Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NY56

- OBP2A_HUMAN

UniProt

Q9NY56 - OBP2A_HUMAN

Protein

Odorant-binding protein 2a

Gene

OBP2A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.1 Publication

    GO - Molecular functioni

    1. odorant binding Source: UniProtKB

    GO - Biological processi

    1. response to stimulus Source: UniProtKB-KW
    2. sensory perception of chemical stimulus Source: ProtInc
    3. sensory perception of smell Source: UniProtKB-KW
    4. transport Source: UniProtKB-KW

    Keywords - Biological processi

    Olfaction, Sensory transduction, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Odorant-binding protein 2a
    Alternative name(s):
    Odorant-binding protein IIa
    Short name:
    OBPIIa
    Gene namesi
    Name:OBP2A
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:23380. OBP2A.

    Subcellular locationi

    Secreted Curated

    GO - Cellular componenti

    1. extracellular region Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134915019.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 1515Sequence AnalysisAdd
    BLAST
    Chaini16 – 170155Odorant-binding protein 2aPRO_0000017937Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Disulfide bondi74 ↔ 1661 Publication

    Keywords - PTMi

    Disulfide bond

    Proteomic databases

    PaxDbiQ9NY56.
    PRIDEiQ9NY56.

    PTM databases

    PhosphoSiteiQ9NY56.

    Expressioni

    Tissue specificityi

    Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.

    Gene expression databases

    ArrayExpressiQ9NY56.
    BgeeiQ9NY56.
    CleanExiHS_OBP2A.
    GenevestigatoriQ9NY56.

    Organism-specific databases

    HPAiHPA055955.

    Interactioni

    Subunit structurei

    Monomer.1 Publication

    Protein-protein interaction databases

    STRINGi9606.ENSP00000360841.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NY56.
    SMRiQ9NY56. Positions 24-166.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the calycin superfamily. Lipocalin family.Curated

    Keywords - Domaini

    Signal

    Phylogenomic databases

    eggNOGiNOG28920.
    HOGENOMiHOG000231562.
    HOVERGENiHBG101411.
    PhylomeDBiQ9NY56.
    TreeFamiTF338197.

    Family and domain databases

    Gene3Di2.40.128.20. 1 hit.
    InterProiIPR012674. Calycin.
    IPR011038. Calycin-like.
    IPR000566. Lipocln_cytosolic_FA-bd_dom.
    IPR002450. von_Ebner_gland.
    [Graphical view]
    PfamiPF00061. Lipocalin. 1 hit.
    [Graphical view]
    PRINTSiPR01175. VNEBNERGLAND.
    SUPFAMiSSF50814. SSF50814. 1 hit.

    Sequences (4)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform Aa (identifier: Q9NY56-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKTLFLGVTL GLAAALSFTL EEEDITGTWY VKAMVVDKDF PEDRRPRKVS    50
    PVKVTALGGG NLEATFTFMR EDRCIQKKIL MRKTEEPGKF SAYGGRKLIY 100
    LQELPGTDDY VFYCKDQRRG GLRYMGKLVG RNPNTNLEAL EEFKKLVQHK 150
    GLSEEDIFMP LQTGSCVLEH 170
    Length:170
    Mass (Da):19,318
    Last modified:October 1, 2000 - v1
    Checksum:i391F55E2E3629E75
    GO
    Isoform Ab (identifier: Q9NY56-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         131-170: RNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH → PCRCPHVGSPGHLTCR

    Show »
    Length:146
    Mass (Da):16,442
    Checksum:i7C0774DB7E9E767A
    GO
    Isoform Ad (identifier: Q9NY56-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         25-129: ITGTWYVKAM...GGLRYMGKLV → EGESVHPEEN...TLAHLATSPA

    Show »
    Length:147
    Mass (Da):15,821
    Checksum:i8D57B038D35F36BA
    GO
    Isoform Ag (identifier: Q9NY56-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         130-170: GRNPNTNLEA...LQTGSCVLEH → ASAPCRAVPL...SHDPSLLPPT

    Show »
    Length:228
    Mass (Da):26,014
    Checksum:iF77392851D8AB471
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti90 – 901F → Y in CAB71326. (PubMed:10607840)Curated
    Sequence conflicti149 – 1491H → R in CAB71320. (PubMed:10607840)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti61 – 611N → K.
    Corresponds to variant rs3180357 [ dbSNP | Ensembl ].
    VAR_034354
    Natural varianti130 – 1301G → A.
    Corresponds to variant rs55695858 [ dbSNP | Ensembl ].
    VAR_061359
    Natural varianti133 – 1331P → S.
    Corresponds to variant rs3178137 [ dbSNP | Ensembl ].
    VAR_061360
    Natural varianti159 – 1591M → T.1 Publication
    Corresponds to variant rs2853652 [ dbSNP | Ensembl ].
    VAR_050176

