Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ADP-ribosylation factor-binding protein GGA3

Gene

GGA3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (AC-LL) motif.1 Publication

GO - Molecular functioni

  • ADP-ribosylation factor binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Protein transport, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125447-MONOMER.
ReactomeiR-HSA-8875656. MET receptor recycling.
R-HSA-977225. Amyloid fiber formation.

Names & Taxonomyi

Protein namesi
Recommended name:
ADP-ribosylation factor-binding protein GGA3
Alternative name(s):
Golgi-localized, gamma ear-containing, ARF-binding protein 3
Gene namesi
Name:GGA3
Synonyms:KIAA0154
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:17079. GGA3.

Subcellular locationi

GO - Cellular componenti

  • clathrin adaptor complex Source: InterPro
  • endosome membrane Source: Reactome
  • trans-Golgi network Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Endosome, Golgi apparatus, Membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi194N → A: Loss of interaction with ARF1 and Golgi localization. 1 Publication1
Mutagenesisi199S → P: Loss of interaction with ARF1 and Golgi localization. 1 Publication1
Mutagenesisi217T → P: Loss of interaction with ARF1 and Golgi localization. 1 Publication1
Mutagenesisi247L → P: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi258K → M: No effect. Confers an affinity to RABEP1 identical to GGA1; when associated with N-283. 1 Publication1
Mutagenesisi262L → S: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi276L → A: Loss of UBC-binding and ubiquitination. 2 Publications1
Mutagenesisi276L → S: Loss of UBC-binding and ubiquitination. 2 Publications1
Mutagenesisi280L → R: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi283S → N: Can bind RABEP1. Confers an affinity to RABEP1 identical to GGA1; when associated with M-258. 1 Publication1
Mutagenesisi284D → G: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi293Y → H: Loss of UBC-binding and ubiquitination. 1 Publication1
Mutagenesisi391 – 395DEELL → AAAAA: Increased binding to IGF2R. 1 Publication5

Organism-specific databases

DisGeNETi23163.
OpenTargetsiENSG00000125447.
PharmGKBiPA28659.

Polymorphism and mutation databases

BioMutaiGGA3.
DMDMi14548064.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002126841 – 723ADP-ribosylation factor-binding protein GGA3Add BLAST723

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei159PhosphoserineCombined sources1
Modified residuei275PhosphoserineCombined sources1

Post-translational modificationi

Phosphorylated by CK2 and dephosphorylated by PP2A (By similarity). Phosphorylation of GGA3 allows the internal AC-LL motif to bind the VHS domain and to inhibit the recognition of cargo signals.By similarity
Ubiquitinated.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ9NZ52.
MaxQBiQ9NZ52.
PaxDbiQ9NZ52.
PeptideAtlasiQ9NZ52.
PRIDEiQ9NZ52.

PTM databases

iPTMnetiQ9NZ52.
PhosphoSitePlusiQ9NZ52.

Expressioni

Tissue specificityi

Ubiquitously expressed.

Gene expression databases

BgeeiENSG00000125447.
CleanExiHS_GGA3.
ExpressionAtlasiQ9NZ52. baseline and differential.
GenevisibleiQ9NZ52. HS.

Organism-specific databases

HPAiHPA022945.

Interactioni

Subunit structurei

Monomer. Interacts with SORT1, SORL1, LRP3, GGA binding partner (GGABP) and P200 (By similarity). Interacts with GGA1 and GGA2. Binds to clathrin and activated ARFs. Binds RABEP1 and RABGEF1. Interacts with the membrane proteins M6PR/CD-MPR, IGF2R/CI-MPR and BACE1 and the accessory proteins SYNRG, EPN4, NECAP1, NECAP2 and AFTPH/aftiphilin. Interacts with TSG101 and UBC.By similarity13 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PACS1Q6VY075EBI-447404,EBI-2555014
RABEP1Q152764EBI-447404,EBI-447043
UBBP0CG472EBI-447404,EBI-413034

GO - Molecular functioni

  • ADP-ribosylation factor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi116775. 36 interactors.
DIPiDIP-31600N.
IntActiQ9NZ52. 23 interactors.
MINTiMINT-126320.
STRINGi9606.ENSP00000245541.

