Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein phosphatase 4 regulatory subunit 2

Gene

PPP4R2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulatory subunit of serine/threonine-protein phosphatase 4 (PP4). May regulate the activity of PPP4C at centrosomal microtubule organizing centers. Its interaction with the SMN complex leads to enhance the temporal localization of snRNPs, suggesting a role of PPP4C in maturation of spliceosomal snRNPs. The PPP4C-PPP4R2-PPP4R3A PP4 complex specifically dephosphorylates H2AFX phosphorylated on 'Ser-140' (gamma-H2AFX) generated during DNA replication and required for DNA double strand break repair. Mediates RPA2 dephosphorylation by recruiting PPP4C to RPA2 in a DNA damage-dependent manner. RPA2 dephosphorylation is required for the efficient RPA2-mediated recruitment of RAD51 to chromatin following double strand breaks, an essential step for DNA repair.4 Publications

GO - Molecular functioni

  • protein binding, bridging Source: UniProtKB
  • protein phosphatase type 4 regulator activity Source: UniProtKB

GO - Biological processi

  • cellular protein modification process Source: ProtInc
  • mRNA processing Source: UniProtKB-KW
  • regulation of double-strand break repair via homologous recombination Source: UniProtKB
  • RNA splicing Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

mRNA processing, mRNA splicing

Enzyme and pathway databases

BioCyciZFISH:ENSG00000163605-MONOMER.
ReactomeiR-HSA-5693607. Processing of DNA double-strand break ends.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein phosphatase 4 regulatory subunit 2
Gene namesi
Name:PPP4R2
ORF Names:SBBI57
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:18296. PPP4R2.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: ProtInc
  • cytoplasm Source: UniProtKB-KW
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • protein phosphatase 4 complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi99F → A: No effect on RPA2-binding; decrease in PPP4C-binding. 1 Publication1
Mutagenesisi103R → A: No effect on RPA2-binding; loss of PPP4C-binding. 1 Publication1
Mutagenesisi106E → A: No effect on RPA2-binding, nor on PPP4C-binding. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000163605.
PharmGKBiPA38520.

Polymorphism and mutation databases

BioMutaiPPP4R2.
DMDMi158564082.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002993651 – 417Serine/threonine-protein phosphatase 4 regulatory subunit 2Add BLAST417

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei159PhosphoserineCombined sources1
Modified residuei226PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NY27.
MaxQBiQ9NY27.
PaxDbiQ9NY27.
PeptideAtlasiQ9NY27.
PRIDEiQ9NY27.

PTM databases

iPTMnetiQ9NY27.
PhosphoSitePlusiQ9NY27.
SwissPalmiQ9NY27.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiENSG00000163605.
CleanExiHS_PPP4R2.
ExpressionAtlasiQ9NY27. baseline and differential.
GenevisibleiQ9NY27. HS.

Organism-specific databases

HPAiHPA034695.
HPA039837.

Interactioni

Subunit structurei

Serine/threonine-protein phosphatase 4 (PP4) occurs in different assemblies of the catalytic and one or more regulatory subunits. Component of the PP4 complexes PPP4C-PPP4R2, PPP4C-PPP4R2-PPP4R3A and PPP4C-PPP4R2-PPP4R3B. The PPP4C-PPP4R2 complex appears to be a tetramer composed of 2 molecules of PPP4C and 2 molecules of PPP4R2. Interacts with DDX20/GEMIN3 and GEMIN4. Interacts with RPA2; this DNA damage-dependent interaction recruits PPP4C leading to RPA2 dephosphorylation.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
PPP4CP6051010EBI-1048740,EBI-1046072

GO - Molecular functioni

  • protein binding, bridging Source: UniProtKB

Protein-protein interaction databases

BioGridi127414. 47 interactors.
IntActiQ9NY27. 14 interactors.
MINTiMINT-8214437.
STRINGi9606.ENSP00000349124.

Structurei

3D structure databases

ProteinModelPortaliQ9NY27.
SMRiQ9NY27.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi298 – 415Glu-richAdd BLAST118

Sequence similaritiesi

Belongs to the PPP4R2 family.Curated

Phylogenomic databases

eggNOGiKOG3175. Eukaryota.
ENOG4110IV7. LUCA.
GeneTreeiENSGT00390000007637.
HOGENOMiHOG000060339.
HOVERGENiHBG101227.
InParanoidiQ9NY27.
KOiK15425.
OMAiEDKNHSD.
OrthoDBiEOG091G0J61.
PhylomeDBiQ9NY27.
TreeFamiTF105561.

Family and domain databases

InterProiIPR015267. PPP4R2.
[Graphical view]
PANTHERiPTHR16487. PTHR16487. 1 hit.
PfamiPF09184. PPP4R2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NY27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDVERLQEAL KDFEKRGKKE VCPVLDQFLC HVAKTGETMI QWSQFKGYFI
60 70 80 90 100
FKLEKVMDDF RTSAPEPRGP PNPNVEYIPF DEMKERILKI VTGFNGIPFT
110 120 130 140 150
IQRLCELLTD PRRNYTGTDK FLRGVEKNVM VVSCVYPSSE KNNSNSLNRM
160 170 180 190 200
NGVMFPGNSP SYTERSNING PGTPRPLNRP KVSLSAPMTT NGLPESTDSK
210 220 230 240 250
EANLQQNEEK NHSDSSTSES EVSSVSPLKN KHPDEDAVEA EGHEVKRLRF
260 270 280 290 300
DKEGEVRETA SQTTSSEISS VMVGETEASS SSQDKDKDSR CTRQHCTEED
310 320 330 340 350
EEEDEEEEEE SFMTSREMIP ERKNQEKESD DALTVNEETS EENNQMEESD
360 370 380 390 400
VSQAEKDLLH SEGSENEGPV SSSSSDCRET EELVGSNSSK TGEILSESSM
410
ENDDEATEVT DEPMEQD
Length:417
Mass (Da):46,898
Last modified:September 11, 2007 - v3
Checksum:i75298CD34A202F40
GO
Isoform 2 (identifier: Q9NY27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     39-96: MIQWSQFKGYFIFKLEKVMDDFRTSAPEPRGPPNPNVEYIPFDEMKERILKIVTGFNG → I

Note: No experimental confirmation available.
Show »
Length:360
Mass (Da):40,175
Checksum:i8008773931775213
GO
Isoform 3 (identifier: Q9NY27-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: Missing.

