Q9NYB9 (ABI2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 111.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Abl interactor 2 Alternative name(s): Abelson interactor 2 Short name=Abi-2 Abl-binding protein 3 Short name=AblBP3 Arg-binding protein 1 Short name=ArgBP1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 513 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | May act in regulation of cell growth and transformation by interacting with nonreceptor tyrosine kinases ABL1 and/or ABL2. Part of the WAVE complex that regulates lamellipodia formation. The WAVE complex regulates actin filament reorganization via its interaction with the Arp2/3 complex. Regulates ABL1/c-Abl-mediated phosphorylation of MENA. Ref.1 Ref.3 Ref.7 |
| Subunit structure | Component of the WAVE1 complex composed of ABI2, CYFIP1 or CYFIP2, BRK1, NCKAP1 and WASF1/WAVE1. Within the complex, a heterdimer containing NCKAP1 and CYFIP1 interacts with a heterotrimer formed by WAVE1, ABI2 and BRK1. CYFIP2 binds to activated RAC1 which causes the complex to dissociate, releasing activated WASF1. The complex can also be activated by NCK1 By similarity. Interacts with ABL1 and ABL2. Ref.1 Ref.3 Ref.14 |
| Subcellular location | Cytoplasm By similarity Ref.1 Ref.8. Isoform 1: Cell projection › lamellipodium By similarity. Cell projection › filopodium By similarity. Cytoplasm › cytoskeleton By similarity. Note: Isoform 1 but not isoform 3 is localized to protruding lamellipodia and filopodia tips By similarity. Ref.1 Ref.8 |
| Post-translational modification | Is a substrate for ABL1. |
| Sequence similarities | Belongs to the ABI family. Contains 1 SH3 domain. Contains 1 t-SNARE coiled-coil homology domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NYB9-1) Also known as: Abi-2b; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NYB9-2) The sequence of this isoform differs from the canonical sequence as follows: 154-159: Missing. 284-344: Missing. 399-399: S → SLAPPPPSILQVTPQLPLMGFVARVQENIS | ||||||
| Isoform 3 (identifier: Q9NYB9-3) Also known as: Abi-2a; The sequence of this isoform differs from the canonical sequence as follows: 1-45: Missing. 46-95: ALEETKAYTT...MESSINHISQ → MSCRCWISRH...GNNCSLRLNE 154-159: Missing. 284-344: Missing. | ||||||
| Isoform 4 (identifier: Q9NYB9-4) The sequence of this isoform differs from the canonical sequence as follows: 154-159: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 513 | 513 | Abl interactor 2 | PRO_0000191790 | ||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||
| Domain | 45 – 107 | 63 | t-SNARE coiled-coil homology | |||||||||||||||||||||||||
| Domain | 451 – 510 | 60 | SH3 | |||||||||||||||||||||||||
| Compositional bias | 172 – 423 | 252 | Pro-rich | |||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||
| Modified residue | 227 | 1 | Phosphoserine Ref.9 Ref.10 Ref.12 | |||||||||||||||||||||||||
| Modified residue | 368 | 1 | Phosphoserine Ref.10 | |||||||||||||||||||||||||
| Modified residue | 462 | 1 | Phosphotyrosine By similarity | |||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||
| Alternative sequence | 1 – 45 | 45 | Missing in isoform 3. | VSP_010759 | ||||||||||||||||||||||||
| Alternative sequence | 46 – 95 | 50 | ALEET…NHISQ → MSCRCWISRHPSYEGWNLQS IIFHKQIRGVDLESTFVTKF GNNCSLRLNE in isoform 3. | VSP_010760 | ||||||||||||||||||||||||
| Alternative sequence | 154 – 159 | 6 | Missing in isoform 2, isoform 3 and isoform 4. | VSP_010761 | ||||||||||||||||||||||||
| Alternative sequence | 284 – 344 | 61 | Missing in isoform 2 and isoform 3. | VSP_010762 | ||||||||||||||||||||||||
| Alternative sequence | 399 | 1 | S → SLAPPPPSILQVTPQLPLMG FVARVQENIS in isoform 2. | VSP_010763 | ||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||
| Sequence conflict | 22 | 1 | S → R in CAA64885. Ref.3 | |||||||||||||||||||||||||
| Sequence conflict | 69 | 1 | A → D in CAA64885. Ref.3 | |||||||||||||||||||||||||
| Sequence conflict | 243 | 1 | S → T in AAA75446. Ref.2 | |||||||||||||||||||||||||
| Sequence conflict | 249 | 1 | G → P in AAA92289. Ref.1 | |||||||||||||||||||||||||
| Sequence conflict | 317 | 1 | N → D in BAG61693. Ref.5 | |||||||||||||||||||||||||
| Sequence conflict | 324 – 325 | 2 | PN → QT in BAG61693. Ref.5 | |||||||||||||||||||||||||
| Sequence conflict | 432 | 1 | A → V in AAA75446. Ref.2 | |||||||||||||||||||||||||
| Sequence conflict | 500 | 1 | F → S in AAA75446. Ref.2 | |||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||
| Helix | 1 – 9 | 9 | ||||||||||||||||||||||||||
| Helix | 11 – 39 | 29 | ||||||||||||||||||||||||||
| Helix | 43 – 110 | 68 | ||||||||||||||||||||||||||
| Beta strand | 123 – 125 | 3 | ||||||||||||||||||||||||||
| Turn | 143 – 151 | 9 | ||||||||||||||||||||||||||
| Beta strand | 453 – 458 | 6 | ||||||||||||||||||||||||||
| Beta strand | 477 – 483 | 7 | ||||||||||||||||||||||||||
| Beta strand | 485 – 493 | 9 | ||||||||||||||||||||||||||
| Beta strand | 496 – 501 | 6 | ||||||||||||||||||||||||||
| Beta strand | 504 – 507 | 4 | ||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Abi-2, a novel SH3-containing protein interacts with the c-Abl tyrosine kinase and modulates c-Abl transforming activity." Dai Z., Pendergast A.M. Genes Dev. 9:2569-2582(1995) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), FUNCTION, PHOSPHORYLATION, SUBCELLULAR LOCATION, INTERACTION WITH ABL1. |
