Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Vascular non-inflammatory molecule 3

Gene

VNN3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Amidohydrolase that hydrolyzes specifically one of the carboamide linkages in D-pantetheine thus recycling pantothenic acid (vitamin B5) and releasing cysteamine.1 Publication

Catalytic activityi

(R)-pantetheine + H2O = (R)-pantothenate + 2-aminoethanethiol.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei80Proton acceptorPROSITE-ProRule annotation1
Active sitei179Proton donorPROSITE-ProRule annotation1
Active sitei212NucleophilePROSITE-ProRule annotation1

GO - Molecular functioni

  • pantetheine hydrolase activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Enzyme and pathway databases

BioCyciZFISH:ENSG00000093134-MONOMER.
BRENDAi3.5.1.92. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
Vascular non-inflammatory molecule 3 (EC:3.5.1.92)
Short name:
Vanin-3
Gene namesi
Name:VNN3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:16431. VNN3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi55350.
OpenTargetsiENSG00000093134.

Polymorphism and mutation databases

DMDMi88952267.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000001972023 – 470Vascular non-inflammatory molecule 3Add BLAST448
PropeptideiPRO_0000019721471 – 501Removed in mature formSequence analysisAdd BLAST31

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi39N-linked (GlcNAc...)Sequence analysis1
Glycosylationi147N-linked (GlcNAc...)Sequence analysis1
Glycosylationi270N-linked (GlcNAc...)Sequence analysis1
Glycosylationi358N-linked (GlcNAc...)Sequence analysis1
Lipidationi470GPI-anchor amidated serineSequence analysis1

Keywords - PTMi

Glycoprotein, GPI-anchor, Lipoprotein

Proteomic databases

PaxDbiQ9NY84.
PeptideAtlasiQ9NY84.
PRIDEiQ9NY84.

PTM databases

PhosphoSitePlusiQ9NY84.

Expressioni

Tissue specificityi

Widely expressed with higher expression in liver and blood. Expressed in differentiated keratinocytes in epidermis and in epithelial cells in dermis. Overexpressed in lesional psoriatic skin.2 Publications

Inductioni

By Th17/Th1 type cytokines, but not by Th2-type.1 Publication

Gene expression databases

BgeeiENSG00000093134.
CleanExiHS_VNN3.
ExpressionAtlasiQ9NY84. baseline and differential.
GenevisibleiQ9NY84. HS.

Organism-specific databases

HPAiHPA010818.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000440594.

Structurei

3D structure databases

ProteinModelPortaliQ9NY84.
SMRiQ9NY84.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini26 – 334CN hydrolasePROSITE-ProRule annotationAdd BLAST309

Sequence similaritiesi

Contains 1 CN hydrolase domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG0806. Eukaryota.
COG0388. LUCA.
GeneTreeiENSGT00390000013823.
HOVERGENiHBG103088.
InParanoidiQ9NY84.
PhylomeDBiQ9NY84.

Family and domain databases

Gene3Di3.60.110.10. 1 hit.
InterProiIPR012101. Biotinidase_euk.
IPR003010. C-N_Hydrolase.
[Graphical view]
PANTHERiPTHR10609. PTHR10609. 1 hit.
PfamiPF00795. CN_hydrolase. 1 hit.
[Graphical view]
PIRSFiPIRSF011861. Biotinidase. 1 hit.
SUPFAMiSSF56317. SSF56317. 1 hit.
PROSITEiPS50263. CN_HYDROLASE. 1 hit.
[Graphical view]

