Q9NY56 (OBP2A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Odorant-binding protein 2a Alternative name(s): Odorant-binding protein IIa Short name=OBPIIa | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 170 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. Ref.4 |
| Subunit structure | Monomer. Ref.4 |
| Subcellular location | Secreted Probable. |
| Tissue specificity | Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung. |
| Sequence similarities | Belongs to the calycin superfamily. Lipocalin family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Olfaction Sensory transduction Transport |
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| PTM | Disulfide bond |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | response to stimulus Inferred from electronic annotation. Source: UniProtKB-KW sensory perception of smellInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | odorant binding Non-traceable author statement Ref.1. Source: UniProtKB transporter activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform Aa (identifier: Q9NY56-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform Ab (identifier: Q9NY56-2) The sequence of this isoform differs from the canonical sequence as follows: 131-170: RNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH → PCRCPHVGSPGHLTCR | ||||||
| Isoform Ad (identifier: Q9NY56-3) The sequence of this isoform differs from the canonical sequence as follows: 25-129: ITGTWYVKAM...GGLRYMGKLV → EGESVHPEEN...TLAHLATSPA | ||||||
| Isoform Ag (identifier: Q9NY56-4) The sequence of this isoform differs from the canonical sequence as follows: 130-170: GRNPNTNLEA...LQTGSCVLEH → ASAPCRAVPL...SHDPSLLPPT |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 15 | 15 | Potential | ||||||||
| Chain | 16 – 170 | 155 | Odorant-binding protein 2a | PRO_0000017937 | |||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 74 ↔ 166 | Ref.4 | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 25 – 129 | 105 | ITGTW…MGKLV → EGESVHPEENPDAEDGGAWQ IQRLWGQEAHIPAGAARDGR LRLLLQRPAPWGPALHGKAC GICSLQGRAAVPTLAHLATS PA in isoform Ad. | VSP_003135 | |||||||
| Alternative sequence | 130 – 170 | 41 | GRNPN…CVLEH → ASAPCRAVPLSPRRLTWPPH LQVGILIPTWRPWKNLRNWC STRDSRRRTFSCPCRREAAF SNTRQPPGLHLQSPPYHQTQ SPDHLDLPSSHDPSLLPPT in isoform Ag. | VSP_003137 | |||||||
| Alternative sequence | 131 – 170 | 40 | RNPNT…CVLEH → PCRCPHVGSPGHLTCR in isoform Ab. | VSP_003136 | |||||||
| Natural variant | 61 | 1 | N → K. Corresponds to variant rs3180357 [ dbSNP | Ensembl ]. | VAR_034354 | |||||||
| Natural variant | 130 | 1 | G → A. Corresponds to variant rs55695858 [ dbSNP | Ensembl ]. | VAR_061359 | |||||||
| Natural variant | 133 | 1 | P → S. Corresponds to variant rs3178137 [ dbSNP | Ensembl ]. | VAR_061360 | |||||||
| Natural variant | 159 | 1 | M → T. Ref.1 Corresponds to variant rs2853652 [ dbSNP | Ensembl ]. | VAR_050176 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 90 | 1 | F → Y in CAB71326. Ref.1 | ||||||||
| Sequence conflict | 149 | 1 | H → R in CAB71320. Ref.1 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres." Lacazette E., Gachon A.-M., Pitiot G. Hum. Mol. Genet. 9:289-301(2000) [PubMed: 10607840] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS AA; AB; AD AND AG), VARIANT THR-159. |
| [2] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed: 15164053] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM AA). |
| [4] | "Evidence of an odorant-binding protein in the human olfactory mucus: location, structural characterization, and odorant-binding properties." Briand L., Eloit C., Nespoulous C., Bezirard V., Huet J.C., Henry C., Blon F., Trotier D., Pernollet J.C. Biochemistry 41:7241-7252(2002) [PubMed: 12044155] [Abstract] Cited for: FUNCTION, SUBUNIT, DISULFIDE BOND. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ251021 mRNA. Translation: CAB71318.1. AJ251022 mRNA. Translation: CAB71319.1. AJ251023 mRNA. Translation: CAB71320.1. AJ251024 mRNA. Translation: CAB71321.1. AJ251029 Genomic DNA. Translation: CAB71326.1. AL161452 Genomic DNA. Translation: CAI14043.1. BC069563 mRNA. Translation: AAH69563.1. |
| IPI | IPI00005153. IPI00221280. IPI00221281. IPI00221282. |
| RefSeq | NP_055397.1. NM_014582.2. |
| UniGene | Hs.567489. |
3D structure databases | |
| ProteinModelPortal | Q9NY56. |
| SMR | Q9NY56. Positions 25-168. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9NY56. |
Polymorphism databases | |
| DMDM | 20139237. |
Proteomic databases | |
| PRIDE | Q9NY56. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000371776; ENSP00000360841; ENSG00000122136. |
| GeneID | 29991. |
| KEGG | hsa:29991. |
| UCSC | uc004cgb.1. human. |
Organism-specific databases | |
| CTD | 29991. |
| GeneCards | GC09P138437. |
| H-InvDB | HIX0034789. |
| HGNC | HGNC:23380. OBP2A. |
| MIM | 164320. gene. |
| neXtProt | NX_Q9NY56. |
| PharmGKB | PA134915019. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00440000033563. |
| HOVERGEN | HBG101411. |
Gene expression databases | |
| ArrayExpress | Q9NY56. |
| Bgee | Q9NY56. |
| CleanEx | HS_OBP2A. |
| Genevestigator | Q9NY56. |
| GermOnline | ENSG00000122136. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR012674. Calycin. IPR011038. Calycin-like. IPR000566. Lipocln_cytosolic_FA-bd_dom. IPR002450. vonEbner_gland. [Graphical view] |
| Gene3D | G3DSA:2.40.128.20. Calycin. 1 hit. |
| Pfam | PF00061. Lipocalin. 1 hit. [Graphical view] |
| PRINTS | PR01175. VNEBNERGLAND. |
| SUPFAM | SSF50814. Calycin. 1 hit. |
| PROSITE | PS00213. LIPOCALIN. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 52776. |
| SOURCE | Search... |
Entry information
| Entry name | OBP2A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NY56 Secondary accession number(s): Q5T8A3 Q9NY55 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with