Structurei

Secondary structure

1723
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi9 – 16Combined sources8
Helixi26 – 38Combined sources13
Helixi42 – 54Combined sources13
Helixi59 – 75Combined sources17
Helixi77 – 84Combined sources8
Helixi87 – 97Combined sources11
Helixi99 – 103Combined sources5
Helixi108 – 124Combined sources17
Helixi129 – 140Combined sources12
Helixi218 – 231Combined sources14
Turni232 – 234Combined sources3
Turni237 – 239Combined sources3
Helixi242 – 267Combined sources26
Helixi276 – 290Combined sources15
Helixi292 – 295Combined sources4
Turni296 – 298Combined sources3
Helixi588 – 590Combined sources3
Beta strandi599 – 604Combined sources6
Beta strandi607 – 616Combined sources10
Beta strandi624 – 633Combined sources10
Beta strandi635 – 637Combined sources3
Beta strandi639 – 647Combined sources9
Beta strandi652 – 656Combined sources5
Beta strandi675 – 683Combined sources9
Beta strandi692 – 700Combined sources9
Beta strandi703 – 711Combined sources9
Helixi717 – 719Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JPLX-ray2.40A/B/C/D1-166[»]
1JUQX-ray2.20A/B/C/D1-166[»]
1LF8X-ray2.30A/B/C/D1-166[»]
1P4UX-ray2.20A571-723[»]
1WR6X-ray2.60A/B/C/D209-319[»]
1YD8X-ray2.80G/H208-301[»]
ProteinModelPortaliQ9NZ52.
SMRiQ9NZ52.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NZ52.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini16 – 146VHSPROSITE-ProRule annotationAdd BLAST131
Domaini171 – 298GATPROSITE-ProRule annotationAdd BLAST128
Domaini594 – 715GAEPROSITE-ProRule annotationAdd BLAST122

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 313Binds to ARF1 (in long isoform)Add BLAST313
Regioni299 – 593Unstructured hingeAdd BLAST295

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi391 – 395Autoinhibitory5

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi357 – 360Poly-Pro4
Compositional biasi453 – 457Poly-Ser5
Compositional biasi624 – 629Poly-Val6

Domaini

The VHS domain functions as a recognition module for sorting signals composed of an acidic cluster followed by two leucines (AC-LL motif).
The GAT domain is responsible for interaction with ARF-GTP, UBC and RABEP1. Required for recruitment to the TGN it prevents ARF-GTP hydrolysis.
The unstructured hinge region contains clathrin-binding and an autoinhibitory (AC-LL) motifs.
The GAE domain binds accessory proteins regulating GGAs function.

Sequence similaritiesi

Belongs to the GGA protein family.Curated
Contains 1 GAE domain.PROSITE-ProRule annotation
Contains 1 GAT domain.PROSITE-ProRule annotation
Contains 1 VHS domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG1087. Eukaryota.
ENOG410Y26G. LUCA.
GeneTreeiENSGT00860000133703.
HOGENOMiHOG000231169.
HOVERGENiHBG015945.
InParanoidiQ9NZ52.
KOiK12404.
OMAiQGSPMKG.
OrthoDBiEOG091G0BQK.
PhylomeDBiQ9NZ52.
TreeFamiTF318574.

