Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NYK5 (RM39_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
39S ribosomal protein L39, mitochondrial

Short name=L39mt
Short name=MRP-L39
Alternative name(s):
39S ribosomal protein L5, mitochondrial
Short name=L5mt
Short name=MRP-L5
Gene names
Name:MRPL39
Synonyms:C21orf92, MRPL5, RPML5
ORF Names:MSTP003, PRED22
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length338 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subcellular location

Mitochondrion.

Tissue specificity

Isoform 1 is ubiquitously expressed. Isoform 2 is heart-specific.

Sequence similarities

Belongs to the ribosomal protein L39 family.

Caution

Ref.1 indicates C21orf8 as a synonym for this orf, this is incorrect, C21orf8 is already assigned to another chromosome 21 region.

It is uncertain whether Met-1 or Met-6 is the initiator.

Sequence caution

The sequence AAF44696.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence AAQ13505.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAA91177.1 differs from that shown. Reason: Frameshift at position 72.

Ontologies

Keywords
   Cellular componentMitochondrion
   Coding sequence diversityAlternative splicing
Polymorphism
   Molecular functionRibonucleoprotein
Ribosomal protein
   PTMAcetylation
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentmitochondrial ribosome

Non-traceable author statement Ref.6. Source: UniProtKB

   Molecular_functionnucleotide binding

Inferred from electronic annotation. Source: InterPro

poly(A) RNA binding

Inferred from direct assay PubMed 22658674. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NYK5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NYK5-2)

Also known as: MRP-L5V1;

The sequence of this isoform differs from the canonical sequence as follows:
     324-338: VTEDQSKATEECTST → TPFPILLLFTTQSFFTTSPESYLLHGTVSE

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 33833839S ribosomal protein L39, mitochondrial
PRO_0000087684

Amino acid modifications

Modified residue1261N6-acetyllysine Ref.9

Natural variations

Alternative sequence324 – 33815VTEDQ…ECTST → TPFPILLLFTTQSFFTTSPE SYLLHGTVSE in isoform 2.
VSP_005718
Natural variant311S → P. Ref.1 Ref.2 Ref.4 Ref.5
Corresponds to variant rs3989369 [ dbSNP | Ensembl ].
VAR_052041

Experimental info

Sequence conflict1401K → E in AAF44696. Ref.1
Sequence conflict1401K → E in BAA91177. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified May 18, 2010. Version 3.
Checksum: BB0139678F72B63D

FASTA33838,712
        10         20         30         40         50         60 
MEALAMGSRA LRLWLVAPGG GIKWRFIATS SASQLSPTEL TEMRNDLFNK EKARQLSLTP 

        70         80         90        100        110        120 
RTEKIEVKHV GKTDPGTVFV MNKNISTPYS CAMHLSEWYC RKSILALVDG QPWDMYKPLT 

       130        140        150        160        170        180 
KSCEIKFLTF KDCDPGEVNK AYWRSCAMMM GCVIERAFKD EYMVNLVRAP EVPVISGAFC 

       190        200        210        220        230        240 
YDVVLDSKLD EWMPTKENLR SFTKDAHALI YKDLPFETLE VEAKVALEIF QHSKYKVDFI 

       250        260        270        280        290        300 
EEKASQNPER IVKLHRIGDF IDVSEGPLIP RTSICFQYEV SAVHNLQPTQ PSLIRRFQGV 

       310        320        330 
SLPVHLRAHF TIWDKLLERS RKMVTEDQSK ATEECTST 

« Hide

Isoform 2 (MRP-L5V1) [UniParc].

Checksum: B6371F87123E62EC
Show »

