Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ras-like protein family member 12

Gene

RASL12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi27 – 34GTP8
Nucleotide bindingi74 – 78GTPBy similarity5
Nucleotide bindingi134 – 137GTP4

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000103710-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Ras-like protein family member 12
Alternative name(s):
Ras-like protein Ris
Gene namesi
Name:RASL12
Synonyms:RIS
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 15

Organism-specific databases

HGNCiHGNC:30289. RASL12.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

DisGeNETi51285.
OpenTargetsiENSG00000103710.
PharmGKBiPA134920029.

Polymorphism and mutation databases

BioMutaiRASL12.
DMDMi74734715.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003338681 – 266Ras-like protein family member 12Add BLAST266

Proteomic databases

EPDiQ9NYN1.
PaxDbiQ9NYN1.
PeptideAtlasiQ9NYN1.
PRIDEiQ9NYN1.

PTM databases

iPTMnetiQ9NYN1.
PhosphoSitePlusiQ9NYN1.

Expressioni

Gene expression databases

BgeeiENSG00000103710.
CleanExiHS_RASL12.
ExpressionAtlasiQ9NYN1. baseline and differential.
GenevisibleiQ9NYN1. HS.

Organism-specific databases

HPAiHPA041963.

Interactioni

Protein-protein interaction databases

BioGridi119437. 4 interactors.
STRINGi9606.ENSP00000220062.

Structurei

Secondary structure

1266
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi20 – 26Combined sources7
Helixi33 – 42Combined sources10
Beta strandi55 – 63Combined sources9
Beta strandi66 – 74Combined sources9
Helixi85 – 88Combined sources4
Beta strandi92 – 99Combined sources8
Helixi103 – 123Combined sources21
Beta strandi129 – 134Combined sources6
Helixi136 – 141Combined sources6
Helixi146 – 156Combined sources11
Beta strandi159 – 162Combined sources4
Beta strandi165 – 167Combined sources3
Helixi170 – 184Combined sources15

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3C5CX-ray1.85A/B/C/D18-186[»]
ProteinModelPortaliQ9NYN1.
SMRiQ9NYN1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9NYN1.

Family & Domainsi

Sequence similaritiesi

Belongs to the small GTPase superfamily. Ras family.Curated

Phylogenomic databases

eggNOGiKOG0395. Eukaryota.
COG1100. LUCA.
GeneTreeiENSGT00860000133696.
HOGENOMiHOG000069979.
HOVERGENiHBG103396.
InParanoidiQ9NYN1.
KOiK07854.
OMAiFYEVSAC.
OrthoDBiEOG091G0M6D.
PhylomeDBiQ9NYN1.
TreeFamiTF318030.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR020849. Small_GTPase_Ras.
[Graphical view]
PANTHERiPTHR24070. PTHR24070. 1 hit.
PfamiPF00071. Ras. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51421. RAS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NYN1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSVFGKPRA GSGPQSAPLE VNLAILGRRG AGKSALTVKF LTKRFISEYD
60 70 80 90 100
PNLEDTYSSE ETVDHQPVHL RVMDTADLDT PRNCERYLNW AHAFLVVYSV
110 120 130 140 150
DSRQSFDSSS SYLELLALHA KETQRSIPAL LLGNKLDMAQ YRQVTKAEGV
160 170 180 190 200
ALAGRFGCLF FEVSACLDFE HVQHVFHEAV REARRELEKS PLTRPLFISE
210 220 230 240 250
ERALPHQAPL TARHGLASCT FNTLSTINLK EMPTVAQAKL VTVKSSRAQS
260
KRKAPTLTLL KGFKIF
Length:266
Mass (Da):29,662
Last modified:October 1, 2000 - v1
Checksum:iCEF9841F94BE9DBA
GO
Isoform 2 (identifier: Q9NYN1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MSSVFGKPRAGSGPQSAPLEVNLAILGRRGAGKS → MVIMGPELVGSWSDFKNEAADPR

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):28,815
Checksum:i5691C424510786F3
GO
Isoform 3 (identifier: Q9NYN1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     35-53: Missing.

