Q9NZ52 (GGA3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 139.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: ADP-ribosylation factor-binding protein GGA3 Alternative name(s): Golgi-localized, gamma ear-containing, ARF-binding protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 723 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in protein sorting and trafficking between the trans-Golgi network (TGN) and endosomes. Mediates the ARF-dependent recruitment of clathrin to the TGN and binds ubiquitinated proteins and membrane cargo molecules with a cytosolic acidic cluster-dileucine (AC-LL) motif. Ref.8 |
| Subunit structure | Monomer. Interacts with SORT1, SORL1, LRP3, GGA binding partner (GGABP) and P200 By similarity. Interacts with GGA1 and GGA2. Binds to clathrin and activated ARFs. Binds RABEP1 and RABGEF1. Interacts with the membrane proteins M6PR/CD-MPR, IGF2R/CI-MPR and BACE1 and the accessory proteins SYNRG, EPN4, NECAP1, NECAP2 and AFTPH/aftiphilin. Interacts with TSG101 and UBC. Ref.7 Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 |
| Subcellular location | Golgi apparatus › trans-Golgi network membrane; Peripheral membrane protein. Endosome membrane; Peripheral membrane protein Ref.19. |
| Tissue specificity | Ubiquitously expressed. |
| Domain | The VHS domain functions as a recognition module for sorting signals composed of an acidic cluster followed by two leucines (AC-LL motif). The GAT domain is responsible for interaction with ARF-GTP, UBC and RABEP1. Required for recruitment to the TGN it prevents ARF-GTP hydrolysis. The unstructured hinge region contains clathrin-binding and an autoinhibitory (AC-LL) motifs. The GAE domain binds accessory proteins regulating GGAs function. |
| Post-translational modification | Phosphorylated by CK2 and dephosphorylated by PP2A By similarity. Phosphorylation of GGA3 allows the internal AC-LL motif to bind the VHS domain and to inhibit the recognition of cargo signals. Ubiquitinated. Ref.16 |
| Sequence similarities | Belongs to the GGA protein family. Contains 1 GAE domain. Contains 1 GAT domain. Contains 1 VHS domain. |
| Sequence caution | The sequence BAA09926.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Protein transport Transport |
| Cellular component | Endosome Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein Ubl conjugation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | intracellular protein transport Non-traceable author statement Ref.2. Source: UniProtKB vesicle-mediated transportInferred from electronic annotation. Source: InterPro |
| Cellular_component | Golgi apparatus part Inferred from electronic annotation. Source: InterPro clathrin adaptor complexInferred from electronic annotation. Source: InterPro endosome membraneInferred from electronic annotation. Source: UniProtKB-SubCell trans-Golgi networkInferred from direct assay Ref.2. Source: UniProtKB |
| Molecular_function | ADP-ribosylation factor binding Inferred from direct assay Ref.2. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| RABEP1 | Q15276 | 4 | EBI-447404,EBI-447043 | |
| UBB | P0CG47 | 2 | EBI-447404,EBI-413034 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Long (identifier: Q9NZ52-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Short (identifier: Q9NZ52-2) The sequence of this isoform differs from the canonical sequence as follows: 68-100: Missing. | ||||||
| Isoform 3 (identifier: Q9NZ52-3) The sequence of this isoform differs from the canonical sequence as follows: 1-122: Missing. 688-723: EKVRLRYKLTFALGEQLSTEVGEVDQFPPVEQWGNL → KQVLSFLGKACLQPWGQAILLTTSCLA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 723 | 723 | ADP-ribosylation factor-binding protein GGA3 | PRO_0000212684 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 16 – 146 | 131 | VHS | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 171 – 298 | 128 | GAT | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 594 – 715 | 122 | GAE | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 1 – 313 | 313 | Binds to ARF1 (in long isoform) | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Region | 299 – 593 | 295 | Unstructured hinge | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Motif | 391 – 395 | 5 | Autoinhibitory | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 357 – 360 | 4 | Poly-Pro | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 453 – 457 | 5 | Poly-Ser | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 624 – 629 | 6 | Poly-Val | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 122 | 122 | Missing in isoform 3. | VSP_045133 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 68 – 100 | 33 | Missing in isoform Short. | VSP_001745 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 688 – 723 | 36 | EKVRL…QWGNL → KQVLSFLGKACLQPWGQAIL LTTSCLA in isoform 3. | VSP_045134 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 574 | 1 | P → L in a breast cancer sample; somatic mutation. Ref.22 | VAR_036524 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 194 | 1 | N → A: Loss of interaction with ARF1 and Golgi localization. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 199 | 1 | S → P: Loss of interaction with ARF1 and Golgi localization. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 217 | 1 | T → P: Loss of interaction with ARF1 and Golgi localization. Ref.8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 247 | 1 | L → P: Loss of UBC-binding and ubiquitination. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 258 | 1 | K → M: No effect. Confers an affinity to RABEP1 identical to GGA1; when associated with N-283. Ref.18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 262 | 1 | L → S: Loss of UBC-binding and ubiquitination. