Reviewed,
UniProtKB/Swiss-Prot Q9NXR7 (BRE_HUMAN)
Last modified
November 3, 2009.
Version 60.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: BRCA1-A complex subunit BRE Alternative name(s): Brain and reproductive organ-expressed protein BRCA1/BRCA2-containing complex subunit 45 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 383 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Component of the BRCA1-A complex, a complex that specifically recognizes 'Lys-63'-linked ubiquitinated histones H2A and H2AX at DNA lesions sites, leading to target the BRCA1-BARD1 heterodimer to sites of DNA damage at double-strand breaks (DSBs). The BRCA1-A complex also possesses deubiquitinase activity that specifically removes 'Lys-63'-linked ubiquitin on histones H2A and H2AX. In the BRCA1-A complex, it acts as an adapter that bridges the interaction between MERIT40/NBA1 and the rest of the complex, thereby being required for the complex integrity and modulating the E3 ubiquitin ligase activity of the BRCA1-BARD1 heterodimer. Probably also plays a role as a component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. May play a role in homeostasis or cellular differentiation in cells of neural, epithelial and germline origins. May also act as a death receptor-associated anti-apoptotic protein, which inhibits the mitochondrial apoptotic pathway. May regulate TNF-alpha signaling through its interactions with TNFRSF1A; however these effects may be indirect. Ref.3 Ref.9 Ref.13 Ref.14 |
| Subunit structure | Component of the BRCA1-A complex, at least composed of the BRCA1, BARD1, UIMC1/RAP80, FAM175A/Abraxas, BRCC3/BRCC36, BRE/BRCC45 and MERIT40/NBA1. In the BRCA1-A complex, interacts directly with FAM175A/Abraxas, BRCC3/BRCC36 and MERIT40/NBA1. Binds polyubiquitin. Component of the BRISC complex, at least composed of the FAM175B/ABRO1, BRCC3/BRCC36, BRE/BRCC45 and MERIT40/NBA1. Component of the BRCA1/BRCA2 containing complex (BRCC), which also contains BRCA1, BRCA2, BARD1, BRCC3/BRCC36 and RAD51. BRCC is a ubiquitin E3 ligase complex that enhances cellular survival following DNA damage. May interact with FAS and TNFRSF1A. Ref.9 Ref.13 Ref.14 |
| Subcellular location | Cytoplasm. Nucleus. Note: Localizes at sites of DNA damage at double-strand breaks (DSBs). Ref.9 Ref.14 |
| Tissue specificity | Expressed in all cell lines examined. Highly expressed in placenta. Ref.2 |
| Induction | Down-regulated by DNA-damaging agents in fibroblasts, by retinoic acid in brain glioma U-251 and promyelocytic HL-60 cell lines, and by LPS in peripheral blood mononuclear cells (PBMC). Ref.2 Ref.1 |
| Domain | Contains 2 ubiquitin-conjugating enzyme family-like (UEV-like) regions. These regions lack the critical Cys residues required for ubiquitination but retain the ability to bind ubiquitin. Ref.13 |
| Sequence similarities | Belongs to the BRE family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BRCC3 | P46736 | 1 | EBI-949389,EBI-750352 | |
| FAM175B | Q15018 | 1 | EBI-949389,EBI-1056583 | |
| MERIT40 | Q9NWV8 | 1 | EBI-949389,EBI-745725 |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Additional isoforms may exist. | ||||||
| Isoform 2 Ref.3 Ref.4 (identifier: Q9NXR7-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation exists. | ||||||
| Isoform 1 (identifier: Q9NXR7-1) The sequence of this isoform differs from the canonical sequence as follows: 364-383: AYFKTFVPQFQEAAFANGKL → GCQGSRDACSPWEQVLAFAVAKTGCKLLQPQRNWPSSRGPPWRASEGERTAQ | ||||||
| Isoform 3 Ref.2 (identifier: Q9NXR7-3) Also known as: Alpha a'; The sequence of this isoform differs from the canonical sequence as follows: 363-383: KAYFKTFVPQFQEAAFANGKL → NSRRQHLPMESSRKHQS | ||||||
| Isoform 4 (identifier: Q9NXR7-4) The sequence of this isoform differs from the canonical sequence as follows: 364-383: AYFKTFVPQFQEAAFANGKL → RESNRDGEESSSA |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 383 | 383 | BRCA1-A complex subunit BRE | PRO_0000224189 | |||||
Regions | |||||||||
| Region | 30 – 147 | 118 | UEV-like 1 | ||||||
