Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vascular non-inflammatory molecule 3

Gene

VNN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.1 Publication

Catalytic activityi

(R)-pantetheine + H2O = (R)-pantothenate + 2-aminoethanethiol.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei80 – 801Proton acceptorPROSITE-ProRule annotation
Active sitei179 – 1791Proton donorPROSITE-ProRule annotation
Active sitei212 – 2121NucleophilePROSITE-ProRule annotation

GO - Molecular functioni

  • pantetheine hydrolase activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Enzyme and pathway databases

BRENDAi3.5.1.92. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
Vascular non-inflammatory molecule 3 (EC:3.5.1.92)
Short name:
Vanin-3
Gene namesi
Name:VNN3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:16431. VNN3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Polymorphism and mutation databases

DMDMi88952267.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence analysisAdd
BLAST
Chaini23 – 470448Vascular non-inflammatory molecule 3PRO_0000019720Add
BLAST
Propeptidei471 – 50131Removed in mature formSequence analysisPRO_0000019721Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi39 – 391N-linked (GlcNAc...)Sequence analysis
Glycosylationi147 – 1471N-linked (GlcNAc...)Sequence analysis
Glycosylationi270 – 2701N-linked (GlcNAc...)Sequence analysis
Glycosylationi358 – 3581N-linked (GlcNAc...)Sequence analysis
Lipidationi470 – 4701GPI-anchor amidated serineSequence analysis

Keywords - PTMi

Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiQ9NY84.
PeptideAtlasiQ9NY84.
PRIDEiQ9NY84.

Expressioni

Tissue specificityi

Widely expressed with higher expression in liver and blood. Expressed in differentiated keratinocytes in epidermis and in epithelial cells in dermis. Overexpressed in lesional psoriatic skin.2 Publications

Inductioni

By Th17/Th1 type cytokines, but not by Th2-type.1 Publication

Gene expression databases

BgeeiQ9NY84.
CleanExiHS_VNN3.
ExpressionAtlasiQ9NY84. baseline and differential.
GenevisibleiQ9NY84. HS.

Organism-specific databases

HPAiHPA010818.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000440594.

Structurei

3D structure databases

ProteinModelPortaliQ9NY84.
SMRiQ9NY84. Positions 24-489.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini26 – 334309CN hydrolasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 CN hydrolase domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG0806. Eukaryota.
COG0388. LUCA.
GeneTreeiENSGT00390000013823.
HOVERGENiHBG103088.
InParanoidiQ9NY84.
OrthoDBiEOG7HF1J0.
PhylomeDBiQ9NY84.

Family and domain databases

Gene3Di3.60.110.10. 1 hit.
InterProiIPR012101. Biotinidase_euk.
IPR003010. C-N_Hydrolase.
[Graphical view]
PANTHERiPTHR10609. PTHR10609. 1 hit.
PfamiPF00795. CN_hydrolase. 1 hit.
[Graphical view]
PIRSFiPIRSF011861. Biotinidase. 1 hit.
SUPFAMiSSF56317. SSF56317. 1 hit.
PROSITEiPS50263. CN_HYDROLASE. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NY84-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIISHFPKCV AVFALLALSV GALDTFIAAV YEHAVILPNR TETPVSKEEA
60 70 80 90 100
LLLMNKNIDV LEKAVKLAAK QGAHIIVTPE DGIYGWIFTR ESIYPYLEDI
110 120 130 140 150
PDPGVNWIPC RDPWRFGNTP VQQRLSCLAK DNSIYVVANI GDKKPCNASD
160 170 180 190 200
SQCPPDGRYQ YNTDVVFDSQ GKLLARYHKY NLFAPEIQFD FPKDSELVTF
210 220 230 240 250
DTPFGKFGIF TCFDIFSHDP AVVVVDEVSI DSILYPTAWY NTLPLLSAVP
260 270 280 290 300
FHSAWAKAMG VNLLAANTHN TSMHMTGSGI YAPEAVKVYH YDMETESGQL
310 320 330 340 350
LLSELKSRPR REPTYPAAVD WHAYASSVKP FSSEQSDFLG MIYFDEFTFT
360 370 380 390 400
KLKRNTGNYT ACQKDLCCHL TYKMSEKRTD EIYALGAFDG LHTVEGQYYL
410 420 430 440 450
QICALLKCQT TDLETCGEPV GSAFTKFEDF SLSGTFGTRY VFPQIILSGS
460 470 480 490 500
QLAPERHYEI SRDGRLRSRS GAPLPVLVMA LYGRVFEKDP PRLGQGSGKF

Q
Length:501
Mass (Da):56,118
Last modified:February 7, 2006 - v2
Checksum:i9305A7B2AB68F687
GO
Isoform 2 (identifier: Q9NY84-2) [UniParc]FASTAAdd to basket

Also known as: PAGEL-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     228-274: VSIDSILYPT...AANTHNTSMH → FQLTAFSTPQ...LQIPTTPACT
     275-501: Missing.