Family and domain databases

Gene3Di1.20.58.160. 1 hit.
1.25.40.90. 1 hit.
2.60.40.1230. 1 hit.
InterProiIPR008152. Clathrin_a/b/g-adaptin_app_Ig.
IPR008153. Clathrin_g-adaptin_app.
IPR013041. Coatomer/clathrin_app_Ig-like.
IPR008942. ENTH_VHS.
IPR004152. GAT_dom.
IPR027422. GGA3.
IPR002014. VHS_dom.
[Graphical view]
PANTHERiPTHR13856:SF34. PTHR13856:SF34. 3 hits.
PfamiPF02883. Alpha_adaptinC2. 1 hit.
PF03127. GAT. 1 hit.
PF00790. VHS. 1 hit.
[Graphical view]
SMARTiSM00809. Alpha_adaptinC2. 1 hit.
SM00288. VHS. 1 hit.
[Graphical view]
SUPFAMiSSF48464. SSF48464. 1 hit.
SSF49348. SSF49348. 1 hit.
PROSITEiPS50180. GAE. 1 hit.
PS50909. GAT. 1 hit.
PS50179. VHS. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Long (identifier: Q9NZ52-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAEAEGESLE SWLNKATNPS NRQEDWEYII GFCDQINKEL EGPQIAVRLL
60 70 80 90 100
AHKIQSPQEW EALQALTVLE ACMKNCGRRF HNEVGKFRFL NELIKVVSPK
110 120 130 140 150
YLGDRVSEKV KTKVIELLYS WTMALPEEAK IKDAYHMLKR QGIVQSDPPI
160 170 180 190 200
PVDRTLIPSP PPRPKNPVFD DEEKSKLLAK LLKSKNPDDL QEANKLIKSM
210 220 230 240 250
VKEDEARIQK VTKRLHTLEE VNNNVRLLSE MLLHYSQEDS SDGDRELMKE
260 270 280 290 300
LFDQCENKRR TLFKLASETE DNDNSLGDIL QASDNLSRVI NSYKTIIEGQ
310 320 330 340 350
VINGEVATLT LPDSEGNSQC SNQGTLIDLA ELDTTNSLSS VLAPAPTPPS
360 370 380 390 400
SGIPILPPPP QASGPPRSRS SSQAEATLGP SSTSNALSWL DEELLCLGLA
410 420 430 440 450
DPAPNVPPKE SAGNSQWHLL QREQSDLDFF SPRPGTAACG ASDAPLLQPS
460 470 480 490 500
APSSSSSQAP LPPPFPAPVV PASVPAPSAG SSLFSTGVAP ALAPKVEPAV
510 520 530 540 550
PGHHGLALGN SALHHLDALD QLLEEAKVTS GLVKPTTSPL IPTTTPARPL
560 570 580 590 600
LPFSTGPGSP LFQPLSFQSQ GSPPKGPELS LASIHVPLES IKPSSALPVT
610 620 630 640 650
AYDKNGFRIL FHFAKECPPG RPDVLVVVVS MLNTAPLPVK SIVLQAAVPK
660 670 680 690 700
SMKVKLQPPS GTELSPFSPI QPPAAITQVM LLANPLKEKV RLRYKLTFAL
710 720
GEQLSTEVGE VDQFPPVEQW GNL
Length:723
Mass (Da):78,315
Last modified:October 1, 2000 - v1
Checksum:i4F80D6032239168C
GO
Isoform Short (identifier: Q9NZ52-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-100: Missing.

Show »
Length:690
Mass (Da):74,470
Checksum:iE3A1C841AB3966C8
GO
Isoform 3 (identifier: Q9NZ52-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-122: Missing.
     688-723: EKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL → KQVLSFLGKACLQPWGQAILLTTSCLA

Show »
Length:592
Mass (Da):62,921
Checksum:iCACD3268CEE80BBE
GO
Isoform 4 (identifier: Q9NZ52-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Note: No experimental confirmation available.
Show »
Length:651
Mass (Da):70,148
Checksum:i416484203E34542A
GO

