLAST
Alternative sequencei160 – 18021AEGLE…YLFVK → MTDSATANGDDRDPEIELFV K in isoform 1. 3 PublicationsVSP_000870Add
BLAST
Alternative sequencei356 – 41055IVAKK…RLSRS → EQVPLKGMI in isoform 3. 1 PublicationVSP_044891Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF216941 mRNA. Translation: AAF66928.1.
AY032602 mRNA. Translation: AAK52083.1.
AK075163 mRNA. Translation: BAC11444.1.
AK097048 mRNA. Translation: BAG53413.1.
AK075144 mRNA. Translation: BAC11432.1.
AL050336, AL357057 Genomic DNA. Translation: CAI21030.1.
AL050336, AL357057 Genomic DNA. Translation: CAI21031.1.
AL355522 Genomic DNA. No translation available.
AL591211 Genomic DNA. No translation available.
CH471081 Genomic DNA. Translation: EAX04286.1.
CH471081 Genomic DNA. Translation: EAX04287.1.
BC035968 mRNA. Translation: AAH35968.1.
CCDSiCCDS47438.1. [Q9NZA1-1]
CCDS4914.1. [Q9NZA1-2]
CCDS59022.1. [Q9NZA1-3]
RefSeqiNP_001107558.1. NM_001114086.1. [Q9NZA1-1]
NP_001242952.1. NM_001256023.1. [Q9NZA1-3]
NP_058625.2. NM_016929.4. [Q9NZA1-2]
UniGeneiHs.485489.
Hs.734348.

Genome annotation databases

EnsembliENST00000185206; ENSP00000185206; ENSG00000112782.
ENST00000544153; ENSP00000439195; ENSG00000112782. [Q9NZA1-3]
GeneIDi53405.
KEGGihsa:53405.
UCSCiuc003oxv.3. human. [Q9NZA1-1]
uc003oxx.4. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF216941 mRNA. Translation: AAF66928.1.
AY032602 mRNA. Translation: AAK52083.1.
AK075163 mRNA. Translation: BAC11444.1.
AK097048 mRNA. Translation: BAG53413.1.
AK075144 mRNA. Translation: BAC11432.1.
AL050336, AL357057 Genomic DNA. Translation: CAI21030.1.
AL050336, AL357057 Genomic DNA. Translation: CAI21031.1.
AL355522 Genomic DNA. No translation available.
AL591211 Genomic DNA. No translation available.
CH471081 Genomic DNA. Translation: EAX04286.1.
CH471081 Genomic DNA. Translation: EAX04287.1.
BC035968 mRNA. Translation: AAH35968.1.
CCDSiCCDS47438.1. [Q9NZA1-1]
CCDS4914.1. [Q9NZA1-2]
CCDS59022.1. [Q9NZA1-3]
RefSeqiNP_001107558.1. NM_001114086.1. [Q9NZA1-1]
NP_001242952.1. NM_001256023.1. [Q9NZA1-3]
NP_058625.2. NM_016929.4. [Q9NZA1-2]
UniGeneiHs.485489.
Hs.734348.

3D structure databases

ProteinModelPortaliQ9NZA1.
SMRiQ9NZA1. Positions 173-407.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119781. 6 interactions.
IntActiQ9NZA1. 6 interactions.
MINTiMINT-4540449.
STRINGi9606.ENSP00000185206.

PTM databases

PhosphoSiteiQ9NZA1.

Polymorphism and mutation databases

BioMutaiCLIC5.
DMDMi215274174.

2D gel databases

OGPiQ9NZA1.

Proteomic databases

MaxQBiQ9NZA1.
PaxDbiQ9NZA1.
PRIDEiQ9NZA1.

Protocols and materials databases

DNASUi53405.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000185206; ENSP00000185206; ENSG00000112782.
ENST00000544153; ENSP00000439195; ENSG00000112782. [Q9NZA1-3]
GeneIDi53405.
KEGGihsa:53405.
UCSCiuc003oxv.3. human. [Q9NZA1-1]
uc003oxx.4. human.

Organism-specific databases

CTDi53405.
GeneCardsiGC06M045848.
HGNCiHGNC:13517. CLIC5.
MIMi607293. gene.
616042. phenotype.
neXtProtiNX_Q9NZA1.
Orphaneti90636. Autosomal recessive non-syndromic sensorineural deafness type DFNB.
PharmGKBiPA26592.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG282171.
GeneTreeiENSGT00550000074477.
HOGENOMiHOG000065740.
HOVERGENiHBG050995.
InParanoidiQ9NZA1.
KOiK05025.
OMAiANGDDRD.
OrthoDBiEOG7X3QR3.
PhylomeDBiQ9NZA1.
TreeFamiTF315438.

Miscellaneous databases

ChiTaRSiCLIC5. human.
GeneWikiiCLIC5.
GenomeRNAii53405.
NextBioi56076.
PROiQ9NZA1.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NZA1.
CleanExiHS_CLIC5.
ExpressionAtlasiQ9NZA1. baseline and differential.
GenevisibleiQ9NZA1. HS.

Family and domain databases

Gene3Di1.20.1050.10. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR002946. CLIC.
IPR030264. CLIC-5.
IPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PANTHERiPTHR11260:SF152. PTHR11260:SF152. 1 hit.
PfamiPF13417. GST_N_3. 1 hit.
[Graphical view]
PRINTSiPR01263. INTCLCHANNEL.
SUPFAMiSSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
TIGRFAMsiTIGR00862. O-ClC. 1 hit.
PROSITEiPS50405. GST_CTER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli."
    Berryman M., Bretscher A.
    Mol. Biol. Cell 11:1509-1521(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "AKAP350 at the Golgi apparatus. II. Association of AKAP350 with a novel chloride intracellular channel (CLIC) family member."
    Shanks R.A., Larocca M.C., Berryman M., Edwards J.C., Urushidani T., Navarre J., Goldenring J.R.
    J. Biol. Chem. 277:40973-40980(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH AKAP9, SUBCELLULAR LOCATION.
    Tissue: Colon adenocarcinoma.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Placenta and Small intestine.
  4. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Placenta.
  5. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  8. "CLIC-5A functions as a chloride channel in vitro and associates with the cortical actin cytoskeleton in vitro and in vivo."
    Berryman M., Bruno J., Price J., Edwards J.C.
    J. Biol. Chem. 279:34794-34801(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION (ISOFORM 1).
  9. "Functional reconstitution of mammalian 'chloride intracellular channels' CLIC1, CLIC4 and CLIC5 reveals differential regulation by cytoskeletal actin."
    Singh H., Cousin M.A., Ashley R.H.
    FEBS J. 274:6306-6316(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH F-ACTIN.
  10. "CLIC5A, a component of the ezrin-podocalyxin complex in glomeruli, is a determinant of podocyte integrity."
    Wegner B., Al-Momany A., Kulak S.C., Kozlowski K., Obeidat M., Jahroudi N., Paes J., Berryman M., Ballermann B.J.
    Am. J. Physiol. 298:F1492-F1503(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, FUNCTION.
  11. Cited for: FUNCTION, TISSUE SPECIFICITY, INVOLVEMENT IN DFNB103.

Entry informationi

Entry nameiCLIC5_HUMAN
AccessioniPrimary (citable) accession number: Q9NZA1
Secondary accession number(s): B3KUF1
, Q5T4Z0, Q8NBY3, Q96JT5, Q9BWZ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: November 25, 2008
Last modified: July 22, 2015
This is version 145 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.