Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NZA1

- CLIC5_HUMAN

UniProt

Q9NZA1 - CLIC5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Chloride intracellular channel protein 5

Gene

CLIC5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Required for normal formation of stereocilia in the inner ear and normal development of the organ of Corti (By similarity). Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture.By similarity3 Publications

GO - Molecular functioni

  1. voltage-gated chloride channel activity Source: InterPro

GO - Biological processi

  1. auditory receptor cell stereocilium organization Source: Ensembl
  2. chloride transport Source: UniProtKB
  3. diet induced thermogenesis Source: Ensembl
  4. female pregnancy Source: ProtInc
  5. neuromuscular process controlling balance Source: Ensembl
  6. protein localization Source: Ensembl
  7. sensory perception of sound Source: Ensembl
  8. transport Source: ProtInc
Complete GO annotation...

Keywords - Molecular functioni

Chloride channel, Ion channel, Voltage-gated channel

Keywords - Biological processi

Ion transport, Transport

Keywords - Ligandi

Chloride

Names & Taxonomyi

Protein namesi
Recommended name:
Chloride intracellular channel protein 5
Gene namesi
Name:CLIC5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:13517. CLIC5.

Subcellular locationi

Isoform 1 : Cytoplasmcell cortex 1 Publication. Cytoplasmcytoskeleton 1 Publication. Membrane 1 Publication; Single-pass membrane protein 1 Publication
Note: Associates with the cortical actin cytoskeleton. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain (By similarity).By similarity
Isoform 2 : Golgi apparatus. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Membrane; Single-pass membrane protein
Note: Colocalized with AKAP9 at the Golgi apparatus as well as, to a lesser extent, the centrosome. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain (By similarity). Colocalized with podocalyxin in renal glomeruli.By similarity

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei193 – 21321Helical; Note=After insertion into the membraneSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. actin cytoskeleton Source: UniProtKB
  2. chloride channel complex Source: UniProtKB-KW
  3. extracellular vesicular exosome Source: UniProt
  4. Golgi apparatus Source: UniProtKB
  5. stereocilium Source: Ensembl
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

Orphaneti90636. Autosomal recessive non-syndromic sensorineural deafness type DFNB.
PharmGKBiPA26592.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 410410Chloride intracellular channel protein 5PRO_0000144214Add
BLAST

Proteomic databases

MaxQBiQ9NZA1.
PaxDbiQ9NZA1.
PRIDEiQ9NZA1.

2D gel databases

OGPiQ9NZA1.

PTM databases

PhosphoSiteiQ9NZA1.

Expressioni

Tissue specificityi

Isoform 1 is expressed in renal glomeruli endothelial cells and podocytes (at protein level).1 Publication

Gene expression databases

BgeeiQ9NZA1.
CleanExiHS_CLIC5.
ExpressionAtlasiQ9NZA1. baseline and differential.
GenevestigatoriQ9NZA1.

Interactioni

Subunit structurei

Component of a multimeric complex consisting of several cytoskeletal proteins, including actin, ezrin, alpha-actinin, gelsolin, and IQGAP1. Interacts with AKAP9.2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
SRCP005232EBI-5658997,EBI-848039From a different organism.

Protein-protein interaction databases

BioGridi119781. 6 interactions.
IntActiQ9NZA1. 6 interactions.
MINTiMINT-4540449.
STRINGi9606.ENSP00000185206.

Structurei

3D structure databases

ProteinModelPortaliQ9NZA1.
SMRiQ9NZA1. Positions 173-407.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini260 – 400141GST C-terminalAdd
BLAST

Domaini

Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion (By similarity).By similarity

Sequence similaritiesi

Belongs to the chloride channel CLIC family.Curated
Contains 1 GST C-terminal domain.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG282171.
GeneTreeiENSGT00550000074477.
HOGENOMiHOG000065740.
HOVERGENiHBG050995.
InParanoidiQ9NZA1.
KOiK05025.
OMAiGAICKAG.
OrthoDBiEOG7X3QR3.
PhylomeDBiQ9NZA1.
TreeFamiTF315438.