FASTA35340,458

References

« Hide 'large scale' references
[1]"Construction of a transcript map in the LL56-APP region of chromosome 21q21.1-21.2."
Choi D.K., Taylor T.D., Hattori M., Sakaki Y.
Submitted (FEB-2000) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT PRO-31.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-31.
[3]"The DNA sequence of human chromosome 21."
Hattori M., Fujiyama A., Taylor T.D., Watanabe H., Yada T., Park H.-S., Toyoda A., Ishii K., Totoki Y., Choi D.-K., Groner Y., Soeda E., Ohki M., Takagi T., Sakaki Y., Taudien S., Blechschmidt K., Polley A. expand/collapse author list , Menzel U., Delabar J., Kumpf K., Lehmann R., Patterson D., Reichwald K., Rump A., Schillhabel M., Schudy A., Zimmermann W., Rosenthal A., Kudoh J., Shibuya K., Kawasaki K., Asakawa S., Shintani A., Sasaki T., Nagamine K., Mitsuyama S., Antonarakis S.E., Minoshima S., Shimizu N., Nordsiek G., Hornischer K., Brandt P., Scharfe M., Schoen O., Desario A., Reichelt J., Kauer G., Bloecker H., Ramser J., Beck A., Klages S., Hennig S., Riesselmann L., Dagand E., Wehrmeyer S., Borzym K., Gardiner K., Nizetic D., Francis F., Lehrach H., Reinhardt R., Yaspo M.-L.
Nature 405:311-319(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-31.
Tissue: Muscle.
[5]Hui R.T., Liu Y.Q., Liu B., Zhao B., Meng X.M., Sheng H., Xu Y.Y., Wang X.Y., Ye J., Song L., Gao Y., Wei Y.J., Zhang C.L., Zhang J., Chai M.Q., Chen J.Z., Sun Y.H., Zhou X.L. expand/collapse author list , Jiang Y.X., Zhao X.W., Liu S., Cao H.Q., Zhao Y., Liu D.Q., Ding J.F., Liu L.S., Gao R.L., Wu Q.Y., Qiang B.Q., Yuan J.G., Liew C.C., Zhao M.S.
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 5-338 (ISOFORM 1), VARIANT PRO-31.
Tissue: Heart.
[6]"Heart-specific splice-variant of a human mitochondrial ribosomal protein (mRNA processing; tissue specific splicing)."
Spirina O., Bykhovskaya Y., Kajava A.V., O'Brien T.W., Nierlich D.P., Mougey E.B., Sylvester J.E., Graack H.-R., Wittmann-Liebold B., Fischel-Ghodsian N.
Gene 261:229-234(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 150-338 (ISOFORM 2).
Tissue: Heart.
[7]"The human mitochondrial ribosomal protein genes: mapping of 54 genes to the chromosomes and implications for human disorders."
Kenmochi N., Suzuki T., Uechi T., Magoori M., Kuniba M., Higa S., Watanabe K., Tanaka T.
Genomics 77:65-70(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 175-183.
[8]"Mammalian mitochondrial ribosomal proteins (2). Amino acid sequencing, characterization, and identification of corresponding gene sequences."
O'Brien T.W., Fiesler S.E., Denslow N.D., Thiede B., Wittmann-Liebold B., Mougey E.B., Sylvester J.E., Graack H.R.
J. Biol. Chem. 274:36043-36051(1999) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[9]"Lysine acetylation targets protein complexes and co-regulates major cellular functions."
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-126, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF239727 mRNA. Translation: AAF44696.1. Different initiation.
AK000458 mRNA. Translation: BAA91177.1. Frameshift.
AP000223 Genomic DNA. No translation available.
BC004896 mRNA. Translation: AAH04896.2.
BC107719 mRNA. Translation: AAI07720.1.
AF109357 mRNA. Translation: AAQ13505.1. Different initiation.
AF270511 mRNA. Translation: AAK12856.1.
AB051346 Genomic DNA. Translation: BAB54936.1.
CCDSCCDS13573.1. [Q9NYK5-1]
CCDS33522.1. [Q9NYK5-2]
RefSeqNP_059142.2. NM_017446.3.
NP_542984.2. NM_080794.3.
XP_006724089.1. XM_006724026.1. [Q9NYK5-2]
UniGeneHs.420696.

3D structure databases

ProteinModelPortalQ9NYK5.
SMRQ9NYK5. Positions 86-327.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119918. 32 interactions.
IntActQ9NYK5. 3 interactions.
STRING9606.ENSP00000305682.

PTM databases

PhosphoSiteQ9NYK5.

Polymorphism databases

DMDM296452977.

Proteomic databases

MaxQBQ9NYK5.
PaxDbQ9NYK5.
PRIDEQ9NYK5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000307301; ENSP00000305682; ENSG00000154719. [Q9NYK5-2]
ENST00000352957; ENSP00000284967; ENSG00000154719. [Q9NYK5-1]
GeneID54148.
KEGGhsa:54148.
UCSCuc002yln.3. human. [Q9NYK5-2]
uc002ylo.3. human. [Q9NYK5-1]

Organism-specific databases

CTD54148.
GeneCardsGC21M026957.
HGNCHGNC:14027. MRPL39.
HPAHPA018331.
MIM611845. gene.
neXtProtNX_Q9NYK5.
PharmGKBPA30970.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0441.
HOVERGENHBG023123.
KOK17420.
OMANCAMHLS.
OrthoDBEOG7T1RCK.
PhylomeDBQ9NYK5.
TreeFamTF300858.

Gene expression databases

ArrayExpressQ9NYK5.
BgeeQ9NYK5.
CleanExHS_MRPL39.
GenevestigatorQ9NYK5.

Family and domain databases

Gene3D3.10.20.30. 1 hit.
InterProIPR012675. Beta-grasp_dom.
IPR012676. TGS-like.
IPR018163. Thr/Ala-tRNA-synth_IIc_edit.
[Graphical view]
SUPFAMSSF55186. SSF55186. 1 hit.
SSF81271. SSF81271. 1 hit.
ProtoNetSearch...

Other

ChiTaRSMRPL39. human.
GeneWikiMRPL39.
GenomeRNAi54148.
NextBio56504.
PROQ9NYK5.
SOURCESearch...

Entry information

Entry nameRM39_HUMAN
AccessionPrimary (citable) accession number: Q9NYK5
Secondary accession number(s): C9JYA5 expand/collapse secondary AC list , Q32Q74, Q5QTR3, Q96Q65, Q9BSQ7, Q9BZV6, Q9NX44
Entry history
Integrated into UniProtKB/Swiss-Prot: January 11, 2001
Last sequence update: May 18, 2010
Last modified: July 9, 2014
This is version 119 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Ribosomal proteins

Ribosomal proteins families and list of entries

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 21

Human chromosome 21: entries, gene names and cross-references to MIM