Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NY56 (OBP2A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Odorant-binding protein 2a
Alternative name(s):
Odorant-binding protein IIa
Short name=OBPIIa
Gene names
Name:OBP2A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length170 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. Ref.4

Subunit structure

Monomer. Ref.4

Subcellular location

Secreted Probable.

Tissue specificity

Strongly expressed in the nasal structures, salivary and lachrymal glands, and lung.

Sequence similarities

Belongs to the calycin superfamily. Lipocalin family.

Ontologies

Keywords
   Biological processOlfaction
Sensory transduction
Transport
   Cellular componentSecreted
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal
   PTMDisulfide bond
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processresponse to stimulus

Inferred from electronic annotation. Source: UniProtKB-KW

sensory perception of chemical stimulus

Traceable author statement Ref.1. Source: ProtInc

sensory perception of smell

Inferred from electronic annotation. Source: UniProtKB-KW

transport

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentextracellular region

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionodorant binding

Non-traceable author statement Ref.1. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform Aa (identifier: Q9NY56-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform Ab (identifier: Q9NY56-2)

The sequence of this isoform differs from the canonical sequence as follows:
     131-170: RNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH → PCRCPHVGSPGHLTCR
Isoform Ad (identifier: Q9NY56-3)

The sequence of this isoform differs from the canonical sequence as follows:
     25-129: ITGTWYVKAM...GGLRYMGKLV → EGESVHPEEN...TLAHLATSPA
Isoform Ag (identifier: Q9NY56-4)

The sequence of this isoform differs from the canonical sequence as follows:
     130-170: GRNPNTNLEA...LQTGSCVLEH → ASAPCRAVPL...SHDPSLLPPT

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 1515 Potential
Chain16 – 170155Odorant-binding protein 2a
PRO_0000017937

Amino acid modifications

Disulfide bond74 ↔ 166 Ref.4

Natural variations

Alternative sequence25 – 129105ITGTW…MGKLV → EGESVHPEENPDAEDGGAWQ IQRLWGQEAHIPAGAARDGR LRLLLQRPAPWGPALHGKAC GICSLQGRAAVPTLAHLATS PA in isoform Ad.
VSP_003135
Alternative sequence130 – 17041GRNPN…CVLEH → ASAPCRAVPLSPRRLTWPPH LQVGILIPTWRPWKNLRNWC STRDSRRRTFSCPCRREAAF SNTRQPPGLHLQSPPYHQTQ SPDHLDLPSSHDPSLLPPT in isoform Ag.
VSP_003137
Alternative sequence131 – 17040RNPNT…CVLEH → PCRCPHVGSPGHLTCR in isoform Ab.
VSP_003136
Natural variant611N → K.
Corresponds to variant rs3180357 [ dbSNP | Ensembl ].
VAR_034354
Natural variant1301G → A.
Corresponds to variant rs55695858 [ dbSNP | Ensembl ].
VAR_061359
Natural variant1331P → S.
Corresponds to variant rs3178137 [ dbSNP | Ensembl ].
VAR_061360
Natural variant1591M → T. Ref.1
Corresponds to variant rs2853652 [ dbSNP | Ensembl ].
VAR_050176

Experimental info

Sequence conflict901F → Y in CAB71326. Ref.1
Sequence conflict1491H → R in CAB71320. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform Aa [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 391F55E2E3629E75

FASTA17019,318
        10         20         30         40         50         60 
MKTLFLGVTL GLAAALSFTL EEEDITGTWY VKAMVVDKDF PEDRRPRKVS PVKVTALGGG 

        70         80         90        100        110        120 
NLEATFTFMR EDRCIQKKIL MRKTEEPGKF SAYGGRKLIY LQELPGTDDY VFYCKDQRRG 

       130        140        150        160        170 
GLRYMGKLVG RNPNTNLEAL EEFKKLVQHK GLSEEDIFMP LQTGSCVLEH 

« Hide

Isoform Ab [UniParc].