Family and domain databases

Gene3Di1.20.1050.10. 1 hit.
3.40.30.10. 1 hit.
InterProiIPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR002946. Int_Cl_channel.
IPR012336. Thioredoxin-like_fold.
[Graphical view]
PfamiPF13417. GST_N_3. 1 hit.
[Graphical view]
PRINTSiPR01263. INTCLCHANNEL.
SUPFAMiSSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
TIGRFAMsiTIGR00862. O-ClC. 1 hit.
PROSITEiPS50405. GST_CTER. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 2 (identifier: Q9NZA1-1) [UniParc]FASTAAdd to Basket

Also known as: CLIC5B

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNDEDYSTIY DTIQNERTYE VPDQPEENES PHYDDVHEYL RPENDLYATQ
60 70 80 90 100
LNTHEYDFVS VYTIKGEETS LASVQSEDRG YLLPDEIYSE LQEAHPGEPQ
110 120 130 140 150
EDRGISMEGL YSSTQDQQLC AAELQENGSV MKEDLPSPSS FTIQHSKAFS
160 170 180 190 200
TTKYSCYSDA EGLEEKEGAH MNPEIYLFVK AGIDGESIGN CPFSQRLFMI
210 220 230 240 250
LWLKGVVFNV TTVDLKRKPA DLHNLAPGTH PPFLTFNGDV KTDVNKIEEF
260 270 280 290 300
LEETLTPEKY PKLAAKHRES NTAGIDIFSK FSAYIKNTKQ QNNAALERGL
310 320 330 340 350
TKALKKLDDY LNTPLPEEID ANTCGEDKGS RRKFLDGDEL TLADCNLLPK
360 370 380 390 400
LHVVKIVAKK YRNYDIPAEM TGLWRYLKNA YARDEFTNTC AADSEIELAY
410
ADVAKRLSRS
Length:410
Mass (Da):46,503
Last modified:November 25, 2008 - v3
Checksum:iE26D307775F8354C
GO
Isoform 1 (identifier: Q9NZA1-2) [UniParc]FASTAAdd to Basket

Also known as: CLIC5A

The sequence of this isoform differs from the canonical sequence as follows:
     1-159: Missing.
     160-180: AEGLEEKEGAHMNPEIYLFVK → MTDSATANGDDRDPEIELFVK

Show »
Length:251
Mass (Da):28,179
Checksum:i1E8658EB7687C60D
GO
Isoform 3 (identifier: Q9NZA1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-17: MNDEDYSTIYDTIQNER → MTDSATANGDDRDPEIE
     18-176: Missing.
     356-410: IVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS → EQVPLKGMI

Note: No experimental confirmation available.

Show »
Length:205
Mass (Da):22,830
Checksum:i5F6C595B3B4842F2
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti201 – 2011L → F in AAK52083. (PubMed:12163479)Curated
Isoform 1 (identifier: Q9NZA1-2)
Sequence conflicti12 – 121R → S in AAF66928. (PubMed:10793131)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti114 – 1141T → A.
Corresponds to variant rs723580 [ dbSNP | Ensembl ].
VAR_059208
Natural varianti257 – 2571P → H.
Corresponds to variant rs35822882 [ dbSNP | Ensembl ].
VAR_047541