| [2] | "Cloning of a binding substrate of the Abl protein tyrosine kinase." Ren R. Submitted (JUL-1995) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Identification of ArgBP1, an Arg protein tyrosine kinase binding protein that is the human homologue of a CNS-specific Xenopus gene." Wang B., Mysliwiec T., Krainc D., Jensen R.A., Sonoda G., Testa J.R., Golemis E.A., Kruh G.D. Oncogene 12:1921-1929(1996) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH ABL2. Tissue: Brain. |
| [4] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Brain. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
| [7] | "Drosophila abelson interacting protein (dAbi) is a positive regulator of abelson tyrosine kinase activity." Juang J.L., Hoffmann F.M. Oncogene 18:5138-5147(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "The Abl interactor proteins localize to sites of actin polymerization at the tips of lamellipodia and filopodia." Stradal T.E.B., Courtney K.D., Rottner K., Hahne P., Small J.V., Pendergast A.M. Curr. Biol. 11:891-895(2001) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-227, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-227 AND SER-368, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [11] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [12] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-227, MASS SPECTROMETRY. |
| [13] | "Solution structure of the SH3 domain of Abl interactor 2 (Abelson interactor 2)." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 444-508. |
| [14] | "Structure and control of the actin regulatory WAVE complex." Chen Z., Borek D., Padrick S.B., Gomez T.S., Metlagel Z., Ismail A.M., Umetani J., Billadeau D.D., Otwinowski Z., Rosen M.K. Nature 468:533-538(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.29 ANGSTROMS) OF 1-164, SUBUNIT. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U23435 mRNA. Translation: AAA92289.1. U31089 mRNA. Translation: AAA75446.1. AF260261 mRNA. Translation: AAF70308.1. X95632 mRNA. Translation: CAA64885.1. BT009920 mRNA. Translation: AAP88922.1. AK299824 mRNA. Translation: BAG61693.1. BC001439 mRNA. Translation: AAH01439.1. | ||||||||||||||||||
| IPI | IPI00442210. IPI00442211. IPI00442214. IPI00925810. | ||||||||||||||||||
| PIR | G01936. | ||||||||||||||||||
| RefSeq | NP_005750.4. NM_005759.4. | ||||||||||||||||||
| UniGene | Hs.471156. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9NYB9. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-37566N. | ||||||||||||||||||
| IntAct | Q9NYB9. 10 interactions. | ||||||||||||||||||
| MINT | MINT-252647. | ||||||||||||||||||
| STRING | 9606.ENSP00000261017. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9NYB9. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 50400673. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9NYB9. | ||||||||||||||||||
| PRIDE | Q9NYB9. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 10152. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000261016; ENSP00000261016; ENSG00000138443. ENST00000261017; ENSP00000261017; ENSG00000138443. ENST00000424558; ENSP00000391433; ENSG00000138443. | ||||||||||||||||||
| GeneID | 10152. | ||||||||||||||||||
| KEGG | hsa:10152. | ||||||||||||||||||
| UCSC | uc002uzz.3. human. uc002vab.3. human. uc010zii.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 10152. | ||||||||||||||||||
| GeneCards | GC02P204192. | ||||||||||||||||||
| H-InvDB | HIX0002759. | ||||||||||||||||||
| HGNC | HGNC:24011. ABI2. | ||||||||||||||||||
| MIM | 606442. gene. | ||||||||||||||||||
| neXtProt | NX_Q9NYB9. | ||||||||||||||||||
| PharmGKB | PA134977642. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG262939. | ||||||||||||||||||
| HOGENOM | HOG000293213. | ||||||||||||||||||
| HOVERGEN | HBG050446. | ||||||||||||||||||
| InParanoid | Q9NYB9. | ||||||||||||||||||
| KO | K05751. | ||||||||||||||||||
| OrthoDB | EOG4ZKJMQ. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9NYB9. | ||||||||||||||||||
| Bgee | Q9NYB9. | ||||||||||||||||||
| CleanEx | HS_ABI2. | ||||||||||||||||||
| Genevestigator | Q9NYB9. | ||||||||||||||||||
| GermOnline | ENSG00000138443. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR012849. Abl-interactor_HHR_dom. IPR001452. SH3_domain. IPR000727. T_SNARE_dom. [Graphical view] | ||||||||||||||||||
| Pfam | PF07815. Abi_HHR. 1 hit. PF00018. SH3_1. 1 hit. [Graphical view] | ||||||||||||||||||
| PRINTS | PR00452. SH3DOMAIN. | ||||||||||||||||||
| SMART | SM00326. SH3. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF50044. SH3. 1 hit. | ||||||||||||||||||
| PROSITE | PS50002. SH3. 1 hit. PS50192. T_SNARE. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| ChiTaRS | ABI2. human. | ||||||||||||||||||
| EvolutionaryTrace | Q9NYB9. | ||||||||||||||||||
| GenomeRNAi | 10152. | ||||||||||||||||||
| NextBio | 38426. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | ABI2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NYB9 Secondary accession number(s): B4DSN1 Q9BV70 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
