Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BTG4

Gene

BTG4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Shows marked antiproliferative activity, being able to induce G1 arrest.

GO - Biological processi

  • cell cycle arrest Source: UniProtKB
  • negative regulation of cell proliferation Source: UniProtKB
  • negative regulation of mitotic cell cycle Source: Ensembl
  • neuron differentiation Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BTG4
Alternative name(s):
BTG family member 4
Protein PC3b
Gene namesi
Name:BTG4
Synonyms:PC3B
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:13862. BTG4.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25453.

Polymorphism and mutation databases

BioMutaiBTG4.
DMDMi13626142.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 223223Protein BTG4PRO_0000143810Add
BLAST

Proteomic databases

PaxDbiQ9NY30.
PRIDEiQ9NY30.

PTM databases

iPTMnetiQ9NY30.
PhosphoSiteiQ9NY30.

Expressioni

Tissue specificityi

Highly expressed in testis and in olfactory epithelium.

Gene expression databases

BgeeiQ9NY30.
CleanExiHS_BTG4.
ExpressionAtlasiQ9NY30. baseline and differential.
GenevisibleiQ9NY30. HS.

Interactioni

Protein-protein interaction databases

BioGridi120141. 1 interaction.
STRINGi9606.ENSP00000348300.

Structurei

3D structure databases

ProteinModelPortaliQ9NY30.
SMRiQ9NY30. Positions 1-107.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the BTG family.Curated

Phylogenomic databases

eggNOGiKOG4006. Eukaryota.
ENOG410ZZC0. LUCA.
GeneTreeiENSGT00550000074461.
HOGENOMiHOG000234823.
HOVERGENiHBG004332.
InParanoidiQ9NY30.
KOiK14443.
OMAiFEKYKNH.
OrthoDBiEOG786H63.
PhylomeDBiQ9NY30.
TreeFamiTF105272.

Family and domain databases

InterProiIPR002087. Anti_prolifrtn.
IPR033332. BTG4.
[Graphical view]
PANTHERiPTHR22978:SF5. PTHR22978:SF5. 1 hit.
PfamiPF07742. BTG. 1 hit.
[Graphical view]
PRINTSiPR00310. ANTIPRLFBTG1.
SMARTiSM00099. btg1. 1 hit.
[Graphical view]
SUPFAMiSSF160696. SSF160696. 1 hit.
PROSITEiPS00960. BTG_1. 1 hit.
PS01203. BTG_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NY30-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRDEIATTVF FVTRLVKKHD KLSKQQIEDF AEKLMTILFE TYRSHWHSDC
60 70 80 90 100
PSKGQAFRCI RINNNQNKDP ILERACVESN VDFSHLGLPK EMTIWVDPFE
110 120 130 140 150
VCCRYGEKNH PFTVASFKGR WEEWELYQQI SYAVSRASSD VSSGTSCDEE
160 170 180 190 200
SCSKEPRVIP KVSNPKSIYQ VENLKQPFQS WLQIPRKKNV VDGRVGLLGN
210 220
TYHGSQKHPK CYRPAMHRLD RIL
Length:223
Mass (Da):25,970
Last modified:October 1, 2000 - v1
Checksum:i7F78E134114D3E6E
GO
Isoform 2 (identifier: Q9NY30-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-223: ENLKQPFQSW...PAMHRLDRIL → KSVPVLFYTFFLSNSKKNALIMKTKKQKNMERTKL

Note: No experimental confirmation available.
Show »
Length:206
Mass (Da):24,008
Checksum:iC4DA772A08D2FE4B
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei172 – 22352ENLKQ…LDRIL → KSVPVLFYTFFLSNSKKNAL IMKTKKQKNMERTKL in isoform 2. 1 PublicationVSP_053851Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ271351 mRNA. Translation: CAB69821.1.
AP002008 Genomic DNA. No translation available.
BC031045 mRNA. Translation: AAH31045.1.
CCDSiCCDS8346.1. [Q9NY30-1]
RefSeqiNP_060059.1. NM_017589.3. [Q9NY30-1]
UniGeneiHs.128180.
Hs.733573.
Hs.734027.

