Q9NYJ7 (DLL3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 127.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Delta-like protein 3 Alternative name(s): Drosophila Delta homolog 3 Short name=Delta3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 618 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibits primary neurogenesis. May be required to divert neurons along a specific differentiation pathway. Plays a role in the formation of somite boundaries during segmentation of the paraxial mesoderm By similarity. |
| Subunit structure | Can bind and activate Notch-1 or another Notch receptor By similarity. |
| Subcellular location | Membrane; Single-pass type I membrane protein Probable. |
| Domain | The DSL domain is required for binding to the Notch receptor. |
| Post-translational modification | Ubiquitinated by MIB (MIB1 or MIB2), leading to its endocytosis and subsequent degradation By similarity. |
| Involvement in disease | Spondylocostal dysostosis 1 (SCDO1) [MIM:277300]: An autosomal recessive condition of variable severity associated with vertebral and rib segmentation defects. The main skeletal malformations include fusion of vertebrae, hemivertebrae, fusion of certain ribs, and other rib malformations. Deformity of the chest and spine (severe scoliosis, kyphoscoliosis and lordosis) is a natural consequence of the malformation and leads to a dwarf-like appearance. As the thorax is small, infants frequently have respiratory insufficiency and repeated respiratory infections resulting in life-threatening complications in the first year of life. |
| Sequence similarities | Contains 1 DSL domain. Contains 6 EGF-like domains. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NYJ7-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NYJ7-2) The sequence of this isoform differs from the canonical sequence as follows: 587-618: VATPLFPPLHTGRAGQRQHLLFPYPSSILSVK → A | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 26 | 26 | Potential | ||||||||
| Chain | 27 – 618 | 592 | Delta-like protein 3 | PRO_0000007509 | |||||||
Regions | |||||||||||
| Topological domain | 27 – 492 | 466 | Extracellular Potential | ||||||||
| Transmembrane | 493 – 513 | 21 | Helical; Potential | ||||||||
| Topological domain | 514 – 618 | 105 | Cytoplasmic Potential | ||||||||
| Domain | 176 – 215 | 40 | DSL | ||||||||
| Domain | 216 – 249 | 34 | EGF-like 1 | ||||||||
| Domain | 274 – 310 | 37 | EGF-like 2 | ||||||||
| Domain | 312 – 351 | 40 | EGF-like 3 | ||||||||
| Domain | 353 – 389 | 37 | EGF-like 4 | ||||||||
| Domain | 391 – 427 | 37 | EGF-like 5 | ||||||||
| Domain | 429 – 465 | 37 | EGF-like 6 | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 220 ↔ 231 | By similarity | |||||||||
| Disulfide bond | 224 ↔ 237 | By similarity | |||||||||
| Disulfide bond | 239 ↔ 248 | By similarity | |||||||||
| Disulfide bond | 278 ↔ 289 | By similarity | |||||||||
| Disulfide bond | 283 ↔ 298 | By similarity | |||||||||
| Disulfide bond | 300 ↔ 309 | By similarity | |||||||||
| Disulfide bond | 316 ↔ 327 | By similarity | |||||||||
| Disulfide bond | 321 ↔ 339 | By similarity | |||||||||
| Disulfide bond | 341 ↔ 350 | By similarity | |||||||||
| Disulfide bond | 357 ↔ 368 | By similarity | |||||||||
| Disulfide bond | 362 ↔ 377 | By similarity | |||||||||
| Disulfide bond | 379 ↔ 388 | By similarity | |||||||||
| Disulfide bond | 395 ↔ 406 | By similarity | |||||||||
| Disulfide bond | 400 ↔ 415 | By similarity | |||||||||
| Disulfide bond | 417 ↔ 426 | By similarity | |||||||||
| Disulfide bond | 433 ↔ 444 | By similarity | |||||||||
| Disulfide bond | 438 ↔ 453 | By similarity | |||||||||
| Disulfide bond | 455 ↔ 464 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 587 – 618 | 32 | VATPL…ILSVK → A in isoform 2. | VSP_045249 | |||||||
| Natural variant | 115 | 1 | A → T. Ref.5 | VAR_046782 | |||||||