Note: No experimental confirmation available.
Show »
Length:247
Mass (Da):27,424
Checksum:i35A1ADCF46BB3906
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0558451 – 34MSSVF…GAGKS → MVIMGPELVGSWSDFKNEAA DPR in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_05584635 – 53Missing in isoform 3. 1 PublicationAdd BLAST19

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF233588 mRNA. Translation: AAF60286.1.
AK296261 mRNA. Translation: BAG58974.1.
AK300536 mRNA. Translation: BAG62244.1.
AK314914 mRNA. Translation: BAG37426.1.
AC013553 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77709.1.
BC053734 mRNA. Translation: AAH53734.1.
CCDSiCCDS10200.1. [Q9NYN1-1]
CCDS76769.1. [Q9NYN1-3]
RefSeqiNP_001294859.1. NM_001307930.1. [Q9NYN1-3]
NP_057647.1. NM_016563.3. [Q9NYN1-1]
UniGeneiHs.27018.

Genome annotation databases

EnsembliENST00000220062; ENSP00000220062; ENSG00000103710. [Q9NYN1-1]
ENST00000421977; ENSP00000390028; ENSG00000103710. [Q9NYN1-3]
ENST00000434605; ENSP00000412787; ENSG00000103710. [Q9NYN1-2]
GeneIDi51285.
KEGGihsa:51285.
UCSCiuc002aoi.2. human. [Q9NYN1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF233588 mRNA. Translation: AAF60286.1.
AK296261 mRNA. Translation: BAG58974.1.
AK300536 mRNA. Translation: BAG62244.1.
AK314914 mRNA. Translation: BAG37426.1.
AC013553 Genomic DNA. No translation available.
CH471082 Genomic DNA. Translation: EAW77709.1.
BC053734 mRNA. Translation: AAH53734.1.
CCDSiCCDS10200.1. [Q9NYN1-1]
CCDS76769.1. [Q9NYN1-3]
RefSeqiNP_001294859.1. NM_001307930.1. [Q9NYN1-3]
NP_057647.1. NM_016563.3. [Q9NYN1-1]
UniGeneiHs.27018.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3C5CX-ray1.85A/B/C/D18-186[»]
ProteinModelPortaliQ9NYN1.
SMRiQ9NYN1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119437. 4 interactors.
STRINGi9606.ENSP00000220062.

PTM databases

iPTMnetiQ9NYN1.
PhosphoSitePlusiQ9NYN1.

Polymorphism and mutation databases

BioMutaiRASL12.
DMDMi74734715.

Proteomic databases

EPDiQ9NYN1.
PaxDbiQ9NYN1.
PeptideAtlasiQ9NYN1.
PRIDEiQ9NYN1.

Protocols and materials databases

DNASUi51285.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000220062; ENSP00000220062; ENSG00000103710. [Q9NYN1-1]
ENST00000421977; ENSP00000390028; ENSG00000103710. [Q9NYN1-3]
ENST00000434605; ENSP00000412787; ENSG00000103710. [Q9NYN1-2]
GeneIDi51285.
KEGGihsa:51285.
UCSCiuc002aoi.2. human. [Q9NYN1-1]

Organism-specific databases

CTDi51285.
DisGeNETi51285.
GeneCardsiRASL12.
HGNCiHGNC:30289. RASL12.
HPAiHPA041963.
neXtProtiNX_Q9NYN1.
OpenTargetsiENSG00000103710.
PharmGKBiPA134920029.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0395. Eukaryota.
COG1100. LUCA.
GeneTreeiENSGT00860000133696.
HOGENOMiHOG000069979.
HOVERGENiHBG103396.
InParanoidiQ9NYN1.
KOiK07854.
OMAiFYEVSAC.
OrthoDBiEOG091G0M6D.
PhylomeDBiQ9NYN1.
TreeFamiTF318030.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000103710-MONOMER.

Miscellaneous databases

EvolutionaryTraceiQ9NYN1.
GenomeRNAii51285.
PROiQ9NYN1.

Gene expression databases

BgeeiENSG00000103710.
CleanExiHS_RASL12.
ExpressionAtlasiQ9NYN1. baseline and differential.
GenevisibleiQ9NYN1. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR027417. P-loop_NTPase.
IPR005225. Small_GTP-bd_dom.
IPR001806. Small_GTPase.
IPR020849. Small_GTPase_Ras.
[Graphical view]
PANTHERiPTHR24070. PTHR24070. 1 hit.
PfamiPF00071. Ras. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
TIGRFAMsiTIGR00231. small_GTP. 1 hit.
PROSITEiPS51421. RAS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRASLC_HUMAN
AccessioniPrimary (citable) accession number: Q9NYN1
Secondary accession number(s): B2RC29, B4DJW2, B4DU82
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: October 1, 2000
Last modified: November 30, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.