Note: Expressed in neutrophils, this isoform displays a frameshift at Glu-227 due to one missing nucleotide compared to isoform 1, this missing nucleotide could be a variation as it is also present on genomic sequence.
Show »
Length:274
Mass (Da):30,719
Checksum:i916CC9113B516FB7
GO
Isoform 3 (identifier: Q9NY84-3) [UniParc]FASTAAdd to basket

Also known as: PAGEL-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     116-117: FG → NH
     118-501: Missing.

Show »
Length:117
Mass (Da):13,111
Checksum:iC7FCDC95155F9DA8
GO
Isoform 4 (identifier: Q9NY84-4) [UniParc]FASTAAdd to basket

Also known as: PAGEL-beta

The sequence of this isoform differs from the canonical sequence as follows:
     116-147: FGNTPVQQRLSCLAKDNSIYVVANIGDKKPCN → KSKKMNEPVSKELCYHCHSECNQYGQWKLYRT
     148-501: Missing.

Show »
Length:147
Mass (Da):16,761
Checksum:iD141E2BB62965D2C
GO
Isoform 5 (identifier: Q9NY84-5) [UniParc]FASTAAdd to basket

Also known as: PAGEL-delta

The sequence of this isoform differs from the canonical sequence as follows:
     180-207: YNLFAPEIQFDFPKDSELVTFDTPFGKF → GVESTPQKQSRCTTMTWKQRVVSCCYQN
     208-501: Missing.

Show »
Length:207
Mass (Da):23,210
Checksum:i5E5434A9C83C6474
GO
Isoform 6 (identifier: Q9NY84-6) [UniParc]FASTAAdd to basket

Also known as: PAGEL-epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     115-133: RFGNTPVQQRLSCLAKDNS → STIFLHLKFSLISPRIQNL
     134-501: Missing.

Show »
Length:133
Mass (Da):14,914
Checksum:i4AAE90F35C7818B3
GO
Isoform 7 (identifier: Q9NY84-7) [UniParc]FASTAAdd to basket

Also known as: PAGEL-zeta

The sequence of this isoform differs from the canonical sequence as follows:
     116-129: FGNTPVQQRLSCLA → EWNLRPRSSQGVPL
     130-501: Missing.

Show »
Length:129
Mass (Da):14,481
Checksum:i2928EDC130EDA620
GO
Isoform 8 (identifier: Q9NY84-8) [UniParc]FASTAAdd to basket

Also known as: PAGEL-eta

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: K → KQVLPFYTCKGDLQFGQRVFGIHDKLFCPTCFE
     116-129: FGNTPVQQRLSCLA → EWNLRPRSSQGVPL
     130-501: Missing.

Show »
Length:161
Mass (Da):18,201
Checksum:i89897FB811DC4340
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti33 – 331H → R.1 Publication
Corresponds to variant rs764264 [ dbSNP | Ensembl ].
VAR_025265
Natural varianti89 – 891T → A.1 Publication
Corresponds to variant rs36012859 [ dbSNP | Ensembl ].
VAR_025266
Natural varianti91 – 911E → K.1 Publication
Corresponds to variant rs12174042 [ dbSNP | Ensembl ].
VAR_025267
Natural varianti222 – 2221V → A.3 Publications
Corresponds to variant rs6569834 [ dbSNP | Ensembl ].
VAR_025268