| Natural variant | 142 | 1 | L → Q. Ref.5 Corresponds to variant rs55741253 [ dbSNP | Ensembl ]. | VAR_046783 | |||||||
| Natural variant | 172 | 1 | F → C. Ref.2 Ref.5 Corresponds to variant rs8107127 [ dbSNP | Ensembl ]. | VAR_046784 | |||||||
| Natural variant | 218 | 1 | L → P. Ref.2 Ref.5 Corresponds to variant rs1110627 [ dbSNP | Ensembl ]. | VAR_016776 | |||||||
| Natural variant | 385 | 1 | G → D in SCDO1. Ref.1 | VAR_009952 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 318 | 1 | D → N in BAC11535. Ref.2 | ||||||||
| Sequence conflict | 435 | 1 | A → V in BAC11535. Ref.2 | ||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mutations in the human delta homologue, DLL3, cause axial skeletal defects in spondylocostal dysostosis." Bulman M.P., Kusumi K., Frayling T.M., McKeown C., Garrett C., Lander E.S., Krumlauf R., Hattersley A.T., Ellard S., Turnpenny P.D. Nat. Genet. 24:438-441(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORM 1), VARIANT SCDO1 ASP-385. |
| [2] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANTS CYS-172 AND PRO-218. |
| [3] | "The DNA sequence and biology of human chromosome 19." Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V. Lucas S.M.Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [5] | "Mutations in the MESP2 gene cause spondylothoracic dysostosis/Jarcho-Levin syndrome." Cornier A.S., Staehling-Hampton K., Delventhal K.M., Saga Y., Caubet J.-F., Sasaki N., Ellard S., Young E., Ramirez N., Carlo S.E., Torres J., Emans J.B., Turnpenny P.D., Pourquie O. Am. J. Hum. Genet. 82:1334-1341(2008) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS THR-115; GLN-142; CYS-172 AND PRO-218. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF241373 AF241372 Genomic DNA. Translation: AAF62542.1.AK075302 mRNA. Translation: BAC11535.1. AC011500 Genomic DNA. No translation available. BC000218 mRNA. Translation: AAH00218.1. |
| IPI | IPI00021010. IPI00409625. |
| RefSeq | NP_058637.1. NM_016941.3. NP_982353.1. NM_203486.2. |
| UniGene | Hs.127792. |
3D structure databases | |
| ProteinModelPortal | Q9NYJ7. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000205143. |
Polymorphism databases | |
| DMDM | 12229810. |
Proteomic databases | |
| PaxDb | Q9NYJ7. |
| PRIDE | Q9NYJ7. |
Protocols and materials databases | |
| DNASU | 10683. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000205143; ENSP00000205143; ENSG00000090932. ENST00000356433; ENSP00000348810; ENSG00000090932. |
| GeneID | 10683. |
| KEGG | hsa:10683. |
| UCSC | uc002olx.2. human. |
Organism-specific databases | |
| CTD | 10683. |
| GeneCards | GC19P039989. |
| HGNC | HGNC:2909. DLL3. |
| MIM | 277300. phenotype. 602768. gene. |
| neXtProt | NX_Q9NYJ7. |
| Orphanet | 2311. Autosomal recessive spondylocostal dysostosis. |
| PharmGKB | PA27365. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG244272. |
| HOGENOM | HOG000267024. |
| HOVERGEN | HBG007139. |
| InParanoid | Q9NYJ7. |
| KO | K06051. |
| OMA | EAAESPC. |
| PhylomeDB | Q9NYJ7. |
Gene expression databases | |
| ArrayExpress | Q9NYJ7. |
| Bgee | Q9NYJ7. |
| CleanEx | HS_DLL3. |
| Genevestigator | Q9NYJ7. |
| GermOnline | ENSG00000090932. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000742. EG-like_dom. IPR013032. EGF-like_CS. IPR011651. Notch_ligand_N. [Graphical view] |
| Pfam | PF00008. EGF. 3 hits. PF12661. hEGF. 2 hits. PF07657. MNNL. 1 hit. [Graphical view] |
| SMART | SM00181. EGF. 6 hits. [Graphical view] |
| PROSITE | PS51051. DSL. False negative. PS00022. EGF_1. 6 hits. PS01186. EGF_2. 6 hits. PS50026. EGF_3. 6 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 10683. |
| NextBio | 40615. |
| SOURCE | Search... |
Entry information
| Entry name | DLL3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NYJ7 Secondary accession number(s): E9PFG2, Q8NBS4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
