Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NZA1

- CLIC5_HUMAN

UniProt

Q9NZA1 - CLIC5_HUMAN

Protein

Chloride intracellular channel protein 5

Gene

CLIC5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 135 (01 Oct 2014)
      Sequence version 3 (25 Nov 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Required for normal formation of stereocilia in the inner ear and normal development of the organ of Corti By similarity. Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture.By similarity3 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB
    2. voltage-gated chloride channel activity Source: InterPro

    GO - Biological processi

    1. auditory receptor cell stereocilium organization Source: Ensembl
    2. chloride transport Source: UniProtKB
    3. diet induced thermogenesis Source: Ensembl
    4. female pregnancy Source: ProtInc
    5. neuromuscular process controlling balance Source: Ensembl
    6. protein localization Source: Ensembl
    7. sensory perception of sound Source: Ensembl
    8. transport Source: ProtInc

    Keywords - Molecular functioni

    Chloride channel, Ion channel, Voltage-gated channel

    Keywords - Biological processi

    Ion transport, Transport

    Keywords - Ligandi

    Chloride

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Chloride intracellular channel protein 5
    Gene namesi
    Name:CLIC5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:13517. CLIC5.

    Subcellular locationi

    Isoform 1 : Cytoplasmcell cortex 1 Publication. Cytoplasmcytoskeleton 1 Publication. Membrane 1 Publication; Single-pass membrane protein 1 Publication
    Note: Associates with the cortical actin cytoskeleton. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain By similarity.By similarity
    Isoform 2 : Golgi apparatus. Cytoplasmcytoskeletonmicrotubule organizing centercentrosome. Membrane; Single-pass membrane protein
    Note: Colocalized with AKAP9 at the Golgi apparatus as well as, to a lesser extent, the centrosome. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain By similarity. Colocalized with podocalyxin in renal glomeruli.By similarity

    GO - Cellular componenti

    1. actin cytoskeleton Source: UniProtKB
    2. cell cortex Source: UniProtKB-SubCell
    3. chloride channel complex Source: UniProtKB-KW
    4. extracellular vesicular exosome Source: UniProt
    5. Golgi apparatus Source: UniProtKB
    6. microtubule organizing center Source: UniProtKB-SubCell
    7. stereocilium Source: Ensembl

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton, Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA26592.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 410410Chloride intracellular channel protein 5PRO_0000144214Add
    BLAST

    Proteomic databases

    MaxQBiQ9NZA1.
    PaxDbiQ9NZA1.
    PRIDEiQ9NZA1.

    2D gel databases

    OGPiQ9NZA1.

    PTM databases

    PhosphoSiteiQ9NZA1.

    Expressioni

    Tissue specificityi

    Isoform 1 is expressed in renal glomeruli endothelial cells and podocytes (at protein level).1 Publication

    Gene expression databases

    ArrayExpressiQ9NZA1.
    BgeeiQ9NZA1.
    CleanExiHS_CLIC5.
    GenevestigatoriQ9NZA1.

    Interactioni

    Subunit structurei

    Component of a multimeric complex consisting of several cytoskeletal proteins, including actin, ezrin, alpha-actinin, gelsolin, and IQGAP1. Interacts with AKAP9.2 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    SRCP005232EBI-5658997,EBI-848039From a different organism.

    Protein-protein interaction databases

    BioGridi119781. 3 interactions.
    IntActiQ9NZA1. 6 interactions.
    MINTiMINT-4540449.
    STRINGi9606.ENSP00000185206.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NZA1.
    SMRiQ9NZA1. Positions 173-407.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei193 – 21321Helical; Note=After insertion into the membraneSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini260 – 400141GST C-terminalAdd
    BLAST

    Domaini

    Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion By similarity.By similarity

    Sequence similaritiesi

    Belongs to the chloride channel CLIC family.Curated
    Contains 1 GST C-terminal domain.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG282171.
    HOGENOMiHOG000065740.
    HOVERGENiHBG050995.
    InParanoidiQ9NZA1.
    KOiK05025.
    OMAiGAICKAG.
    OrthoDBiEOG7X3QR3.
    PhylomeDBiQ9NZA1.
    TreeFamiTF315438.