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei25 – 129105ITGTW…MGKLV → EGESVHPEENPDAEDGGAWQ IQRLWGQEAHIPAGAARDGR LRLLLQRPAPWGPALHGKAC GICSLQGRAAVPTLAHLATS PA in isoform Ad. 1 PublicationVSP_003135Add
    BLAST
    Alternative sequencei130 – 17041GRNPN…CVLEH → ASAPCRAVPLSPRRLTWPPH LQVGILIPTWRPWKNLRNWC STRDSRRRTFSCPCRREAAF SNTRQPPGLHLQSPPYHQTQ SPDHLDLPSSHDPSLLPPT in isoform Ag. 1 PublicationVSP_003137Add
    BLAST
    Alternative sequencei131 – 17040RNPNT…CVLEH → PCRCPHVGSPGHLTCR in isoform Ab. 1 PublicationVSP_003136Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ251021 mRNA. Translation: CAB71318.1.
    AJ251022 mRNA. Translation: CAB71319.1.
    AJ251023 mRNA. Translation: CAB71320.1.
    AJ251024 mRNA. Translation: CAB71321.1.
    AJ251029 Genomic DNA. Translation: CAB71326.1.
    AL161452 Genomic DNA. Translation: CAI14043.1.
    BC069563 mRNA. Translation: AAH69563.1.
    CCDSiCCDS6992.1. [Q9NY56-1]
    RefSeqiNP_055397.1. NM_014582.2. [Q9NY56-1]
    UniGeneiHs.567489.

    Genome annotation databases

    EnsembliENST00000371776; ENSP00000360841; ENSG00000122136. [Q9NY56-1]
    ENST00000539850; ENSP00000441028; ENSG00000122136. [Q9NY56-1]
    GeneIDi29991.
    KEGGihsa:29991.
    UCSCiuc004cgb.3. human. [Q9NY56-1]

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ251021 mRNA. Translation: CAB71318.1 .
    AJ251022 mRNA. Translation: CAB71319.1 .
    AJ251023 mRNA. Translation: CAB71320.1 .
    AJ251024 mRNA. Translation: CAB71321.1 .
    AJ251029 Genomic DNA. Translation: CAB71326.1 .
    AL161452 Genomic DNA. Translation: CAI14043.1 .
    BC069563 mRNA. Translation: AAH69563.1 .
    CCDSi CCDS6992.1. [Q9NY56-1 ]
    RefSeqi NP_055397.1. NM_014582.2. [Q9NY56-1 ]
    UniGenei Hs.567489.

    3D structure databases

    ProteinModelPortali Q9NY56.
    SMRi Q9NY56. Positions 24-166.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    STRINGi 9606.ENSP00000360841.

    PTM databases

    PhosphoSitei Q9NY56.

    Proteomic databases

    PaxDbi Q9NY56.
    PRIDEi Q9NY56.

    Protocols and materials databases

    DNASUi 29991.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000371776 ; ENSP00000360841 ; ENSG00000122136 . [Q9NY56-1 ]
    ENST00000539850 ; ENSP00000441028 ; ENSG00000122136 . [Q9NY56-1 ]
    GeneIDi 29991.
    KEGGi hsa:29991.
    UCSCi uc004cgb.3. human. [Q9NY56-1 ]

    Organism-specific databases

    CTDi 29991.
    GeneCardsi GC09P138437.
    HGNCi HGNC:23380. OBP2A.
    HPAi HPA055955.
    MIMi 164320. gene.
    neXtProti NX_Q9NY56.
    PharmGKBi PA134915019.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG28920.
    HOGENOMi HOG000231562.
    HOVERGENi HBG101411.
    PhylomeDBi Q9NY56.
    TreeFami TF338197.

    Miscellaneous databases

    GeneWikii OBP2A.
    GenomeRNAii 29991.
    NextBioi 52776.
    PROi Q9NY56.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NY56.
    Bgeei Q9NY56.
    CleanExi HS_OBP2A.
    Genevestigatori Q9NY56.

    Family and domain databases

    Gene3Di 2.40.128.20. 1 hit.
    InterProi IPR012674. Calycin.
    IPR011038. Calycin-like.
    IPR000566. Lipocln_cytosolic_FA-bd_dom.
    IPR002450. von_Ebner_gland.
    [Graphical view ]
    Pfami PF00061. Lipocalin. 1 hit.
    [Graphical view ]
    PRINTSi PR01175. VNEBNERGLAND.
    SUPFAMi SSF50814. SSF50814. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres."
      Lacazette E., Gachon A.-M., Pitiot G.
      Hum. Mol. Genet. 9:289-301(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS AA; AB; AD AND AG), VARIANT THR-159.
    2. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM AA).
    4. "Evidence of an odorant-binding protein in the human olfactory mucus: location, structural characterization, and odorant-binding properties."
      Briand L., Eloit C., Nespoulous C., Bezirard V., Huet J.C., Henry C., Blon F., Trotier D., Pernollet J.C.
      Biochemistry 41:7241-7252(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBUNIT, DISULFIDE BOND.

    Entry informationi

    Entry nameiOBP2A_HUMAN
    AccessioniPrimary (citable) accession number: Q9NY56
    Secondary accession number(s): Q5T8A3
    , Q9NY50, Q9NY53, Q9NY54, Q9NY55
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2002
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 103 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3