Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Odorant-binding protein 2a

Gene

OBP2A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids.1 Publication

GO - Molecular functioni

  1. odorant binding Source: UniProtKB

GO - Biological processi

  1. response to stimulus Source: UniProtKB-KW
  2. sensory perception of chemical stimulus Source: ProtInc
  3. sensory perception of smell Source: UniProtKB-KW
  4. transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Olfaction, Sensory transduction, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Odorant-binding protein 2a
Alternative name(s):
Odorant-binding protein IIa
Short name:
OBPIIa
Gene namesi
Name:OBP2A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:23380. OBP2A.

Subcellular locationi

Secreted Curated

GO - Cellular componenti

  1. extracellular region Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134915019.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 1515Sequence AnalysisAdd
BLAST
Chaini16 – 170155Odorant-binding protein 2aPRO_0000017937Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi74 ↔ 1661 Publication

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ9NY56.
PRIDEiQ9NY56.

PTM databases

PhosphoSiteiQ9NY56.

Expressioni

Tissue specificityi

Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.

Gene expression databases

BgeeiQ9NY56.
CleanExiHS_OBP2A.
ExpressionAtlasiQ9NY56. baseline and differential.
GenevestigatoriQ9NY56.

Organism-specific databases

HPAiHPA055955.

Interactioni

Subunit structurei

Monomer.1 Publication

Protein-protein interaction databases

BioGridi119016. 6 interactions.
STRINGi9606.ENSP00000360841.

Structurei

3D structure databases

ProteinModelPortaliQ9NY56.
SMRiQ9NY56. Positions 24-166.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the calycin superfamily. Lipocalin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiNOG28920.
GeneTreeiENSGT00440000033563.
HOGENOMiHOG000231562.
HOVERGENiHBG101411.
InParanoidiQ9NY56.
PhylomeDBiQ9NY56.
TreeFamiTF338197.

Family and domain databases

Gene3Di2.40.128.20. 1 hit.
InterProiIPR012674. Calycin.
IPR011038. Calycin-like.
IPR000566. Lipocln_cytosolic_FA-bd_dom.
IPR002450. von_Ebner_gland.
[Graphical view]
PfamiPF00061. Lipocalin. 1 hit.
[Graphical view]
PRINTSiPR01175. VNEBNERGLAND.
SUPFAMiSSF50814. SSF50814. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform Aa (identifier: Q9NY56-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKTLFLGVTL GLAAALSFTL EEEDITGTWY VKAMVVDKDF PEDRRPRKVS
60 70 80 90 100
PVKVTALGGG NLEATFTFMR EDRCIQKKIL MRKTEEPGKF SAYGGRKLIY
110 120 130 140 150
LQELPGTDDY VFYCKDQRRG GLRYMGKLVG RNPNTNLEAL EEFKKLVQHK
160 170
GLSEEDIFMP LQTGSCVLEH
Length:170
Mass (Da):19,318
Last modified:October 1, 2000 - v1
Checksum:i391F55E2E3629E75
GO
Isoform Ab (identifier: Q9NY56-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     131-170: RNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH → PCRCPHVGSPGHLTCR

Show »
Length:146
Mass (Da):16,442
Checksum:i7C0774DB7E9E767A
GO
Isoform Ad (identifier: Q9NY56-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-129: ITGTWYVKAM...GGLRYMGKLV → EGESVHPEEN...TLAHLATSPA

Show »
Length:147
Mass (Da):15,821
Checksum:i8D57B038D35F36BA
GO
Isoform Ag (identifier: Q9NY56-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     130-170: GRNPNTNLEA...LQTGSCVLEH → ASAPCRAVPL...SHDPSLLPPT

Show »
Length:228
Mass (Da):26,014
Checksum:iF77392851D8AB471
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti90 – 901F → Y in CAB71326 (PubMed:10607840).Curated
Sequence conflicti149 – 1491H → R in CAB71320 (PubMed:10607840).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti61 – 611N → K.
Corresponds to variant rs3180357 [ dbSNP | Ensembl ].
VAR_034354
Natural varianti130 – 1301G → A.
Corresponds to variant rs55695858 [ dbSNP | Ensembl ].
VAR_061359
Natural varianti133 – 1331P → S.
Corresponds to variant rs3178137 [ dbSNP | Ensembl ].
VAR_061360
Natural varianti159 – 1591M → T.1 Publication
Corresponds to variant rs2853652 [ dbSNP | Ensembl ].
VAR_050176