    Family and domain databases

    Gene3Di1.20.1050.10. 1 hit.
    3.40.30.10. 1 hit.
    InterProiIPR010987. Glutathione-S-Trfase_C-like.
    IPR004045. Glutathione_S-Trfase_N.
    IPR002946. Int_Cl_channel.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view]
    PfamiPF13417. GST_N_3. 1 hit.
    [Graphical view]
    PRINTSiPR01263. INTCLCHANNEL.
    SUPFAMiSSF47616. SSF47616. 1 hit.
    SSF52833. SSF52833. 1 hit.
    TIGRFAMsiTIGR00862. O-ClC. 1 hit.
    PROSITEiPS50405. GST_CTER. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 2 (identifier: Q9NZA1-1) [UniParc]FASTAAdd to Basket

    Also known as: CLIC5B

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MNDEDYSTIY DTIQNERTYE VPDQPEENES PHYDDVHEYL RPENDLYATQ    50
    LNTHEYDFVS VYTIKGEETS LASVQSEDRG YLLPDEIYSE LQEAHPGEPQ 100
    EDRGISMEGL YSSTQDQQLC AAELQENGSV MKEDLPSPSS FTIQHSKAFS 150
    TTKYSCYSDA EGLEEKEGAH MNPEIYLFVK AGIDGESIGN CPFSQRLFMI 200
    LWLKGVVFNV TTVDLKRKPA DLHNLAPGTH PPFLTFNGDV KTDVNKIEEF 250
    LEETLTPEKY PKLAAKHRES NTAGIDIFSK FSAYIKNTKQ QNNAALERGL 300
    TKALKKLDDY LNTPLPEEID ANTCGEDKGS RRKFLDGDEL TLADCNLLPK 350
    LHVVKIVAKK YRNYDIPAEM TGLWRYLKNA YARDEFTNTC AADSEIELAY 400
    ADVAKRLSRS 410
    Length:410
    Mass (Da):46,503
    Last modified:November 25, 2008 - v3
    Checksum:iE26D307775F8354C
    GO
    Isoform 1 (identifier: Q9NZA1-2) [UniParc]FASTAAdd to Basket

    Also known as: CLIC5A

    The sequence of this isoform differs from the canonical sequence as follows:
         1-159: Missing.
         160-180: AEGLEEKEGAHMNPEIYLFVK → MTDSATANGDDRDPEIELFVK

    Show »
    Length:251
    Mass (Da):28,179
    Checksum:i1E8658EB7687C60D
    GO
    Isoform 3 (identifier: Q9NZA1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-17: MNDEDYSTIYDTIQNER → MTDSATANGDDRDPEIE
         18-176: Missing.
         356-410: IVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS → EQVPLKGMI

    Note: No experimental confirmation available.

    Show »
    Length:205
    Mass (Da):22,830
    Checksum:i5F6C595B3B4842F2
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti201 – 2011L → F in AAK52083. (PubMed:12163479)Curated
    Isoform 1 (identifier: Q9NZA1-2)
    Sequence conflicti12 – 121R → S in AAF66928. (PubMed:10793131)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti114 – 1141T → A.
    Corresponds to variant rs723580 [ dbSNP | Ensembl ].
    VAR_059208
    Natural varianti257 – 2571P → H.
    Corresponds to variant rs35822882 [ dbSNP | Ensembl ].
    VAR_047541