Sequence cautioni

The sequence BAA09926 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti448Q → K in AAH70044 (PubMed:15489334).Curated1
Sequence conflicti562F → S in BAH13665 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_075715132K → R.1 PublicationCorresponds to variant rs117805695dbSNPEnsembl.1
Natural variantiVAR_075716321S → G.1 PublicationCorresponds to variant rs146877619dbSNPEnsembl.1
Natural variantiVAR_036524574P → L in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant rs776324450dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451331 – 122Missing in isoform 3. 1 PublicationAdd BLAST122
Alternative sequenceiVSP_0468681 – 72Missing in isoform 4. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_00174568 – 100Missing in isoform Short. 4 PublicationsAdd BLAST33
Alternative sequenceiVSP_045134688 – 723EKVRL…QWGNL → KQVLSFLGKACLQPWGQAIL LTTSCLA in isoform 3. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF219138 mRNA. Translation: AAF42848.1.
AF190864 mRNA. Translation: AAF05709.1.
AF219139 mRNA. Translation: AAF42849.1.
D63876 mRNA. Translation: BAA09926.1. Different initiation.
AK301895 mRNA. Translation: BAH13578.1.
AK302278 mRNA. Translation: BAH13665.1.
AC022211 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89258.1.
BC070044 mRNA. Translation: AAH70044.1.
CCDSiCCDS11716.1. [Q9NZ52-2]
CCDS11717.1. [Q9NZ52-1]
CCDS54164.1. [Q9NZ52-4]
CCDS58597.1. [Q9NZ52-3]
RefSeqiNP_001166174.1. NM_001172703.2. [Q9NZ52-4]
NP_001166175.1. NM_001172704.2. [Q9NZ52-3]
NP_001278570.1. NM_001291641.1. [Q9NZ52-4]
NP_001278571.1. NM_001291642.1.
NP_054720.1. NM_014001.4. [Q9NZ52-2]
NP_619525.1. NM_138619.3. [Q9NZ52-1]
UniGeneiHs.87726.

Genome annotation databases

EnsembliENST00000537686; ENSP00000438085; ENSG00000125447. [Q9NZ52-1]
ENST00000538886; ENSP00000446421; ENSG00000125447. [Q9NZ52-2]
ENST00000578348; ENSP00000463288; ENSG00000125447. [Q9NZ52-3]
ENST00000582717; ENSP00000462081; ENSG00000125447. [Q9NZ52-4]
GeneIDi23163.
KEGGihsa:23163.
UCSCiuc010wrw.3. human. [Q9NZ52-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF219138 mRNA. Translation: AAF42848.1.
AF190864 mRNA. Translation: AAF05709.1.
AF219139 mRNA. Translation: AAF42849.1.
D63876 mRNA. Translation: BAA09926.1. Different initiation.
AK301895 mRNA. Translation: BAH13578.1.
AK302278 mRNA. Translation: BAH13665.1.
AC022211 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89258.1.
BC070044 mRNA. Translation: AAH70044.1.
CCDSiCCDS11716.1. [Q9NZ52-2]
CCDS11717.1. [Q9NZ52-1]
CCDS54164.1. [Q9NZ52-4]
CCDS58597.1. [Q9NZ52-3]
RefSeqiNP_001166174.1. NM_001172703.2. [Q9NZ52-4]
NP_001166175.1. NM_001172704.2. [Q9NZ52-3]
NP_001278570.1. NM_001291641.1. [Q9NZ52-4]
NP_001278571.1. NM_001291642.1.
NP_054720.1. NM_014001.4. [Q9NZ52-2]
NP_619525.1. NM_138619.3. [Q9NZ52-1]
UniGeneiHs.87726.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
1JPLX-ray2.40A/B/C/D1-166[»]
1JUQX-ray2.20A/B/C/D1-166[»]
1LF8X-ray2.30A/B/C/D1-166[»]
1P4UX-ray2.20A571-723[»]
1WR6X-ray2.60A/B/C/D209-319[»]
1YD8X-ray2.80G/H208-301[»]
ProteinModelPortaliQ9NZ52.
SMRiQ9NZ52.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116775. 36 interactors.
DIPiDIP-31600N.
IntActiQ9NZ52. 23 interactors.
MINTiMINT-126320.
STRINGi9606.ENSP00000245541.