Sequences (8)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NY84-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MIISHFPKCV AVFALLALSV GALDTFIAAV YEHAVILPNR TETPVSKEEA
60 70 80 90 100
LLLMNKNIDV LEKAVKLAAK QGAHIIVTPE DGIYGWIFTR ESIYPYLEDI
110 120 130 140 150
PDPGVNWIPC RDPWRFGNTP VQQRLSCLAK DNSIYVVANI GDKKPCNASD
160 170 180 190 200
SQCPPDGRYQ YNTDVVFDSQ GKLLARYHKY NLFAPEIQFD FPKDSELVTF
210 220 230 240 250
DTPFGKFGIF TCFDIFSHDP AVVVVDEVSI DSILYPTAWY NTLPLLSAVP
260 270 280 290 300
FHSAWAKAMG VNLLAANTHN TSMHMTGSGI YAPEAVKVYH YDMETESGQL
310 320 330 340 350
LLSELKSRPR REPTYPAAVD WHAYASSVKP FSSEQSDFLG MIYFDEFTFT
360 370 380 390 400
KLKRNTGNYT ACQKDLCCHL TYKMSEKRTD EIYALGAFDG LHTVEGQYYL
410 420 430 440 450
QICALLKCQT TDLETCGEPV GSAFTKFEDF SLSGTFGTRY VFPQIILSGS
460 470 480 490 500
QLAPERHYEI SRDGRLRSRS GAPLPVLVMA LYGRVFEKDP PRLGQGSGKF

Q
Length:501
Mass (Da):56,118
Last modified:February 7, 2006 - v2
Checksum:i9305A7B2AB68F687
GO
Isoform 2 (identifier: Q9NY84-2) [UniParc]FASTAAdd to basket
Also known as: PAGEL-gamma

The sequence of this isoform differs from the canonical sequence as follows:
     228-274: VSIDSILYPT...AANTHNTSMH → FQLTAFSTPQ...LQIPTTPACT
     275-501: Missing.

Note: Expressed in neutrophils, this isoform displays a frameshift at Glu-227 due to one missing nucleotide compared to isoform 1, this missing nucleotide could be a variation as it is also present on genomic sequence.
Show »
Length:274
Mass (Da):30,719
Checksum:i916CC9113B516FB7
GO
Isoform 3 (identifier: Q9NY84-3) [UniParc]FASTAAdd to basket
Also known as: PAGEL-alpha

The sequence of this isoform differs from the canonical sequence as follows:
     116-117: FG → NH
     118-501: Missing.

Show »
Length:117
Mass (Da):13,111
Checksum:iC7FCDC95155F9DA8
GO
Isoform 4 (identifier: Q9NY84-4) [UniParc]FASTAAdd to basket
Also known as: PAGEL-beta

The sequence of this isoform differs from the canonical sequence as follows:
     116-147: FGNTPVQQRLSCLAKDNSIYVVANIGDKKPCN → KSKKMNEPVSKELCYHCHSECNQYGQWKLYRT
     148-501: Missing.

Show »
Length:147
Mass (Da):16,761
Checksum:iD141E2BB62965D2C
GO
Isoform 5 (identifier: Q9NY84-5) [UniParc]FASTAAdd to basket
Also known as: PAGEL-delta

The sequence of this isoform differs from the canonical sequence as follows:
     180-207: YNLFAPEIQFDFPKDSELVTFDTPFGKF → GVESTPQKQSRCTTMTWKQRVVSCCYQN
     208-501: Missing.

Show »
Length:207
Mass (Da):23,210
Checksum:i5E5434A9C83C6474
GO
Isoform 6 (identifier: Q9NY84-6) [UniParc]FASTAAdd to basket
Also known as: PAGEL-epsilon

The sequence of this isoform differs from the canonical sequence as follows:
     115-133: RFGNTPVQQRLSCLAKDNS → STIFLHLKFSLISPRIQNL
     134-501: Missing.

Show »
Length:133
Mass (Da):14,914
Checksum:i4AAE90F35C7818B3
GO
Isoform 7 (identifier: Q9NY84-7) [UniParc]FASTAAdd to basket
Also known as: PAGEL-zeta

The sequence of this isoform differs from the canonical sequence as follows:
     116-129: FGNTPVQQRLSCLA → EWNLRPRSSQGVPL
     130-501: Missing.

Show »
Length:129
Mass (Da):14,481
Checksum:i2928EDC130EDA620
GO
Isoform 8 (identifier: Q9NY84-8) [UniParc]FASTAAdd to basket
Also known as: PAGEL-eta

The sequence of this isoform differs from the canonical sequence as follows:
     70-70: K → KQVLPFYTCKGDLQFGQRVFGIHDKLFCPTCFE
     116-129: FGNTPVQQRLSCLA → EWNLRPRSSQGVPL
     130-501: Missing.