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 276 | 1 | L → A: Loss of UBC-binding and ubiquitination. Ref.16 Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 276 | 1 | L → S: Loss of UBC-binding and ubiquitination. Ref.16 Ref.19 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 280 | 1 | L → R: Loss of UBC-binding and ubiquitination. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 283 | 1 | S → N: Can bind RABEP1. Confers an affinity to RABEP1 identical to GGA1; when associated with M-258. Ref.18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 284 | 1 | D → G: Loss of UBC-binding and ubiquitination. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 293 | 1 | Y → H: Loss of UBC-binding and ubiquitination. Ref.16 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 391 – 395 | 5 | DEELL → AAAAA: Increased binding to IGF2R. Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 448 | 1 | Q → K in AAH70044. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 9 – 16 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 26 – 38 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 42 – 54 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 59 – 75 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 77 – 84 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 87 – 97 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 99 – 103 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 108 – 124 | 17 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 129 – 140 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 218 – 231 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 232 – 234 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 237 – 239 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 242 – 267 | 26 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 276 – 290 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 292 – 295 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 296 – 298 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 588 – 590 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 599 – 604 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 607 – 616 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 624 – 633 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 635 – 637 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 639 – 647 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 652 – 656 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 675 – 683 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 692 – 700 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 703 – 711 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 717 – 719 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "GGAs: a family of ADP ribosylation factor-binding proteins related to adaptors and associated with the Golgi complex." Dell'Angelica E.C., Puertollano R., Mullins C., Aguilar R.C., Vargas J.D., Hartnell L.M., Bonifacino J.S. J. Cell Biol. 149:81-94(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS LONG AND SHORT). Tissue: Heart. |
| [2] | "A family of ADP-ribosylation factor effectors that can alter transport through the trans-Golgi." Boman A.L., Zhang C.-J., Zhu X., Kahn R.A. Mol. Biol. Cell 11:1241-1255(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM SHORT). |
| [3] | "Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1." Nagase T., Seki N., Tanaka A., Ishikawa K., Nomura N. DNA Res. 2:167-174(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). Tissue: Bone marrow. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Testis. |
| [5] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM SHORT). Tissue: Brain. |
| [7] | "Adaptor gamma ear homology domain conserved in gamma-adaptin and GGA proteins that interact with gamma-synergin." Takatsu H., Yoshino K., Nakayama K. Biochem. Biophys. Res. Commun. 271:719-725(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SYNRG. |
| [8] | "The GGAs promote ARF-dependent recruitment of clathrin to the TGN." Puertollano R., Randazzo P.A., Presley J.F., Hartnell L.M., Bonifacino J.S. Cell 105:93-102(2001) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF ASN-194; SER-199 AND THR-217, INTERACTION WITH ARF1 AND CLATHRIN, FUNCTION. |
| [9] | "Sorting of mannose 6-phosphate receptors mediated by the GGAs." Puertollano R., Aguilar R.C., Gorshkova I., Crouch R.J., Bonifacino J.S. Science 292:1712-1716(2001) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH M6PR AND IGF2R. |
| [10] | "GGA proteins associate with Golgi membranes through interaction between their GGAH domains and ADP-ribosylation factors." Takatsu H., Yoshino K., Toda K., Nakayama K. Biochem. J. 365:369-378(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARF1; ARF5 AND ARF6. |
| [11] | "Enthoprotin: a novel clathrin-associated protein identified through subcellular proteomics." Wasiak S., Legendre-Guillemin V., Puertollano R., Blondeau F., Girard M., de Heuvel E., Boismenu D., Bell A.W., Bonifacino J.S., McPherson P.S. J. Cell Biol. 158:855-862(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EPN4. |
| [12] | "Autoinhibition of the ligand-binding site of GGA1/3 VHS domains by an internal acidic cluster-dileucine motif." Doray B., Bruns K., Ghosh P., Kornfeld S.A. Proc. Natl. Acad. Sci. U.S.A. 99:8072-8077(2002) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF 391-ASP--LEU-395, INTERACTION WITH IGF2R, AUTOINHIBITION. |
