Q9NZA1 (CLIC5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 120.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Chloride intracellular channel protein 5 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 410 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Can insert into membranes and form poorly selective ion channels that may also transport chloride ions. May play a role in the regulation of transepithelial ion absorption and secretion. Required for normal formation of stereocilia in the inner ear and normal development of the organ of Corti By similarity. Is required for the development and/or maintenance of the proper glomerular endothelial cell and podocyte architecture. Ref.8 Ref.9 Ref.10 |
| Subunit structure | Component of a multimeric complex consisting of several cytoskeletal proteins, including actin, ezrin, alpha-actinin, gelsolin, and IQGAP1. Interacts with AKAP9. Ref.2 Ref.9 |
| Subcellular location | Isoform 1: Cytoplasm › cell cortex. Cytoplasm › cytoskeleton. Membrane; Single-pass membrane protein. Note: Associates with the cortical actin cytoskeleton. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain By similarity. Ref.2 Ref.8 Ref.9 Isoform 2: Golgi apparatus. Cytoplasm › cytoskeleton › centrosome. Membrane; Single-pass membrane protein. Note: Colocalized with AKAP9 at the Golgi apparatus as well as, to a lesser extent, the centrosome. Exists both as soluble cytoplasmic protein and as membrane protein with probably a single transmembrane domain By similarity. Colocalized with podocalyxin in renal glomeruli. Ref.2 Ref.8 Ref.9 |
| Tissue specificity | Isoform 1 is expressed in renal glomeruli endothelial cells and podocytes (at protein level). Ref.10 |
| Domain | Members of this family may change from a globular, soluble state to a state where the N-terminal domain is inserted into the membrane and functions as chloride channel. A conformation change of the N-terminal domain is thought to expose hydrophobic surfaces that trigger membrane insertion By similarity. |
| Sequence similarities | Belongs to the chloride channel CLIC family. Contains 1 GST C-terminal domain. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 2 (identifier: Q9NZA1-1) Also known as: CLIC5B; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 1 (identifier: Q9NZA1-2) Also known as: CLIC5A; The sequence of this isoform differs from the canonical sequence as follows: 1-159: Missing. 160-180: AEGLEEKEGAHMNPEIYLFVK → MTDSATANGDDRDPEIELFVK | ||||||
| Isoform 3 (identifier: Q9NZA1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-17: MNDEDYSTIYDTIQNER → MTDSATANGDDRDPEIE 18-176: Missing. 356-410: IVAKKYRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRS → EQVPLKGMI | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 410 | 410 | Chloride intracellular channel protein 5 | PRO_0000144214 | |||||
Regions | |||||||||
| Transmembrane | 193 – 213 | 21 | Helical; Note=After insertion into the membrane; Potential | ||||||
| Domain | 260 – 400 | 141 | GST C-terminal | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 159 | 159 | Missing in isoform 1. | VSP_000869 | |||||
| Alternative sequence | 1 – 17 | 17 | MNDED…IQNER → MTDSATANGDDRDPEIE in isoform 3. | VSP_044889 | |||||
| Alternative sequence | 18 – 176 | 159 | Missing in isoform 3. | VSP_044890 | |||||
| Alternative sequence | 160 – 180 | 21 | AEGLE…YLFVK → MTDSATANGDDRDPEIELFV K in isoform 1. | VSP_000870 | |||||
| Alternative sequence | 356 – 410 | 55 | IVAKK…RLSRS → EQVPLKGMI in isoform 3. | VSP_044891 | |||||
| Natural variant | 114 | 1 | T → A. Corresponds to variant rs723580 [ dbSNP | Ensembl ]. | VAR_059208 | |||||
| Natural variant | 257 | 1 | P → H. Corresponds to variant rs35822882 [ dbSNP | Ensembl ]. | VAR_047541 | |||||
Experimental info | |||||||||
| Sequence conflict | 201 | 1 | L → F in AAK52083. Ref.2 | ||||||
| Isoform 1: | |||||||||