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei70 – 701K → KQVLPFYTCKGDLQFGQRVF GIHDKLFCPTCFE in isoform 8. 1 PublicationVSP_038561
Alternative sequencei115 – 13319RFGNT…AKDNS → STIFLHLKFSLISPRIQNL in isoform 6. 1 PublicationVSP_038562Add
BLAST
Alternative sequencei116 – 14732FGNTP…KKPCN → KSKKMNEPVSKELCYHCHSE CNQYGQWKLYRT in isoform 4. 1 PublicationVSP_038563Add
BLAST
Alternative sequencei116 – 12914FGNTP…LSCLA → EWNLRPRSSQGVPL in isoform 7 and isoform 8. 1 PublicationVSP_038564Add
BLAST
Alternative sequencei116 – 1172FG → NH in isoform 3. 2 PublicationsVSP_029578
Alternative sequencei118 – 501384Missing in isoform 3. 2 PublicationsVSP_029579Add
BLAST
Alternative sequencei130 – 501372Missing in isoform 7 and isoform 8. 1 PublicationVSP_038565Add
BLAST
Alternative sequencei134 – 501368Missing in isoform 6. 1 PublicationVSP_038566Add
BLAST
Alternative sequencei148 – 501354Missing in isoform 4. 1 PublicationVSP_038567Add
BLAST
Alternative sequencei180 – 20728YNLFA…PFGKF → GVESTPQKQSRCTTMTWKQR VVSCCYQN in isoform 5. 1 PublicationVSP_038568Add
BLAST
Alternative sequencei208 – 501294Missing in isoform 5. 1 PublicationVSP_038569Add
BLAST
Alternative sequencei228 – 27447VSIDS…NTSMH → FQLTAFSTPQHGTTRCPSSR LFPSIQHGPRPWESIYLLQI PTTPACT in isoform 2. 1 PublicationVSP_017138Add
BLAST
Alternative sequencei275 – 501227Missing in isoform 2. 1 PublicationVSP_017139Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ238982 mRNA. Translation: CAB76824.1.
AB435052 mRNA. Translation: BAG30924.1.
AB435053 mRNA. Translation: BAG30925.1.
AB435054 mRNA. Translation: BAG30926.1.
AB435055 mRNA. Translation: BAG30927.1.
AB435056 mRNA. Translation: BAG30928.1.
AB435057 mRNA. Translation: BAG30929.1.
AB435058 mRNA. Translation: BAG30930.1.
AB435059 mRNA. Translation: BAG30931.1.
AB435060 mRNA. Translation: BAG30932.1.
AB435061 mRNA. Translation: BAG30933.1.
DQ220706 Genomic DNA. Translation: ABA60895.1.
AL032821 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW48017.1.
BC104416 mRNA. Translation: AAI04417.1.
BC104417 mRNA. Translation: AAI04418.1.
RefSeqiNP_001278632.1. NM_001291703.1.
UniGeneiHs.183656.

Genome annotation databases

EnsembliENST00000275223; ENSP00000443073; ENSG00000093134. [Q9NY84-3]
ENST00000367927; ENSP00000438024; ENSG00000093134. [Q9NY84-2]
ENST00000392393; ENSP00000441182; ENSG00000093134. [Q9NY84-4]
ENST00000414302; ENSP00000444505; ENSG00000093134. [Q9NY84-6]
ENST00000417437; ENSP00000463583; ENSG00000093134. [Q9NY84-8]
ENST00000423615; ENSP00000443901; ENSG00000093134. [Q9NY84-7]
ENST00000425515; ENSP00000439449; ENSG00000093134. [Q9NY84-3]
ENST00000427187; ENSP00000444491; ENSG00000093134. [Q9NY84-5]
ENST00000509351; ENSP00000464241; ENSG00000093134. [Q9NY84-7]
ENST00000519686; ENSP00000438175; ENSG00000093134. [Q9NY84-3]
GeneIDi55350.
KEGGihsa:55350.
UCSCiuc011ecl.3. human. [Q9NY84-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ238982 mRNA. Translation: CAB76824.1.
AB435052 mRNA. Translation: BAG30924.1.
AB435053 mRNA. Translation: BAG30925.1.
AB435054 mRNA. Translation: BAG30926.1.
AB435055 mRNA. Translation: BAG30927.1.
AB435056 mRNA. Translation: BAG30928.1.
AB435057 mRNA. Translation: BAG30929.1.
AB435058 mRNA. Translation: BAG30930.1.
AB435059 mRNA. Translation: BAG30931.1.
AB435060 mRNA. Translation: BAG30932.1.
AB435061 mRNA. Translation: BAG30933.1.
DQ220706 Genomic DNA. Translation: ABA60895.1.
AL032821 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW48017.1.
BC104416 mRNA. Translation: AAI04417.1.
BC104417 mRNA. Translation: AAI04418.1.
RefSeqiNP_001278632.1. NM_001291703.1.
UniGeneiHs.183656.

3D structure databases

ProteinModelPortaliQ9NY84.
SMRiQ9NY84. Positions 24-489.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000440594.

Polymorphism and mutation databases

DMDMi88952267.

