Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Odorant-binding protein 2a

Gene

OBP2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.1 Publication

GO - Molecular functioni

  • odorant binding Source: UniProtKB

GO - Biological processi

  • response to stimulus Source: UniProtKB-KW
  • sensory perception of chemical stimulus Source: ProtInc
  • sensory perception of smell Source: UniProtKB-KW
  • transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Olfaction, Sensory transduction, Transport

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122136-MONOMER.

Chemistry databases

SwissLipidsiSLP:000001528. [Q9NY56-1]

Names & Taxonomyi

Protein namesi
Recommended name:
Odorant-binding protein 2a
Alternative name(s):
Odorant-binding protein IIa
Short name:
OBPIIa
Gene namesi
Name:OBP2A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:23380. OBP2A.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi29991.
OpenTargetsiENSG00000122136.
PharmGKBiPA134915019.

Polymorphism and mutation databases

BioMutaiOBP2A.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 15Sequence analysisAdd BLAST15
ChainiPRO_000001793716 – 170Odorant-binding protein 2aAdd BLAST155

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi74 ↔ 1661 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ9NY56.
PeptideAtlasiQ9NY56.
PRIDEiQ9NY56.

PTM databases

iPTMnetiQ9NY56.
PhosphoSitePlusiQ9NY56.

Expressioni

Tissue specificityi

Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.

Gene expression databases

BgeeiENSG00000122136.
CleanExiHS_OBP2A.
ExpressionAtlasiQ9NY56. baseline and differential.
GenevisibleiQ9NY56. HS.

Organism-specific databases

HPAiHPA055955.

Interactioni

Subunit structurei

Monomer.1 Publication

Protein-protein interaction databases

BioGridi119016. 7 interactors.
STRINGi9606.ENSP00000360841.

Structurei

Secondary structure

1170
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi27 – 36Combined sources10
Helixi42 – 44Combined sources3
Beta strandi47 – 49Combined sources3
Beta strandi52 – 56Combined sources5
Beta strandi62 – 70Combined sources9
Beta strandi73 – 82Combined sources10
Beta strandi89 – 92Combined sources4
Turni93 – 96Combined sources4
Beta strandi97 – 103Combined sources7
Beta strandi110 – 118Combined sources9
Beta strandi121 – 133Combined sources13
Helixi137 – 149Combined sources13
Helixi154 – 156Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4RUNX-ray2.60A/B16-170[»]
ProteinModelPortaliQ9NY56.
SMRiQ9NY56.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the calycin superfamily. Lipocalin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiENOG410IZGJ. Eukaryota.
ENOG4111AYP. LUCA.
GeneTreeiENSGT00440000033563.
HOGENOMiHOG000231562.
HOVERGENiHBG101411.
InParanoidiQ9NY56.
PhylomeDBiQ9NY56.
TreeFamiTF338197.

Family and domain databases

Gene3Di2.40.128.20. 1 hit.
InterProiIPR012674. Calycin.
IPR011038. Calycin-like.
IPR000566. Lipocln_cytosolic_FA-bd_dom.
IPR002450. von_Ebner_gland.
[Graphical view]
PfamiPF00061. Lipocalin. 1 hit.
[Graphical view]
PRINTSiPR01175. VNEBNERGLAND.
SUPFAMiSSF50814. SSF50814. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Aa (identifier: Q9NY56-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKTLFLGVTL GLAAALSFTL EEEDITGTWY VKAMVVDKDF PEDRRPRKVS
60 70 80 90 100
PVKVTALGGG NLEATFTFMR EDRCIQKKIL MRKTEEPGKF SAYGGRKLIY
110 120 130 140 150
LQELPGTDDY VFYCKDQRRG GLRYMGKLVG RNPNTNLEAL EEFKKLVQHK
160 170
GLSEEDIFMP LQTGSCVLEH
Length:170
Mass (Da):19,318
Last modified:October 1, 2000 - v1
Checksum:i391F55E2E3629E75
GO
Isoform Ab (identifier: Q9NY56-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-170: RNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH → PCRCPHVGSPGHLTCR

Show »
Length:146
Mass (Da):16,442
Checksum:i7C0774DB7E9E767A
GO
Isoform Ad (identifier: Q9NY56-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-129: ITGTWYVKAM...GGLRYMGKLV → EGESVHPEEN...TLAHLATSPA

Show »
Length:147
Mass (Da):15,821
Checksum:i8D57B038D35F36BA
GO
Isoform Ag (identifier: Q9NY56-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     130-170: GRNPNTNLEA...LQTGSCVLEH → ASAPCRAVPL...SHDPSLLPPT