| Region | 275 – 364 | 90 | UEV-like 2 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 270 | 1 | N6-acetyllysine Ref.15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 363 – 383 | 21 | KAYFK…ANGKL → NSRRQHLPMESSRKHQS in isoform 3. | VSP_051957 | |||||
| Alternative sequence | 364 – 383 | 20 | AYFKT…ANGKL → GCQGSRDACSPWEQVLAFAV AKTGCKLLQPQRNWPSSRGP PWRASEGERTAQ in isoform 1. | VSP_051956 | |||||
| Alternative sequence | 364 – 383 | 20 | AYFKT…ANGKL → RESNRDGEESSSA in isoform 4. | VSP_037261 | |||||
Experimental info | |||||||||
| Sequence conflict | 192 | 1 | V → L in BAF83775. Ref.5 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a brain- and reproductive-organs-specific gene responsive to DNA damage and retinoic acid." Li L., Yoo H., Becker F.F., Ali-Osman F., Chan J.Y.-H. Biochem. Biophys. Res. Commun. 206:764-774(1995) [PubMed: 7826398] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INDUCTION. |
| [2] | "Expression of human BRE in multiple isoforms." Ching A.K.K., Li P.S., Li Q., Chan B.C.L., Chan J.Y.-H., Lim P.L., Pang J.C.S., Chui Y.L. Biochem. Biophys. Res. Commun. 288:535-545(2001) [PubMed: 11676476] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 3 AND 4), TISSUE SPECIFICITY, INDUCTION. Tissue: Monocyte. |
| [3] | "Regulation of BRCC, a holoenzyme complex containing BRCA1 and BRCA2, by a signalosome-like subunit and its role in DNA repair." Dong Y., Hakimi M.-A., Chen X., Kumaraswamy E., Cooch N.S., Godwin A.K., Shiekhattar R. Mol. Cell 12:1087-1099(2003) [PubMed: 14636569] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, IDENTIFICATION IN BRCC COMPLEX. |
| [4] | Keeton K.R., Miles W.M. Submitted (JUL-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Colon and Teratocarcinoma. |
| [6] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Cervix. |
| [9] | "A death receptor-associated anti-apoptotic protein, BRE, inhibits mitochondrial apoptotic pathway." Li Q., Ching A.K.-K., Chan B.C.-L., Chow S.K.-Y., Lim P.-L., Ho T.C.-Y., Ip W.-K., Wong C.-K., Lam C.W.-K., Lee K.K.-H., Chan J.Y.-H., Chui Y.-L. J. Biol. Chem. 279:52106-52116(2004) [PubMed: 15465831] [Abstract] Cited for: FUNCTION, INTERACTION WITH FAS AND TNFRSF1A, SUBCELLULAR LOCATION. |
| [10] | "RAP80 targets BRCA1 to specific ubiquitin structures at DNA damage sites." Sobhian B., Shao G., Lilli D.R., Culhane A.C., Moreau L.A., Xia B., Livingston D.M., Greenberg R.A. Science 316:1198-1202(2007) [PubMed: 17525341] [Abstract] Cited for: IDENTIFICATION IN THE BRCA1-A COMPLEX. |
| [11] | "K63-specific deubiquitination by two JAMM/MPN+ complexes: BRISC-associated Brcc36 and proteasomal Poh1." Cooper E.M., Cutcliffe C., Kristiansen T.Z., Pandey A., Pickart C.M., Cohen R.E. EMBO J. 28:621-631(2009) [PubMed: 19214193] [Abstract] Cited for: IDENTIFICATION IN THE BRISC COMPLEX. |
| [12] | "MERIT40 controls BRCA1-Rap80 complex integrity and recruitment to DNA double-strand breaks." Shao G., Patterson-Fortin J., Messick T.E., Feng D., Shanbhag N., Wang Y., Greenberg R.A. Genes Dev. 23:740-754(2009) [PubMed: 19261746] [Abstract] Cited for: IDENTIFICATION IN THE BRCA1-A COMPLEX. |
| [13] | "NBA1, a new player in the Brca1 A complex, is required for DNA damage resistance and checkpoint control." Wang B., Hurov K., Hofmann K., Elledge S.J. Genes Dev. 23:729-739(2009) [PubMed: 19261749] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE BRCA1-A COMPLEX, DOMAIN UEV-LIKE, UBIQUITIN-BINDING, INTERACTION WITH FAM175A. |
| [14] | "MERIT40 facilitates BRCA1 localization and DNA damage repair." Feng L., Huang J., Chen J. Genes Dev. 23:719-728(2009) [PubMed: 19261748] [Abstract] Cited for: FUNCTION, IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BRCA1-A COMPLEX, SUBCELLULAR LOCATION, INTERACTION WITH FAM175A; MERIT40 AND BRCC3. |
| [15] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed: 19608861] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-270, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Entry information
| Entry name | BRE_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NXR7 Secondary accession number(s): A8K4X1 Q96P06 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