Proteomic databases

PaxDbiQ9NY84.
PeptideAtlasiQ9NY84.
PRIDEiQ9NY84.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000275223; ENSP00000443073; ENSG00000093134. [Q9NY84-3]
ENST00000367927; ENSP00000438024; ENSG00000093134. [Q9NY84-2]
ENST00000392393; ENSP00000441182; ENSG00000093134. [Q9NY84-4]
ENST00000414302; ENSP00000444505; ENSG00000093134. [Q9NY84-6]
ENST00000417437; ENSP00000463583; ENSG00000093134. [Q9NY84-8]
ENST00000423615; ENSP00000443901; ENSG00000093134. [Q9NY84-7]
ENST00000425515; ENSP00000439449; ENSG00000093134. [Q9NY84-3]
ENST00000427187; ENSP00000444491; ENSG00000093134. [Q9NY84-5]
ENST00000509351; ENSP00000464241; ENSG00000093134. [Q9NY84-7]
ENST00000519686; ENSP00000438175; ENSG00000093134. [Q9NY84-3]
GeneIDi55350.
KEGGihsa:55350.
UCSCiuc011ecl.3. human. [Q9NY84-1]

Organism-specific databases

CTDi55350.
GeneCardsiVNN3.
H-InvDBHIX0032812.
HGNCiHGNC:16431. VNN3.
HPAiHPA010818.
MIMi606592. gene.
neXtProtiNX_Q9NY84.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0806. Eukaryota.
COG0388. LUCA.
GeneTreeiENSGT00390000013823.
HOVERGENiHBG103088.
InParanoidiQ9NY84.
OrthoDBiEOG7HF1J0.
PhylomeDBiQ9NY84.

Enzyme and pathway databases

BRENDAi3.5.1.92. 2681.

Miscellaneous databases

GenomeRNAii55350.
PROiQ9NY84.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NY84.
CleanExiHS_VNN3.
ExpressionAtlasiQ9NY84. baseline and differential.
GenevisibleiQ9NY84. HS.

Family and domain databases

Gene3Di3.60.110.10. 1 hit.
InterProiIPR012101. Biotinidase_euk.
IPR003010. C-N_Hydrolase.
[Graphical view]
PANTHERiPTHR10609. PTHR10609. 1 hit.
PfamiPF00795. CN_hydrolase. 1 hit.
[Graphical view]
PIRSFiPIRSF011861. Biotinidase. 1 hit.
SUPFAMiSSF56317. SSF56317. 1 hit.
PROSITEiPS50263. CN_HYDROLASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Vanin genes are clustered (human 6q22-24 and mouse 10A2B1) and encode isoforms of pantetheinase ectoenzymes."
    Martin F., Malergue F., Pitari G., Philippe J.M., Philips S., Chabret C., Granjeaud S., Mattei M.G., Mungall A.J., Naquet P., Galland F.
    Immunogenetics 53:296-306(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ALA-222, FUNCTION, TISSUE SPECIFICITY.
  2. "Alternative spliced variants in the pantetheinase family of genes expressed in human neutrophils."
    Nitto T., Inoue T., Node K.
    Gene 426:57-64(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3; 4; 5; 6; 7 AND 8).
    Tissue: Neutrophil.
  3. NIEHS SNPs program
    Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANTS ARG-33; ALA-89; LYS-91 AND ALA-222.
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  7. "An ESTs description of the new vanin gene family conserved from fly to human."
    Granjeaud S., Naquet P., Galland F.
    Immunogenetics 49:964-972(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 95-489 (ISOFORM 1), VARIANT ALA-222.
    Tissue: Liver.
  8. "Expression of the vanin gene family in normal and inflamed human skin: induction by proinflammatory cytokines."
    Jansen P.A.M., Kamsteeg M., Rodijk-Olthuis D., van Vlijmen-Willems I.M.J.J., de Jongh G.J., Bergers M., Tjabringa G.S., Zeeuwen P.L.J.M., Schalkwijk J.
    J. Invest. Dermatol. 129:2167-2174(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY, INDUCTION BY CYTOKINES.

Entry informationi

Entry nameiVNN3_HUMAN
AccessioniPrimary (citable) accession number: Q9NY84
Secondary accession number(s): B2DFY0
, B2DFY1, B2DFY3, B2DFY5, B2DFY6, B2DFY7, B2DFY8, Q3SX90, Q9BQY2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: February 7, 2006
Last modified: July 6, 2016
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.