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 159159Missing in isoform 1. 3 PublicationsVSP_000869Add
BLAST
Alternative sequencei1 – 1717MNDED…IQNER → MTDSATANGDDRDPEIE in isoform 3. 1 PublicationVSP_044889Add
BLAST
Alternative sequencei18 – 176159Missing in isoform 3. 1 PublicationVSP_044890Add
BLAST
Alternative sequencei160 – 18021AEGLE…YLFVK → MTDSATANGDDRDPEIELFV K in isoform 1. 3 PublicationsVSP_000870Add
BLAST
Alternative sequencei356 – 41055IVAKK…RLSRS → EQVPLKGMI in isoform 3. 1 PublicationVSP_044891Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF216941 mRNA. Translation: AAF66928.1.
AY032602 mRNA. Translation: AAK52083.1.
AK075163 mRNA. Translation: BAC11444.1.
AK097048 mRNA. Translation: BAG53413.1.
AK075144 mRNA. Translation: BAC11432.1.
AL050336, AL357057 Genomic DNA. Translation: CAI21030.1.
AL050336, AL357057 Genomic DNA. Translation: CAI21031.1.
AL355522 Genomic DNA. No translation available.
AL591211 Genomic DNA. No translation available.
CH471081 Genomic DNA. Translation: EAX04286.1.
CH471081 Genomic DNA. Translation: EAX04287.1.
BC035968 mRNA. Translation: AAH35968.1.
CCDSiCCDS47438.1. [Q9NZA1-1]
CCDS4914.1. [Q9NZA1-2]
CCDS59022.1. [Q9NZA1-3]
RefSeqiNP_001107558.1. NM_001114086.1. [Q9NZA1-1]
NP_001242952.1. NM_001256023.1. [Q9NZA1-3]
NP_058625.2. NM_016929.4. [Q9NZA1-2]
UniGeneiHs.485489.
Hs.734348.

Genome annotation databases

EnsembliENST00000185206; ENSP00000185206; ENSG00000112782. [Q9NZA1-1]
ENST00000339561; ENSP00000344165; ENSG00000112782. [Q9NZA1-2]
ENST00000544153; ENSP00000439195; ENSG00000112782. [Q9NZA1-3]
GeneIDi53405.
KEGGihsa:53405.
UCSCiuc003oxv.3. human. [Q9NZA1-1]
uc003oxx.4. human.

Polymorphism databases

DMDMi215274174.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF216941 mRNA. Translation: AAF66928.1 .
AY032602 mRNA. Translation: AAK52083.1 .
AK075163 mRNA. Translation: BAC11444.1 .
AK097048 mRNA. Translation: BAG53413.1 .
AK075144 mRNA. Translation: BAC11432.1 .
AL050336 , AL357057 Genomic DNA. Translation: CAI21030.1 .
AL050336 , AL357057 Genomic DNA. Translation: CAI21031.1 .
AL355522 Genomic DNA. No translation available.
AL591211 Genomic DNA. No translation available.
CH471081 Genomic DNA. Translation: EAX04286.1 .
CH471081 Genomic DNA. Translation: EAX04287.1 .
BC035968 mRNA. Translation: AAH35968.1 .
CCDSi CCDS47438.1. [Q9NZA1-1 ]
CCDS4914.1. [Q9NZA1-2 ]
CCDS59022.1. [Q9NZA1-3 ]
RefSeqi NP_001107558.1. NM_001114086.1. [Q9NZA1-1 ]
NP_001242952.1. NM_001256023.1. [Q9NZA1-3 ]
NP_058625.2. NM_016929.4. [Q9NZA1-2 ]
UniGenei Hs.485489.
Hs.734348.

3D structure databases

ProteinModelPortali Q9NZA1.
SMRi Q9NZA1. Positions 173-407.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119781. 6 interactions.
IntActi Q9NZA1. 6 interactions.
MINTi MINT-4540449.
STRINGi 9606.ENSP00000185206.

PTM databases

PhosphoSitei Q9NZA1.

Polymorphism databases

DMDMi 215274174.

2D gel databases

OGPi Q9NZA1.

Proteomic databases

MaxQBi Q9NZA1.
PaxDbi Q9NZA1.
PRIDEi Q9NZA1.

Protocols and materials databases

DNASUi 53405.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000185206 ; ENSP00000185206 ; ENSG00000112782 . [Q9NZA1-1 ]
ENST00000339561 ; ENSP00000344165 ; ENSG00000112782 . [Q9NZA1-2 ]
ENST00000544153 ; ENSP00000439195 ; ENSG00000112782 . [Q9NZA1-3 ]
GeneIDi 53405.
KEGGi hsa:53405.
UCSCi uc003oxv.3. human. [Q9NZA1-1 ]
uc003oxx.4. human.