| Sequence conflict | 12 | 1 | R → S in AAF66928. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel member of the chloride intracellular channel gene family (CLIC5) that associates with the actin cytoskeleton of placental microvilli." Berryman M., Bretscher A. Mol. Biol. Cell 11:1509-1521(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "AKAP350 at the Golgi apparatus. II. Association of AKAP350 with a novel chloride intracellular channel (CLIC) family member." Shanks R.A., Larocca M.C., Berryman M., Edwards J.C., Urushidani T., Navarre J., Goldenring J.R. J. Biol. Chem. 277:40973-40980(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH AKAP9, SUBCELLULAR LOCATION. Tissue: Colon adenocarcinoma. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Placenta and Small intestine. |
| [4] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Placenta. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [8] | "CLIC-5A functions as a chloride channel in vitro and associates with the cortical actin cytoskeleton in vitro and in vivo." Berryman M., Bruno J., Price J., Edwards J.C. J. Biol. Chem. 279:34794-34801(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION (ISOFORM 1). |
| [9] | "Functional reconstitution of mammalian 'chloride intracellular channels' CLIC1, CLIC4 and CLIC5 reveals differential regulation by cytoskeletal actin." Singh H., Cousin M.A., Ashley R.H. FEBS J. 274:6306-6316(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH F-ACTIN. |
| [10] | "CLIC5A, a component of the ezrin-podocalyxin complex in glomeruli, is a determinant of podocyte integrity." Wegner B., Al-Momany A., Kulak S.C., Kozlowski K., Obeidat M., Jahroudi N., Paes J., Berryman M., Ballermann B.J. Am. J. Physiol. 298:F1492-F1503(2010) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF216941 mRNA. Translation: AAF66928.1. AY032602 mRNA. Translation: AAK52083.1. AK075163 mRNA. Translation: BAC11444.1. AK097048 mRNA. Translation: BAG53413.1. AK075144 mRNA. Translation: BAC11432.1. AL050336, AL357057 Genomic DNA. Translation: CAI21030.1. AL050336, AL357057 Genomic DNA. Translation: CAI21031.1. AL355522 Genomic DNA. No translation available. AL591211 Genomic DNA. No translation available. CH471081 Genomic DNA. Translation: EAX04286.1. CH471081 Genomic DNA. Translation: EAX04287.1. BC035968 mRNA. Translation: AAH35968.1. |
| IPI | IPI00027193. IPI00294443. IPI00844301. |
| RefSeq | NP_001107558.1. NM_001114086.1. NP_001242952.1. NM_001256023.1. NP_058625.2. NM_016929.4. |
| UniGene | Hs.485489. Hs.734348. |
3D structure databases | |
| ProteinModelPortal | Q9NZA1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NZA1. 2 interactions. |
| STRING | 9606.ENSP00000185206. |
PTM databases | |
| PhosphoSite | Q9NZA1. |
Polymorphism databases | |
| DMDM | 215274174. |
2D gel databases | |
| OGP | Q9NZA1. |
Proteomic databases | |
| PaxDb | Q9NZA1. |
| PRIDE | Q9NZA1. |
Protocols and materials databases | |
| DNASU | 53405. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000185206; ENSP00000185206; ENSG00000112782. ENST00000339561; ENSP00000344165; ENSG00000112782. ENST00000544153; ENSP00000439195; ENSG00000112782. |
| GeneID | 53405. |
| KEGG | hsa:53405. |
| UCSC | uc003oxv.3. human. |
Organism-specific databases | |
| CTD | 53405. |
| GeneCards | GC06M045848. |
| HGNC | HGNC:13517. CLIC5. |
| MIM | 607293. gene. |
| neXtProt | NX_Q9NZA1. |
| PharmGKB | PA26592. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG282171. |
| HOGENOM | HOG000065740. |
| HOVERGEN | HBG050995. |
| InParanoid | Q9NZA1. |
| KO | K05025. |
| OMA | NGDDRDP. |
| OrthoDB | EOG40S0FN. |
| PhylomeDB | Q9NZA1. |
Gene expression databases | |
| ArrayExpress | Q9NZA1. |
| Bgee | Q9NZA1. |
| CleanEx | HS_CLIC5. |
| Genevestigator | Q9NZA1. |
| GermOnline | ENSG00000112782. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.20.1050.10. 1 hit. 3.40.30.10. 1 hit. |
| InterPro | IPR010987. Glutathione-S-Trfase_C-like. IPR017933. Glutathione_S_Trfase/Cl_chnl_C. IPR002946. Int_Cl_channel. IPR012336. Thioredoxin-like_fold. [Graphical view] |
| PRINTS | PR01263. INTCLCHANNEL. |
| SUPFAM | SSF47616. GST_C_like. 1 hit. SSF52833. Thiordxn-like_fd. 1 hit. |
| TIGRFAMs | TIGR00862. O-ClC. 1 hit. |
| PROSITE | PS50405. GST_CTER. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 53405. |
| NextBio | 56076. |
| SOURCE | Search... |
Entry information
| Entry name | CLIC5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NZA1 Secondary accession number(s): B3KUF1 Q9BWZ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