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 159159Missing in isoform 1. 3 PublicationsVSP_000869Add
    BLAST
    Alternative sequencei1 – 1717MNDED…IQNER → MTDSATANGDDRDPEIE in isoform 3. 1 PublicationVSP_044889Add
    BLAST
    Alternative sequencei18 – 176159Missing in isoform 3. 1 PublicationVSP_044890Add
    BLAST
    Alternative sequencei160 – 18021AEGLE…YLFVK → MTDSATANGDDRDPEIELFV K in isoform 1. 3 PublicationsVSP_000870Add
    BLAST
    Alternative sequencei356 – 41055IVAKK…RLSRS → EQVPLKGMI in isoform 3. 1 PublicationVSP_044891Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF216941 mRNA. Translation: AAF66928.1.
    AY032602 mRNA. Translation: AAK52083.1.
    AK075163 mRNA. Translation: BAC11444.1.
    AK097048 mRNA. Translation: BAG53413.1.
    AK075144 mRNA. Translation: BAC11432.1.
    AL050336, AL357057 Genomic DNA. Translation: CAI21030.1.
    AL050336, AL357057 Genomic DNA. Translation: CAI21031.1.
    AL355522 Genomic DNA. No translation available.
    AL591211 Genomic DNA. No translation available.
    CH471081 Genomic DNA. Translation: EAX04286.1.
    CH471081 Genomic DNA. Translation: EAX04287.1.
    BC035968 mRNA. Translation: AAH35968.1.
    CCDSiCCDS47438.1. [Q9NZA1-1]
    CCDS4914.1. [Q9NZA1-2]
    CCDS59022.1. [Q9NZA1-3]
    RefSeqiNP_001107558.1. NM_001114086.1. [Q9NZA1-1]
    NP_001242952.1. NM_001256023.1. [Q9NZA1-3]
    NP_058625.2. NM_016929.4. [Q9NZA1-2]
    UniGeneiHs.485489.
    Hs.734348.

    Genome annotation databases

    EnsembliENST00000185206; ENSP00000185206; ENSG00000112782. [Q9NZA1-1]
    ENST00000339561; ENSP00000344165; ENSG00000112782. [Q9NZA1-2]
    ENST00000544153; ENSP00000439195; ENSG00000112782. [Q9NZA1-3]
    GeneIDi53405.
    KEGGihsa:53405.
    UCSCiuc003oxv.3. human. [Q9NZA1-1]
    uc003oxx.4. human.

    Polymorphism databases

    DMDMi215274174.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF216941 mRNA. Translation: AAF66928.1 .
    AY032602 mRNA. Translation: AAK52083.1 .
    AK075163 mRNA. Translation: BAC11444.1 .
    AK097048 mRNA. Translation: BAG53413.1 .
    AK075144 mRNA. Translation: BAC11432.1 .
    AL050336 , AL357057 Genomic DNA. Translation: CAI21030.1 .
    AL050336 , AL357057 Genomic DNA. Translation: CAI21031.1 .
    AL355522 Genomic DNA. No translation available.
    AL591211 Genomic DNA. No translation available.
    CH471081 Genomic DNA. Translation: EAX04286.1 .
    CH471081 Genomic DNA. Translation: EAX04287.1 .
    BC035968 mRNA. Translation: AAH35968.1 .
    CCDSi CCDS47438.1. [Q9NZA1-1 ]
    CCDS4914.1. [Q9NZA1-2 ]
    CCDS59022.1. [Q9NZA1-3 ]
    RefSeqi NP_001107558.1. NM_001114086.1. [Q9NZA1-1 ]
    NP_001242952.1. NM_001256023.1. [Q9NZA1-3 ]
    NP_058625.2. NM_016929.4. [Q9NZA1-2 ]
    UniGenei Hs.485489.
    Hs.734348.

    3D structure databases

    ProteinModelPortali Q9NZA1.
    SMRi Q9NZA1. Positions 173-407.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119781. 3 interactions.
    IntActi Q9NZA1. 6 interactions.
    MINTi MINT-4540449.
    STRINGi 9606.ENSP00000185206.

    PTM databases

    PhosphoSitei Q9NZA1.

    Polymorphism databases

    DMDMi 215274174.

    2D gel databases

    OGPi Q9NZA1.

    Proteomic databases

    MaxQBi Q9NZA1.
    PaxDbi Q9NZA1.
    PRIDEi Q9NZA1.