| [13] | "Biochemical and structural characterization of the interaction of memapsin 2 (beta-secretase) cytosolic domain with the VHS domain of GGA proteins." He X., Zhu G., Koelsch G., Rodgers K.K., Zhang X.C., Tang J. Biochemistry 42:12174-12180(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BACE1. |
| [14] | "Divalent interaction of the GGAs with the Rabaptin-5-Rabex-5 complex." Mattera R., Arighi C.N., Lodge R., Zerial M., Bonifacino J.S. EMBO J. 22:78-88(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RABEP1 AND RABGEF1. |
| [15] | "Mammalian GGAs act together to sort mannose 6-phosphate receptors." Ghosh P., Griffith J., Geuze H.J., Kornfeld S. J. Cell Biol. 163:755-766(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH GGA1 AND GGA2. |
| [16] | "GAT (GGA and Tom1) domain responsible for ubiquitin binding and ubiquitination." Shiba Y., Katoh Y., Shiba T., Yoshino K., Takatsu H., Kobayashi H., Shin H.-W., Wakatsuki S., Nakayama K. J. Biol. Chem. 279:7105-7111(2004) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF LEU-247; LEU-262; LEU-276; LEU-280; ASP-284 AND TYR-293, INTERACTION WITH UBC, UBIQUITINATION. |
| [17] | "Definition of the consensus motif recognized by gamma-adaptin ear domains." Mattera R., Ritter B., Sidhu S.S., McPherson P.S., Bonifacino J.S. J. Biol. Chem. 279:8018-8028(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NECAP1; NECAP2 AND AFTPH. |
| [18] | "The trihelical bundle subdomain of the GGA proteins interacts with multiple partners through overlapping but distinct sites." Mattera R., Puertollano R., Smith W.J., Bonifacino J.S. J. Biol. Chem. 279:31409-31418(2004) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF LYS-258 AND SER-283, INTERACTION WITH RABEP1. |
| [19] | "Interactions of GGA3 with the ubiquitin sorting machinery." Puertollano R., Bonifacino J.S. Nat. Cell Biol. 6:244-251(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, MUTAGENESIS OF LEU-276, INTERACTION WITH UBC AND TSG101. |
| [20] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [21] | "Phosphoregulation of sorting signal-VHS domain interactions by a direct electrostatic mechanism." Kato Y., Misra S., Puertollano R., Hurley J.H., Bonifacino J.S. Nat. Struct. Biol. 9:532-536(2002) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 1-166. |
| [22] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] LEU-574. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF219138 mRNA. Translation: AAF42848.1. AF190864 mRNA. Translation: AAF05709.1. AF219139 mRNA. Translation: AAF42849.1. D63876 mRNA. Translation: BAA09926.1. Different initiation. AK301895 mRNA. Translation: BAH13578.1. AC022211 Genomic DNA. No translation available. BC070044 mRNA. Translation: AAH70044.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00021174. IPI00219305. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001166174.1. NM_001172703.1. NP_001166175.1. NM_001172704.1. NP_054720.1. NM_014001.3. NP_619525.1. NM_138619.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.87726. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9NZ52. 4 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-126320. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000245541. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 14548064. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000245541; ENSP00000245541; ENSG00000125447. ENST00000351904; ENSP00000326575; ENSG00000125447. ENST00000578348; ENSP00000463288; ENSG00000125447. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 23163. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:23163. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc002jni.2. human. uc002jnj.2. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 23163. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC17M073229. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:17079. GGA3. | ||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA022945. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 606006. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA28659. | ||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG321636. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000231169. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG015945. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K12404. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | IPMDRTL. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4W0XCS. | ||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | arf_3pathway. Arf1 pathway. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_GGA3. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000125447. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| Gene3D | 1.25.40.90. 1 hit. 2.60.40.1230. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR008152. Clathrin_a/b/g-adaptin_app_Ig. IPR008153. Clathrin_g-adaptin_app. IPR013041. Coatomer/clathrin_app_Ig-like. IPR008942. ENTH_VHS. IPR004152. GAT. IPR002014. VHS. IPR018205. VHS_subgr. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF02883. Alpha_adaptinC2. 1 hit. PF03127. GAT. 1 hit. PF00790. VHS. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00809. Alpha_adaptinC2. 1 hit. SM00288. VHS. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49348. Clath_adapt. 1 hit. SSF48464. ENTH_VHS. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50180. GAE. 1 hit. PS50909. GAT. 1 hit. PS50179. VHS. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9NZ52. | ||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 23163. | ||||||||||||||||||||||||||||||||||||||||||
| NextBio | 44545. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | GGA3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NZ52 Secondary accession number(s): B7Z7E2 Q9UJY3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