Genome annotation databases

EnsembliENST00000356018; ENSP00000348300; ENSG00000137707. [Q9NY30-1]
ENST00000525791; ENSP00000432018; ENSG00000137707. [Q9NY30-2]
GeneIDi54766.
KEGGihsa:54766.
UCSCiuc001plj.4. human. [Q9NY30-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ271351 mRNA. Translation: CAB69821.1.
AP002008 Genomic DNA. No translation available.
BC031045 mRNA. Translation: AAH31045.1.
CCDSiCCDS8346.1. [Q9NY30-1]
RefSeqiNP_060059.1. NM_017589.3. [Q9NY30-1]
UniGeneiHs.128180.
Hs.733573.
Hs.734027.

3D structure databases

ProteinModelPortaliQ9NY30.
SMRiQ9NY30. Positions 1-107.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120141. 1 interaction.
STRINGi9606.ENSP00000348300.

PTM databases

iPTMnetiQ9NY30.
PhosphoSiteiQ9NY30.

Polymorphism and mutation databases

BioMutaiBTG4.
DMDMi13626142.

Proteomic databases

PaxDbiQ9NY30.
PRIDEiQ9NY30.

Protocols and materials databases

DNASUi54766.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356018; ENSP00000348300; ENSG00000137707. [Q9NY30-1]
ENST00000525791; ENSP00000432018; ENSG00000137707. [Q9NY30-2]
GeneIDi54766.
KEGGihsa:54766.
UCSCiuc001plj.4. human. [Q9NY30-1]

Organism-specific databases

CTDi54766.
GeneCardsiBTG4.
HGNCiHGNC:13862. BTG4.
MIMi605673. gene.
neXtProtiNX_Q9NY30.
PharmGKBiPA25453.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4006. Eukaryota.
ENOG410ZZC0. LUCA.
GeneTreeiENSGT00550000074461.
HOGENOMiHOG000234823.
HOVERGENiHBG004332.
InParanoidiQ9NY30.
KOiK14443.
OMAiFEKYKNH.
OrthoDBiEOG786H63.
PhylomeDBiQ9NY30.
TreeFamiTF105272.

Miscellaneous databases

GeneWikiiBTG4.
GenomeRNAii54766.
PROiQ9NY30.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NY30.
CleanExiHS_BTG4.
ExpressionAtlasiQ9NY30. baseline and differential.
GenevisibleiQ9NY30. HS.

Family and domain databases

InterProiIPR002087. Anti_prolifrtn.
IPR033332. BTG4.
[Graphical view]
PANTHERiPTHR22978:SF5. PTHR22978:SF5. 1 hit.
PfamiPF07742. BTG. 1 hit.
[Graphical view]
PRINTSiPR00310. ANTIPRLFBTG1.
SMARTiSM00099. btg1. 1 hit.
[Graphical view]
SUPFAMiSSF160696. SSF160696. 1 hit.
PROSITEiPS00960. BTG_1. 1 hit.
PS01203. BTG_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of PC3B, a novel member of the PC3/BTG/TOB family of growth inhibitory genes, highly expressed in the olfactory epithelium."
    Buanne P., Corrente G., Micheli L., Palena A., Lavia P., Spadafora C., Lakshmana M.K., Rinaldi A., Banfi S., Quarto M., Bulfone A., Tirone F.
    Genomics 68:253-263(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.

Entry informationi

Entry nameiBTG4_HUMAN
AccessioniPrimary (citable) accession number: Q9NY30
Secondary accession number(s): Q8NEH7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 27, 2001
Last sequence update: October 1, 2000
Last modified: June 8, 2016
This is version 103 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.