Organism-specific databases

CTDi 53405.
GeneCardsi GC06M045848.
HGNCi HGNC:13517. CLIC5.
MIMi 607293. gene.
neXtProti NX_Q9NZA1.
Orphaneti 90636. Autosomal recessive non-syndromic sensorineural deafness type DFNB.
PharmGKBi PA26592.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG282171.
GeneTreei ENSGT00550000074477.
HOGENOMi HOG000065740.
HOVERGENi HBG050995.
InParanoidi Q9NZA1.
KOi K05025.
OMAi GAICKAG.
OrthoDBi EOG7X3QR3.
PhylomeDBi Q9NZA1.
TreeFami TF315438.

Miscellaneous databases

ChiTaRSi CLIC5. human.
GeneWikii CLIC5.
GenomeRNAii 53405.
NextBioi 56076.
PROi Q9NZA1.
SOURCEi Search...

Gene expression databases

Bgeei Q9NZA1.
CleanExi HS_CLIC5.
ExpressionAtlasi Q9NZA1. baseline and differential.
Genevestigatori Q9NZA1.

Family and domain databases

Gene3Di 1.20.1050.10. 1 hit.
3.40.30.10. 1 hit.
InterProi IPR010987. Glutathione-S-Trfase_C-like.
IPR004045. Glutathione_S-Trfase_N.
IPR002946. Int_Cl_channel.
IPR012336. Thioredoxin-like_fold.
[Graphical view ]
Pfami PF13417. GST_N_3. 1 hit.
[Graphical view ]
PRINTSi PR01263. INTCLCHANNEL.
SUPFAMi SSF47616. SSF47616. 1 hit.
SSF52833. SSF52833. 1 hit.
TIGRFAMsi TIGR00862. O-ClC. 1 hit.
PROSITEi PS50405. GST_CTER. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli."
    Berryman M., Bretscher A.
    Mol. Biol. Cell 11:1509-1521(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "AKAP350 at the Golgi apparatus. II. Association of AKAP350 with a novel chloride intracellular channel (CLIC) family member."
    Shanks R.A., Larocca M.C., Berryman M., Edwards J.C., Urushidani T., Navarre J., Goldenring J.R.
    J. Biol. Chem. 277:40973-40980(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH AKAP9, SUBCELLULAR LOCATION.
    Tissue: Colon adenocarcinoma.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Placenta and Small intestine.
  4. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Placenta.
  5. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney.
  8. "CLIC-5A functions as a chloride channel in vitro and associates with the cortical actin cytoskeleton in vitro and in vivo."
    Berryman M., Bruno J., Price J., Edwards J.C.
    J. Biol. Chem. 279:34794-34801(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION (ISOFORM 1).
  9. "Functional reconstitution of mammalian 'chloride intracellular channels' CLIC1, CLIC4 and CLIC5 reveals differential regulation by cytoskeletal actin."
    Singh H., Cousin M.A., Ashley R.H.
    FEBS J. 274:6306-6316(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH F-ACTIN.
  10. "CLIC5A, a component of the ezrin-podocalyxin complex in glomeruli, is a determinant of podocyte integrity."
    Wegner B., Al-Momany A., Kulak S.C., Kozlowski K., Obeidat M., Jahroudi N., Paes J., Berryman M., Ballermann B.J.
    Am. J. Physiol. 298:F1492-F1503(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, FUNCTION.

Entry informationi

Entry nameiCLIC5_HUMAN
AccessioniPrimary (citable) accession number: Q9NZA1
Secondary accession number(s): B3KUF1
, Q5T4Z0, Q8NBY3, Q96JT5, Q9BWZ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 27, 2002
Last sequence update: November 25, 2008
Last modified: November 26, 2014
This is version 137 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3