Note: No experimental confirmation available.
Show »
Length:361
Mass (Da):40,249
Checksum:i3B1868993A26757A
GO

Sequence cautioni

The sequence AAI00282 differs from that shown. Contaminating sequence. Potential poly-A sequence.Curated
The sequence CAB93534 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051749174P → L.Corresponds to variant rs2306983dbSNPEnsembl.1
Natural variantiVAR_034811282S → C.Corresponds to variant rs34742137dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0276121 – 56Missing in isoform 3. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_02761339 – 96MIQWS…TGFNG → I in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ271448 mRNA. Translation: CAB93534.2. Different initiation.
AF327345 mRNA. Translation: AAL56006.1.
AK289901 mRNA. Translation: BAF82590.1.
CH471055 Genomic DNA. Translation: EAW65530.1.
BC100281 mRNA. Translation: AAI00282.1. Sequence problems.
BC110889 mRNA. Translation: AAI10890.1.
BC128136 mRNA. Translation: AAI28137.1.
BC128137 mRNA. Translation: AAI28138.1.
CCDSiCCDS2917.1. [Q9NY27-1]
RefSeqiNP_001304954.1. NM_001318025.1. [Q9NY27-2]
NP_001304955.1. NM_001318026.1.
NP_001304956.1. NM_001318027.1.
NP_777567.1. NM_174907.3. [Q9NY27-1]
UniGeneiHs.431092.

Genome annotation databases

EnsembliENST00000356692; ENSP00000349124; ENSG00000163605. [Q9NY27-1]
GeneIDi151987.
KEGGihsa:151987.
UCSCiuc003dph.2. human. [Q9NY27-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ271448 mRNA. Translation: CAB93534.2. Different initiation.
AF327345 mRNA. Translation: AAL56006.1.
AK289901 mRNA. Translation: BAF82590.1.
CH471055 Genomic DNA. Translation: EAW65530.1.
BC100281 mRNA. Translation: AAI00282.1. Sequence problems.
BC110889 mRNA. Translation: AAI10890.1.
BC128136 mRNA. Translation: AAI28137.1.
BC128137 mRNA. Translation: AAI28138.1.
CCDSiCCDS2917.1. [Q9NY27-1]
RefSeqiNP_001304954.1. NM_001318025.1. [Q9NY27-2]
NP_001304955.1. NM_001318026.1.
NP_001304956.1. NM_001318027.1.
NP_777567.1. NM_174907.3. [Q9NY27-1]
UniGeneiHs.431092.

3D structure databases

ProteinModelPortaliQ9NY27.
SMRiQ9NY27.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127414. 47 interactors.
IntActiQ9NY27. 14 interactors.
MINTiMINT-8214437.
STRINGi9606.ENSP00000349124.

PTM databases

iPTMnetiQ9NY27.
PhosphoSitePlusiQ9NY27.
SwissPalmiQ9NY27.

Polymorphism and mutation databases

BioMutaiPPP4R2.
DMDMi158564082.

Proteomic databases

EPDiQ9NY27.
MaxQBiQ9NY27.
PaxDbiQ9NY27.
PeptideAtlasiQ9NY27.
PRIDEiQ9NY27.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000356692; ENSP00000349124; ENSG00000163605. [Q9NY27-1]
GeneIDi151987.
KEGGihsa:151987.
UCSCiuc003dph.2. human. [Q9NY27-1]

Organism-specific databases

CTDi151987.
GeneCardsiPPP4R2.
HGNCiHGNC:18296. PPP4R2.
HPAiHPA034695.
HPA039837.
MIMi613822. gene.
neXtProtiNX_Q9NY27.
OpenTargetsiENSG00000163605.
PharmGKBiPA38520.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3175. Eukaryota.
ENOG4110IV7. LUCA.
GeneTreeiENSGT00390000007637.
HOGENOMiHOG000060339.
HOVERGENiHBG101227.
InParanoidiQ9NY27.
KOiK15425.
OMAiEDKNHSD.
OrthoDBiEOG091G0J61.
PhylomeDBiQ9NY27.
TreeFamiTF105561.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000163605-MONOMER.
ReactomeiR-HSA-5693607. Processing of DNA double-strand break ends.

Miscellaneous databases

ChiTaRSiPPP4R2. human.
GenomeRNAii151987.
PROiQ9NY27.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000163605.
CleanExiHS_PPP4R2.
ExpressionAtlasiQ9NY27. baseline and differential.
GenevisibleiQ9NY27. HS.

Family and domain databases

InterProiIPR015267. PPP4R2.
[Graphical view]
PANTHERiPTHR16487. PTHR16487. 1 hit.
PfamiPF09184. PPP4R2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiPP4R2_HUMAN
AccessioniPrimary (citable) accession number: Q9NY27
Secondary accession number(s): A8K1I6
, Q2TAJ9, Q498B8, Q8WXX6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: November 30, 2016
This is version 112 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.