Show »
Length:228
Mass (Da):26,014
Checksum:iF77392851D8AB471
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti90F → Y in CAB71326 (PubMed:10607840).Curated1
Sequence conflicti149H → R in CAB71320 (PubMed:10607840).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03435461N → K.Corresponds to variant rs3180357dbSNPEnsembl.1
Natural variantiVAR_061359130G → A.Corresponds to variant rs55695858dbSNPEnsembl.1
Natural variantiVAR_061360133P → S.Corresponds to variant rs3178137dbSNPEnsembl.1
Natural variantiVAR_050176159M → T.1 PublicationCorresponds to variant rs2853652dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_00313525 – 129ITGTW…MGKLV → EGESVHPEENPDAEDGGAWQ IQRLWGQEAHIPAGAARDGR LRLLLQRPAPWGPALHGKAC GICSLQGRAAVPTLAHLATS PA in isoform Ad. 1 PublicationAdd BLAST105
Alternative sequenceiVSP_003137130 – 170GRNPN…CVLEH → ASAPCRAVPLSPRRLTWPPH LQVGILIPTWRPWKNLRNWC STRDSRRRTFSCPCRREAAF SNTRQPPGLHLQSPPYHQTQ SPDHLDLPSSHDPSLLPPT in isoform Ag. 1 PublicationAdd BLAST41
Alternative sequenceiVSP_003136131 – 170RNPNT…CVLEH → PCRCPHVGSPGHLTCR in isoform Ab. 1 PublicationAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ251021 mRNA. Translation: CAB71318.1.
AJ251022 mRNA. Translation: CAB71319.1.
AJ251023 mRNA. Translation: CAB71320.1.
AJ251024 mRNA. Translation: CAB71321.1.
AJ251029 Genomic DNA. Translation: CAB71326.1.
AL161452 Genomic DNA. Translation: CAI14043.1.
BC069563 mRNA. Translation: AAH69563.1.
CCDSiCCDS6992.1. [Q9NY56-1]
CCDS78455.1. [Q9NY56-4]
CCDS78456.1. [Q9NY56-3]
RefSeqiNP_001280118.1. NM_001293189.1.
NP_001280122.1. NM_001293193.1.
NP_055397.1. NM_014582.2. [Q9NY56-1]
UniGeneiHs.567489.

Genome annotation databases

EnsembliENST00000371776; ENSP00000360841; ENSG00000122136. [Q9NY56-1]
ENST00000539850; ENSP00000441028; ENSG00000122136. [Q9NY56-1]
GeneIDi29991.
KEGGihsa:29991.
UCSCiuc004cgb.3. human. [Q9NY56-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ251021 mRNA. Translation: CAB71318.1.
AJ251022 mRNA. Translation: CAB71319.1.
AJ251023 mRNA. Translation: CAB71320.1.
AJ251024 mRNA. Translation: CAB71321.1.
AJ251029 Genomic DNA. Translation: CAB71326.1.
AL161452 Genomic DNA. Translation: CAI14043.1.
BC069563 mRNA. Translation: AAH69563.1.
CCDSiCCDS6992.1. [Q9NY56-1]
CCDS78455.1. [Q9NY56-4]
CCDS78456.1. [Q9NY56-3]
RefSeqiNP_001280118.1. NM_001293189.1.
NP_001280122.1. NM_001293193.1.
NP_055397.1. NM_014582.2. [Q9NY56-1]
UniGeneiHs.567489.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4RUNX-ray2.60A/B16-170[»]
ProteinModelPortaliQ9NY56.
SMRiQ9NY56.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119016. 7 interactors.
STRINGi9606.ENSP00000360841.

Chemistry databases

SwissLipidsiSLP:000001528. [Q9NY56-1]

PTM databases

iPTMnetiQ9NY56.
PhosphoSitePlusiQ9NY56.

Polymorphism and mutation databases

BioMutaiOBP2A.

Proteomic databases

PaxDbiQ9NY56.
PeptideAtlasiQ9NY56.
PRIDEiQ9NY56.

Protocols and materials databases

DNASUi29991.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371776; ENSP00000360841; ENSG00000122136. [Q9NY56-1]
ENST00000539850; ENSP00000441028; ENSG00000122136. [Q9NY56-1]
GeneIDi29991.
KEGGihsa:29991.
UCSCiuc004cgb.3. human. [Q9NY56-1]

Organism-specific databases

CTDi29991.
DisGeNETi29991.
GeneCardsiOBP2A.
HGNCiHGNC:23380. OBP2A.
HPAiHPA055955.
MIMi164320. gene.
neXtProtiNX_Q9NY56.
OpenTargetsiENSG00000122136.
PharmGKBiPA134915019.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IZGJ. Eukaryota.
ENOG4111AYP. LUCA.
GeneTreeiENSGT00440000033563.
HOGENOMiHOG000231562.
HOVERGENiHBG101411.
InParanoidiQ9NY56.
PhylomeDBiQ9NY56.
TreeFamiTF338197.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122136-MONOMER.

Miscellaneous databases

GeneWikiiOBP2A.
GenomeRNAii29991.
PROiQ9NY56.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122136.
CleanExiHS_OBP2A.
ExpressionAtlasiQ9NY56. baseline and differential.
GenevisibleiQ9NY56. HS.

Family and domain databases

Gene3Di2.40.128.20. 1 hit.
InterProiIPR012674. Calycin.
IPR011038. Calycin-like.
IPR000566. Lipocln_cytosolic_FA-bd_dom.
IPR002450. von_Ebner_gland.
[Graphical view]
PfamiPF00061. Lipocalin. 1 hit.
[Graphical view]
PRINTSiPR01175. VNEBNERGLAND.
SUPFAMiSSF50814. SSF50814. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiOBP2A_HUMAN
AccessioniPrimary (citable) accession number: Q9NY56
Secondary accession number(s): Q5T8A3
, Q9NY50, Q9NY53, Q9NY54, Q9NY55
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2002
Last sequence update: October 1, 2000
Last modified: November 2, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.