    Protocols and materials databases

    DNASUi 53405.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000185206 ; ENSP00000185206 ; ENSG00000112782 . [Q9NZA1-1 ]
    ENST00000339561 ; ENSP00000344165 ; ENSG00000112782 . [Q9NZA1-2 ]
    ENST00000544153 ; ENSP00000439195 ; ENSG00000112782 . [Q9NZA1-3 ]
    GeneIDi 53405.
    KEGGi hsa:53405.
    UCSCi uc003oxv.3. human. [Q9NZA1-1 ]
    uc003oxx.4. human.

    Organism-specific databases

    CTDi 53405.
    GeneCardsi GC06M045848.
    HGNCi HGNC:13517. CLIC5.
    MIMi 607293. gene.
    neXtProti NX_Q9NZA1.
    PharmGKBi PA26592.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG282171.
    HOGENOMi HOG000065740.
    HOVERGENi HBG050995.
    InParanoidi Q9NZA1.
    KOi K05025.
    OMAi GAICKAG.
    OrthoDBi EOG7X3QR3.
    PhylomeDBi Q9NZA1.
    TreeFami TF315438.

    Miscellaneous databases

    GeneWikii CLIC5.
    GenomeRNAii 53405.
    NextBioi 56076.
    PROi Q9NZA1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NZA1.
    Bgeei Q9NZA1.
    CleanExi HS_CLIC5.
    Genevestigatori Q9NZA1.

    Family and domain databases

    Gene3Di 1.20.1050.10. 1 hit.
    3.40.30.10. 1 hit.
    InterProi IPR010987. Glutathione-S-Trfase_C-like.
    IPR004045. Glutathione_S-Trfase_N.
    IPR002946. Int_Cl_channel.
    IPR012336. Thioredoxin-like_fold.
    [Graphical view ]
    Pfami PF13417. GST_N_3. 1 hit.
    [Graphical view ]
    PRINTSi PR01263. INTCLCHANNEL.
    SUPFAMi SSF47616. SSF47616. 1 hit.
    SSF52833. SSF52833. 1 hit.
    TIGRFAMsi TIGR00862. O-ClC. 1 hit.
    PROSITEi PS50405. GST_CTER. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli."
      Berryman M., Bretscher A.
      Mol. Biol. Cell 11:1509-1521(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "AKAP350 at the Golgi apparatus. II. Association of AKAP350 with a novel chloride intracellular channel (CLIC) family member."
      Shanks R.A., Larocca M.C., Berryman M., Edwards J.C., Urushidani T., Navarre J., Goldenring J.R.
      J. Biol. Chem. 277:40973-40980(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH AKAP9, SUBCELLULAR LOCATION.
      Tissue: Colon adenocarcinoma.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Placenta and Small intestine.
    4. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
      Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
      , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
      DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Placenta.
    5. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Kidney.
    8. "CLIC-5A functions as a chloride channel in vitro and associates with the cortical actin cytoskeleton in vitro and in vivo."
      Berryman M., Bruno J., Price J., Edwards J.C.
      J. Biol. Chem. 279:34794-34801(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION (ISOFORM 1).
    9. "Functional reconstitution of mammalian 'chloride intracellular channels' CLIC1, CLIC4 and CLIC5 reveals differential regulation by cytoskeletal actin."
      Singh H., Cousin M.A., Ashley R.H.
      FEBS J. 274:6306-6316(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH F-ACTIN.
    10. "CLIC5A, a component of the ezrin-podocalyxin complex in glomeruli, is a determinant of podocyte integrity."
      Wegner B., Al-Momany A., Kulak S.C., Kozlowski K., Obeidat M., Jahroudi N., Paes J., Berryman M., Ballermann B.J.
      Am. J. Physiol. 298:F1492-F1503(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: TISSUE SPECIFICITY, FUNCTION.

    Entry informationi

    Entry nameiCLIC5_HUMAN
    AccessioniPrimary (citable) accession number: Q9NZA1
    Secondary accession number(s): B3KUF1
    , Q5T4Z0, Q8NBY3, Q96JT5, Q9BWZ0
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 27, 2002
    Last sequence update: November 25, 2008
    Last modified: October 1, 2014
    This is version 135 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3