Show »
Length:161
Mass (Da):18,201
Checksum:i89897FB811DC4340
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02526533H → R.1 PublicationCorresponds to variant rs764264dbSNPEnsembl.1
Natural variantiVAR_02526689T → A.1 PublicationCorresponds to variant rs36012859dbSNPEnsembl.1
Natural variantiVAR_02526791E → K.1 PublicationCorresponds to variant rs12174042dbSNPEnsembl.1
Natural variantiVAR_025268222V → A.3 PublicationsCorresponds to variant rs6569834dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03856170K → KQVLPFYTCKGDLQFGQRVF GIHDKLFCPTCFE in isoform 8. 1 Publication1
Alternative sequenceiVSP_038562115 – 133RFGNT…AKDNS → STIFLHLKFSLISPRIQNL in isoform 6. 1 PublicationAdd BLAST19
Alternative sequenceiVSP_038563116 – 147FGNTP…KKPCN → KSKKMNEPVSKELCYHCHSE CNQYGQWKLYRT in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_038564116 – 129FGNTP…LSCLA → EWNLRPRSSQGVPL in isoform 7 and isoform 8. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_029578116 – 117FG → NH in isoform 3. 2 Publications2
Alternative sequenceiVSP_029579118 – 501Missing in isoform 3. 2 PublicationsAdd BLAST384
Alternative sequenceiVSP_038565130 – 501Missing in isoform 7 and isoform 8. 1 PublicationAdd BLAST372
Alternative sequenceiVSP_038566134 – 501Missing in isoform 6. 1 PublicationAdd BLAST368
Alternative sequenceiVSP_038567148 – 501Missing in isoform 4. 1 PublicationAdd BLAST354
Alternative sequenceiVSP_038568180 – 207YNLFA…PFGKF → GVESTPQKQSRCTTMTWKQR VVSCCYQN in isoform 5. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_038569208 – 501Missing in isoform 5. 1 PublicationAdd BLAST294
Alternative sequenceiVSP_017138228 – 274VSIDS…NTSMH → FQLTAFSTPQHGTTRCPSSR LFPSIQHGPRPWESIYLLQI PTTPACT in isoform 2. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_017139275 – 501Missing in isoform 2. 1 PublicationAdd BLAST227

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ238982 mRNA. Translation: CAB76824.1.
AB435052 mRNA. Translation: BAG30924.1.
AB435053 mRNA. Translation: BAG30925.1.
AB435054 mRNA. Translation: BAG30926.1.
AB435055 mRNA. Translation: BAG30927.1.
AB435056 mRNA. Translation: BAG30928.1.
AB435057 mRNA. Translation: BAG30929.1.
AB435058 mRNA. Translation: BAG30930.1.
AB435059 mRNA. Translation: BAG30931.1.
AB435060 mRNA. Translation: BAG30932.1.
AB435061 mRNA. Translation: BAG30933.1.
DQ220706 Genomic DNA. Translation: ABA60895.1.
AL032821 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW48017.1.
BC104416 mRNA. Translation: AAI04417.1.
BC104417 mRNA. Translation: AAI04418.1.
RefSeqiNP_001278632.1. NM_001291703.1.
UniGeneiHs.183656.

Genome annotation databases

EnsembliENST00000275223; ENSP00000443073; ENSG00000093134. [Q9NY84-3]
ENST00000367927; ENSP00000438024; ENSG00000093134. [Q9NY84-2]
ENST00000392393; ENSP00000441182; ENSG00000093134. [Q9NY84-4]
ENST00000414302; ENSP00000444505; ENSG00000093134. [Q9NY84-6]
ENST00000417437; ENSP00000463583; ENSG00000093134. [Q9NY84-8]
ENST00000423615; ENSP00000443901; ENSG00000093134. [Q9NY84-7]
ENST00000425515; ENSP00000439449; ENSG00000093134. [Q9NY84-3]
ENST00000427187; ENSP00000444491; ENSG00000093134. [Q9NY84-5]
ENST00000509351; ENSP00000464241; ENSG00000093134. [Q9NY84-7]
ENST00000519686; ENSP00000438175; ENSG00000093134. [Q9NY84-3]
GeneIDi55350.
KEGGihsa:55350.
UCSCiuc011ecl.3. human. [Q9NY84-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

