Q9NYK5 (RM39_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 39S ribosomal protein L39, mitochondrial Short name=L39mt Short name=MRP-L39 Alternative name(s): 39S ribosomal protein L5, mitochondrial Short name=L5mt Short name=MRP-L5 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 338 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | |
| Tissue specificity | Isoform 1 is ubiquitously expressed. Isoform 2 is heart-specific. |
| Sequence similarities | To the N-terminal of threonyl-tRNA synthetases. |
| Caution | Ref.1 indicates C21orf8 as a synonym for this orf, this is incorrect, C21orf8 is already assigned to another chromosome 21 region. It is uncertain whether Met-1 or Met-6 is the initiator. |
| Sequence caution | The sequence AAF44696.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence AAQ13505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAA91177.1 differs from that shown. Reason: Frameshift at position 72. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Molecular function | Ribonucleoprotein Ribosomal protein |
| PTM | Acetylation |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | mitochondrial ribosome Non-traceable author statement Ref.6. Source: UniProtKB |
| Molecular_function | nucleotide binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NYK5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NYK5-2) Also known as: MRP-L5V1; The sequence of this isoform differs from the canonical sequence as follows: 324-338: VTEDQSKATEECTST → TPFPILLLFTTQSFFTTSPESYLLHGTVSE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 338 | 338 | 39S ribosomal protein L39, mitochondrial | PRO_0000087684 | |||||
Amino acid modifications | |||||||||
| Modified residue | 126 | 1 | N6-acetyllysine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 324 – 338 | 15 | VTEDQ…ECTST → TPFPILLLFTTQSFFTTSPE SYLLHGTVSE in isoform 2. | VSP_005718 | |||||
| Natural variant | 31 | 1 | S → P. Ref.1 Ref.2 Ref.4 Ref.5 Corresponds to variant rs3989369 [ dbSNP | Ensembl ]. | VAR_052041 | |||||
Experimental info | |||||||||
| Sequence conflict | 140 | 1 | K → E in AAF44696. Ref.1 | ||||||
| Sequence conflict | 140 | 1 | K → E in BAA91177. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Construction of a transcript map in the LL56-APP region of chromosome 21q21.1-21.2." Choi D.K., Taylor T.D., Hattori M., Sakaki Y. Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT PRO-31. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-31. |
| [3] | "The DNA sequence of human chromosome 21." Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. Yaspo M.-L.Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-31. Tissue: Muscle. |
| [5] | Hui R.T., Liu Y.Q., Liu B., Zhao B., Meng X.M., Sheng H., Xu Y.Y., Wang X.Y., Ye J., Song L., Gao Y., Wei Y.J., Zhang C.L., Zhang J., Chai M.Q., Chen J.Z., Sun Y.H., Zhou X.L. Zhao M.S.Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 5-338 (ISOFORM 1), VARIANT PRO-31. Tissue: Heart. |
| [6] | "Heart-specific splice-variant of a human mitochondrial ribosomal protein (mRNA processing; tissue specific splicing)." Spirina O., Bykhovskaya Y., Kajava A.V., O'Brien T.W., Nierlich D.P., Mougey E.B., Sylvester J.E., Graack H.-R., Wittmann-Liebold B., Fischel-Ghodsian N. Gene 261:229-234(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 150-338 (ISOFORM 2). Tissue: Heart. |
| [7] | "The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders." Kenmochi N., Suzuki T., Uechi T., Magoori M., Kuniba M., Higa S., Watanabe K., Tanaka T. Genomics 77:65-70(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 175-183. |
| [8] | "Mammalian mitochondrial ribosomal proteins (2). Amino acid sequencing, characterization, and identification of corresponding gene sequences." O'Brien T.W., Fiesler S.E., Denslow N.D., Thiede B., Wittmann-Liebold B., Mougey E.B., Sylvester J.E., Graack H.R. J. Biol. Chem. 274:36043-36051(1999) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [9] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-126, MASS SPECTROMETRY. |
| [10] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF239727 mRNA. Translation: AAF44696.1. Different initiation. AK000458 mRNA. Translation: BAA91177.1. Frameshift. AP000223 Genomic DNA. No translation available. BC004896 mRNA. Translation: AAH04896.2. BC107719 mRNA. Translation: AAI07720.1. AF109357 mRNA. Translation: AAQ13505.1. Different initiation. AF270511 mRNA. Translation: AAK12856.1. AB051346 Genomic DNA. Translation: BAB54936.1. |
| IPI | IPI00084571. IPI00295427. |
| RefSeq | NP_059142.2. NM_017446.3. NP_542984.2. NM_080794.3. |
| UniGene | Hs.420696. |
3D structure databases | |
| ProteinModelPortal | Q9NYK5. |
| SMR | Q9NYK5. Positions 86-327. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NYK5. 2 interactions. |
| STRING | 9606.ENSP00000305682. |
PTM databases | |
| PhosphoSite | Q9NYK5. |
Polymorphism databases | |
| DMDM | 296452977. |
Proteomic databases | |
| PaxDb | Q9NYK5. |
| PRIDE | Q9NYK5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000307301; ENSP00000305682; ENSG00000154719. ENST00000352957; ENSP00000284967; ENSG00000154719. |
| GeneID | 54148. |
| KEGG | hsa:54148. |
| UCSC | uc002yln.3. human. uc002ylo.3. human. |
Organism-specific databases | |
| CTD | 54148. |
| GeneCards | GC21M026957. |
| HGNC | HGNC:14027. MRPL39. |
| HPA | HPA018331. |
| MIM | 611845. gene. |
| neXtProt | NX_Q9NYK5. |
| PharmGKB | PA30970. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0441. |
| HOVERGEN | HBG023123. |
| OMA | AHALIYK. |
| OrthoDB | EOG4FJ89G. |
| PhylomeDB | Q9NYK5. |
Gene expression databases | |
| ArrayExpress | Q9NYK5. |
| Bgee | Q9NYK5. |
| CleanEx | HS_MRPL39. |
| Genevestigator | Q9NYK5. |
| GermOnline | ENSG00000154719. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.10.20.30. 1 hit. |
| InterPro | IPR012675. Beta-grasp_dom. IPR015552. Ribosomal_L39_mit. IPR018163. Thr/Ala-tRNA-synth_IIc_edit. [Graphical view] |
| PANTHER | PTHR11451:SF2. PTHR11451:SF2. 1 hit. |
| SUPFAM | SSF55186. Thr/Ala-tRNA-synth_IIc_edit. 1 hit. |
| ProtoNet | Search... |
Other | |
| ChiTaRS | MRPL39. human. |
| GenomeRNAi | 54148. |
| NextBio | 56504. |
| SOURCE | Search... |
Entry information
| Entry name | RM39_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NYK5 Secondary accession number(s): C9JYA5 Q9NX44 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 21 Human chromosome 21: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