PTM databases

iPTMnetiQ9NZ52.
PhosphoSitePlusiQ9NZ52.

Polymorphism and mutation databases

BioMutaiGGA3.
DMDMi14548064.

Proteomic databases

EPDiQ9NZ52.
MaxQBiQ9NZ52.
PaxDbiQ9NZ52.
PeptideAtlasiQ9NZ52.
PRIDEiQ9NZ52.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000537686; ENSP00000438085; ENSG00000125447. [Q9NZ52-1]
ENST00000538886; ENSP00000446421; ENSG00000125447. [Q9NZ52-2]
ENST00000578348; ENSP00000463288; ENSG00000125447. [Q9NZ52-3]
ENST00000582717; ENSP00000462081; ENSG00000125447. [Q9NZ52-4]
GeneIDi23163.
KEGGihsa:23163.
UCSCiuc010wrw.3. human. [Q9NZ52-1]

Organism-specific databases

CTDi23163.
DisGeNETi23163.
GeneCardsiGGA3.
HGNCiHGNC:17079. GGA3.
HPAiHPA022945.
MIMi606006. gene.
neXtProtiNX_Q9NZ52.
OpenTargetsiENSG00000125447.
PharmGKBiPA28659.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1087. Eukaryota.
ENOG410Y26G. LUCA.
GeneTreeiENSGT00860000133703.
HOGENOMiHOG000231169.
HOVERGENiHBG015945.
InParanoidiQ9NZ52.
KOiK12404.
OMAiQGSPMKG.
OrthoDBiEOG091G0BQK.
PhylomeDBiQ9NZ52.
TreeFamiTF318574.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000125447-MONOMER.
ReactomeiR-HSA-8875656. MET receptor recycling.
R-HSA-977225. Amyloid fiber formation.

Miscellaneous databases

EvolutionaryTraceiQ9NZ52.
GeneWikiiGGA3.
GenomeRNAii23163.
PROiQ9NZ52.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125447.
CleanExiHS_GGA3.
ExpressionAtlasiQ9NZ52. baseline and differential.
GenevisibleiQ9NZ52. HS.

Family and domain databases

Gene3Di1.20.58.160. 1 hit.
1.25.40.90. 1 hit.
2.60.40.1230. 1 hit.
InterProiIPR008152. Clathrin_a/b/g-adaptin_app_Ig.
IPR008153. Clathrin_g-adaptin_app.
IPR013041. Coatomer/clathrin_app_Ig-like.
IPR008942. ENTH_VHS.
IPR004152. GAT_dom.
IPR027422. GGA3.
IPR002014. VHS_dom.
[Graphical view]
PANTHERiPTHR13856:SF34. PTHR13856:SF34. 3 hits.
PfamiPF02883. Alpha_adaptinC2. 1 hit.
PF03127. GAT. 1 hit.
PF00790. VHS. 1 hit.
[Graphical view]
SMARTiSM00809. Alpha_adaptinC2. 1 hit.
SM00288. VHS. 1 hit.
[Graphical view]
SUPFAMiSSF48464. SSF48464. 1 hit.
SSF49348. SSF49348. 1 hit.
PROSITEiPS50180. GAE. 1 hit.
PS50909. GAT. 1 hit.
PS50179. VHS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGGA3_HUMAN
AccessioniPrimary (citable) accession number: Q9NZ52
Secondary accession number(s): B7Z7E2
, B7Z7M9, J3KRN0, Q15017, Q6IS16, Q9UJY3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 20, 2001
Last sequence update: October 1, 2000
Last modified: November 30, 2016
This is version 176 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.