NIEHS-SNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ238982 mRNA. Translation: CAB76824.1.
AB435052 mRNA. Translation: BAG30924.1.
AB435053 mRNA. Translation: BAG30925.1.
AB435054 mRNA. Translation: BAG30926.1.
AB435055 mRNA. Translation: BAG30927.1.
AB435056 mRNA. Translation: BAG30928.1.
AB435057 mRNA. Translation: BAG30929.1.
AB435058 mRNA. Translation: BAG30930.1.
AB435059 mRNA. Translation: BAG30931.1.
AB435060 mRNA. Translation: BAG30932.1.
AB435061 mRNA. Translation: BAG30933.1.
DQ220706 Genomic DNA. Translation: ABA60895.1.
AL032821 Genomic DNA. No translation available.
CH471051 Genomic DNA. Translation: EAW48017.1.
BC104416 mRNA. Translation: AAI04417.1.
BC104417 mRNA. Translation: AAI04418.1.
RefSeqiNP_001278632.1. NM_001291703.1.
UniGeneiHs.183656.

3D structure databases

ProteinModelPortaliQ9NY84.
SMRiQ9NY84.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000440594.

PTM databases

PhosphoSitePlusiQ9NY84.

Polymorphism and mutation databases

DMDMi88952267.

Proteomic databases

PaxDbiQ9NY84.
PeptideAtlasiQ9NY84.
PRIDEiQ9NY84.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000275223; ENSP00000443073; ENSG00000093134. [Q9NY84-3]
ENST00000367927; ENSP00000438024; ENSG00000093134. [Q9NY84-2]
ENST00000392393; ENSP00000441182; ENSG00000093134. [Q9NY84-4]
ENST00000414302; ENSP00000444505; ENSG00000093134. [Q9NY84-6]
ENST00000417437; ENSP00000463583; ENSG00000093134. [Q9NY84-8]
ENST00000423615; ENSP00000443901; ENSG00000093134. [Q9NY84-7]
ENST00000425515; ENSP00000439449; ENSG00000093134. [Q9NY84-3]
ENST00000427187; ENSP00000444491; ENSG00000093134. [Q9NY84-5]
ENST00000509351; ENSP00000464241; ENSG00000093134. [Q9NY84-7]
ENST00000519686; ENSP00000438175; ENSG00000093134. [Q9NY84-3]
GeneIDi55350.
KEGGihsa:55350.
UCSCiuc011ecl.3. human. [Q9NY84-1]

Organism-specific databases

CTDi55350.
DisGeNETi55350.
GeneCardsiVNN3.
H-InvDBHIX0032812.
HGNCiHGNC:16431. VNN3.
HPAiHPA010818.
MIMi606592. gene.
neXtProtiNX_Q9NY84.
OpenTargetsiENSG00000093134.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0806. Eukaryota.
COG0388. LUCA.
GeneTreeiENSGT00390000013823.
HOVERGENiHBG103088.
InParanoidiQ9NY84.
PhylomeDBiQ9NY84.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000093134-MONOMER.
BRENDAi3.5.1.92. 2681.

Miscellaneous databases

GenomeRNAii55350.
PROiQ9NY84.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000093134.
CleanExiHS_VNN3.
ExpressionAtlasiQ9NY84. baseline and differential.
GenevisibleiQ9NY84. HS.

Family and domain databases

Gene3Di3.60.110.10. 1 hit.
InterProiIPR012101. Biotinidase_euk.
IPR003010. C-N_Hydrolase.
[Graphical view]
PANTHERiPTHR10609. PTHR10609. 1 hit.
PfamiPF00795. CN_hydrolase. 1 hit.
[Graphical view]
PIRSFiPIRSF011861. Biotinidase. 1 hit.
SUPFAMiSSF56317. SSF56317. 1 hit.
PROSITEiPS50263. CN_HYDROLASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiVNN3_HUMAN
AccessioniPrimary (citable) accession number: Q9NY84
Secondary accession number(s): B2DFY0
, B2DFY1, B2DFY3, B2DFY5, B2DFY6, B2DFY7, B2DFY8, Q3SX90, Q9BQY2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: February 7, 2006
Last modified: November 2, 2016
This is version 136 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.