Checksum: 7C0774DB7E9E767A
Show »

FASTA14616,442
Isoform Ad [UniParc].

Checksum: 8D57B038D35F36BA
Show »

FASTA14715,821
Isoform Ag [UniParc].

Checksum: F77392851D8AB471
Show »

FASTA22826,014

References

« Hide 'large scale' references
[1]"A novel human odorant-binding protein gene family resulting from genomic duplicons at 9q34: differential expression in the oral and genital spheres."
Lacazette E., Gachon A.-M., Pitiot G.
Hum. Mol. Genet. 9:289-301(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA / MRNA] (ISOFORMS AA; AB; AD AND AG), VARIANT THR-159.
[2]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM AA).
[4]"Evidence of an odorant-binding protein in the human olfactory mucus: location, structural characterization, and odorant-binding properties."
Briand L., Eloit C., Nespoulous C., Bezirard V., Huet J.C., Henry C., Blon F., Trotier D., Pernollet J.C.
Biochemistry 41:7241-7252(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBUNIT, DISULFIDE BOND.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ251021 mRNA. Translation: CAB71318.1.
AJ251022 mRNA. Translation: CAB71319.1.
AJ251023 mRNA. Translation: CAB71320.1.
AJ251024 mRNA. Translation: CAB71321.1.
AJ251029 Genomic DNA. Translation: CAB71326.1.
AL161452 Genomic DNA. Translation: CAI14043.1.
BC069563 mRNA. Translation: AAH69563.1.
CCDSCCDS6992.1. [Q9NY56-1]
RefSeqNP_055397.1. NM_014582.2. [Q9NY56-1]
UniGeneHs.567489.

3D structure databases

ProteinModelPortalQ9NY56.
SMRQ9NY56. Positions 24-166.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

STRING9606.ENSP00000360841.

PTM databases

PhosphoSiteQ9NY56.

Proteomic databases

PaxDbQ9NY56.
PRIDEQ9NY56.

Protocols and materials databases

DNASU29991.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000371776; ENSP00000360841; ENSG00000122136. [Q9NY56-1]
ENST00000539850; ENSP00000441028; ENSG00000122136. [Q9NY56-1]
GeneID29991.
KEGGhsa:29991.
UCSCuc004cgb.3. human. [Q9NY56-1]

Organism-specific databases

CTD29991.
GeneCardsGC09P138437.
HGNCHGNC:23380. OBP2A.
HPAHPA055955.
MIM164320. gene.
neXtProtNX_Q9NY56.
PharmGKBPA134915019.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG28920.
HOGENOMHOG000231562.
HOVERGENHBG101411.
PhylomeDBQ9NY56.
TreeFamTF338197.

Gene expression databases

ArrayExpressQ9NY56.
BgeeQ9NY56.
CleanExHS_OBP2A.
GenevestigatorQ9NY56.

Family and domain databases

Gene3D2.40.128.20. 1 hit.
InterProIPR012674. Calycin.
IPR011038. Calycin-like.
IPR000566. Lipocln_cytosolic_FA-bd_dom.
IPR002450. von_Ebner_gland.
[Graphical view]
PfamPF00061. Lipocalin. 1 hit.
[Graphical view]
PRINTSPR01175. VNEBNERGLAND.
SUPFAMSSF50814. SSF50814. 1 hit.
ProtoNetSearch...

Other

GeneWikiOBP2A.
GenomeRNAi29991.
NextBio52776.
PROQ9NY56.
SOURCESearch...

Entry information

Entry nameOBP2A_HUMAN
AccessionPrimary (citable) accession number: Q9NY56
Secondary accession number(s): Q5T8A3 expand/collapse secondary AC list , Q9NY50, Q9NY53, Q9NY54, Q9NY55
Entry history
Integrated into UniProtKB/Swiss-Prot: April 3, 2002
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM