Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BTG4

Gene

BTG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Shows marked antiproliferative activity, being able to induce G1 arrest.

GO - Biological processi

  • cell cycle arrest Source: UniProtKB
  • negative regulation of cell proliferation Source: UniProtKB
  • negative regulation of mitotic cell cycle Source: Ensembl
  • neuron differentiation Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BTG4
Alternative name(s):
BTG family member 4
Protein PC3b
Gene namesi
Name:BTG4
Synonyms:PC3B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000137707.13
HGNCiHGNC:13862 BTG4
MIMi605673 gene
neXtProtiNX_Q9NY30

Pathology & Biotechi

Organism-specific databases

DisGeNETi54766
OpenTargetsiENSG00000137707
PharmGKBiPA25453

Polymorphism and mutation databases

BioMutaiBTG4
DMDMi13626142

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001438101 – 223Protein BTG4Add BLAST223

Proteomic databases

PaxDbiQ9NY30
PeptideAtlasiQ9NY30
PRIDEiQ9NY30
ProteomicsDBi83158

PTM databases

iPTMnetiQ9NY30
PhosphoSitePlusiQ9NY30

Expressioni

Tissue specificityi

Highly expressed in testis and in olfactory epithelium.

Gene expression databases

BgeeiENSG00000137707
CleanExiHS_BTG4
ExpressionAtlasiQ9NY30 baseline and differential
GenevisibleiQ9NY30 HS

Organism-specific databases

HPAiHPA057157

Interactioni

Protein-protein interaction databases

BioGridi120141, 1 interactor
STRINGi9606.ENSP00000348300

Structurei

3D structure databases

ProteinModelPortaliQ9NY30
SMRiQ9NY30
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the BTG family.Curated

Phylogenomic databases

eggNOGiKOG4006 Eukaryota
ENOG410ZZC0 LUCA
GeneTreeiENSGT00550000074461
HOGENOMiHOG000234823
HOVERGENiHBG004332
InParanoidiQ9NY30
KOiK14443
OMAiDRYHWVN
OrthoDBiEOG091G0U1P
PhylomeDBiQ9NY30
TreeFamiTF105272

Family and domain databases

Gene3Di1.20.120.1120, 1 hit
InterProiView protein in InterPro
IPR002087 Anti_prolifrtn
IPR036054 BTG-like_sf
IPR033332 BTG4
PANTHERiPTHR22978:SF5 PTHR22978:SF5, 1 hit
PfamiView protein in Pfam
PF07742 BTG, 1 hit
PRINTSiPR00310 ANTIPRLFBTG1
SMARTiView protein in SMART
SM00099 btg1, 1 hit
SUPFAMiSSF160696 SSF160696, 1 hit
PROSITEiView protein in PROSITE
PS00960 BTG_1, 1 hit
PS01203 BTG_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NY30-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRDEIATTVF FVTRLVKKHD KLSKQQIEDF AEKLMTILFE TYRSHWHSDC
60 70 80 90 100
PSKGQAFRCI RINNNQNKDP ILERACVESN VDFSHLGLPK EMTIWVDPFE
110 120 130 140 150
VCCRYGEKNH PFTVASFKGR WEEWELYQQI SYAVSRASSD VSSGTSCDEE
160 170 180 190 200
SCSKEPRVIP KVSNPKSIYQ VENLKQPFQS WLQIPRKKNV VDGRVGLLGN
210 220
TYHGSQKHPK CYRPAMHRLD RIL
Length:223
Mass (Da):25,970
Last modified:October 1, 2000 - v1
Checksum:i7F78E134114D3E6E
GO
Isoform 2 (identifier: Q9NY30-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-223: ENLKQPFQSW...PAMHRLDRIL → KSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL

Note: No experimental confirmation available.
Show »
Length:206
Mass (Da):24,008
Checksum:iC4DA772A08D2FE4B
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_053851172 – 223ENLKQ…LDRIL → KSVPVLFYTFFLSNSKKNAL IMKTKKQKNMERTKL in isoform 2. 1 PublicationAdd BLAST52

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ271351 mRNA Translation: CAB69821.1
AP002008 Genomic DNA No translation available.
BC031045 mRNA Translation: AAH31045.1
CCDSiCCDS8346.1 [Q9NY30-1]
RefSeqiNP_060059.1, NM_017589.3 [Q9NY30-1]
UniGeneiHs.128180
Hs.733573
Hs.734027

Genome annotation databases

EnsembliENST00000356018; ENSP00000348300; ENSG00000137707 [Q9NY30-1]
ENST00000525791; ENSP00000432018; ENSG00000137707 [Q9NY30-2]
GeneIDi54766
KEGGihsa:54766
UCSCiuc001plj.4 human [Q9NY30-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBTG4_HUMAN
AccessioniPrimary (citable) accession number: Q9NY30
Secondary accession number(s): Q8NEH7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: October 1, 2000
Last modified: June 20, 2018
This is version 114 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health