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei25 – 129105ITGTW…MGKLV → EGESVHPEENPDAEDGGAWQ IQRLWGQEAHIPAGAARDGR LRLLLQRPAPWGPALHGKAC GICSLQGRAAVPTLAHLATS PA in isoform Ad. 1 PublicationVSP_003135Add
BLAST
Alternative sequencei130 – 17041GRNPN…CVLEH → ASAPCRAVPLSPRRLTWPPH LQVGILIPTWRPWKNLRNWC STRDSRRRTFSCPCRREAAF SNTRQPPGLHLQSPPYHQTQ SPDHLDLPSSHDPSLLPPT in isoform Ag. 1 PublicationVSP_003137Add
BLAST
Alternative sequencei131 – 17040RNPNT…CVLEH → PCRCPHVGSPGHLTCR in isoform Ab. 1 PublicationVSP_003136Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ251021 mRNA. Translation: CAB71318.1.
AJ251022 mRNA. Translation: CAB71319.1.
AJ251023 mRNA. Translation: CAB71320.1.
AJ251024 mRNA. Translation: CAB71321.1.
AJ251029 Genomic DNA. Translation: CAB71326.1.
AL161452 Genomic DNA. Translation: CAI14043.1.
BC069563 mRNA. Translation: AAH69563.1.
CCDSiCCDS6992.1. [Q9NY56-1]
RefSeqiNP_001280118.1. NM_001293189.1.
NP_001280122.1. NM_001293193.1.
NP_055397.1. NM_014582.2. [Q9NY56-1]
UniGeneiHs.567489.

Genome annotation databases

EnsembliENST00000371776; ENSP00000360841; ENSG00000122136. [Q9NY56-1]
ENST00000539850; ENSP00000441028; ENSG00000122136. [Q9NY56-1]
GeneIDi29991.
KEGGihsa:29991.
UCSCiuc004cgb.3. human. [Q9NY56-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ251021 mRNA. Translation: CAB71318.1.
AJ251022 mRNA. Translation: CAB71319.1.
AJ251023 mRNA. Translation: CAB71320.1.
AJ251024 mRNA. Translation: CAB71321.1.
AJ251029 Genomic DNA. Translation: CAB71326.1.
AL161452 Genomic DNA. Translation: CAI14043.1.
BC069563 mRNA. Translation: AAH69563.1.
CCDSiCCDS6992.1. [Q9NY56-1]
RefSeqiNP_001280118.1. NM_001293189.1.
NP_001280122.1. NM_001293193.1.
NP_055397.1. NM_014582.2. [Q9NY56-1]
UniGeneiHs.567489.

3D structure databases

ProteinModelPortaliQ9NY56.
SMRiQ9NY56. Positions 24-166.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119016. 6 interactions.
STRINGi9606.ENSP00000360841.

PTM databases

PhosphoSiteiQ9NY56.

Proteomic databases

PaxDbiQ9NY56.
PRIDEiQ9NY56.

Protocols and materials databases

DNASUi29991.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371776; ENSP00000360841; ENSG00000122136. [Q9NY56-1]
ENST00000539850; ENSP00000441028; ENSG00000122136. [Q9NY56-1]
GeneIDi29991.
KEGGihsa:29991.
UCSCiuc004cgb.3. human. [Q9NY56-1]

Organism-specific databases

CTDi29991.
GeneCardsiGC09P138437.
HGNCiHGNC:23380. OBP2A.
HPAiHPA055955.
MIMi164320. gene.
neXtProtiNX_Q9NY56.
PharmGKBiPA134915019.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG28920.
GeneTreeiENSGT00440000033563.
HOGENOMiHOG000231562.
HOVERGENiHBG101411.
InParanoidiQ9NY56.
PhylomeDBiQ9NY56.
TreeFamiTF338197.

Miscellaneous databases

GeneWikiiOBP2A.
GenomeRNAii29991.
NextBioi52776.
PROiQ9NY56.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NY56.
CleanExiHS_OBP2A.
ExpressionAtlasiQ9NY56. baseline and differential.
GenevestigatoriQ9NY56.

Family and domain databases

Gene3Di2.40.128.20. 1 hit.
InterProiIPR012674. Calycin.
IPR011038. Calycin-like.
IPR000566. Lipocln_cytosolic_FA-bd_dom.
IPR002450. von_Ebner_gland.
[Graphical view]
PfamiPF00061. Lipocalin. 1 hit.
[Graphical view]
PRINTSiPR01175. VNEBNERGLAND.
SUPFAMiSSF50814. SSF50814. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres."
    Lacazette E., Gachon A.-M., Pitiot G.
    Hum. Mol. Genet. 9:289-301(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS AA; AB; AD AND AG), VARIANT THR-159.
  2. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM AA).
  4. "Evidence of an odorant-binding protein in the human olfactory mucus: location, structural characterization, and odorant-binding properties."
    Briand L., Eloit C., Nespoulous C., Bezirard V., Huet J.C., Henry C., Blon F., Trotier D., Pernollet J.C.
    Biochemistry 41:7241-7252(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, DISULFIDE BOND.

Entry informationi

Entry nameiOBP2A_HUMAN
AccessioniPrimary (citable) accession number: Q9NY56
Secondary accession number(s): Q5T8A3
, Q9NY50, Q9NY53, Q9NY54, Q9NY55
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2002
Last sequence update: October 1, 2000
Last modified: January 7, 2015
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.