Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gypsy retrotransposon integrase-like protein 1

Gene

GIN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Gypsy retrotransposon integrase-like protein 1
Short name:
GIN-1
Alternative name(s):
Ty3/Gypsy integrase 1
Zinc finger H2C2 domain-containing protein
Gene namesi
Name:GIN1
Synonyms:TGIN1, ZH2C2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:25959. GIN1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162389674.

Polymorphism and mutation databases

BioMutaiGIN1.
DMDMi296439336.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 522522Gypsy retrotransposon integrase-like protein 1PRO_0000333016Add
BLAST

Proteomic databases

MaxQBiQ9NXP7.
PaxDbiQ9NXP7.
PRIDEiQ9NXP7.

PTM databases

iPTMnetiQ9NXP7.
PhosphoSiteiQ9NXP7.

Expressioni

Tissue specificityi

Widely expressed. Also found in tumors originating from parathyroid gland, colon, stomach, bladder, uterus and prostate.1 Publication

Gene expression databases

BgeeiQ9NXP7.
CleanExiHS_GIN1.
GenevisibleiQ9NXP7. HS.

Organism-specific databases

HPAiHPA037402.

Interactioni

Protein-protein interaction databases

BioGridi120180. 2 interactions.
IntActiQ9NXP7. 2 interactions.
MINTiMINT-1455288.
STRINGi9606.ENSP00000381970.

Structurei

3D structure databases

ProteinModelPortaliQ9NXP7.
SMRiQ9NXP7. Positions 57-316.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini135 – 292158Integrase catalyticPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 integrase catalytic domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0017. Eukaryota.
COG2801. LUCA.
GeneTreeiENSGT00800000124067.
HOGENOMiHOG000074147.
HOVERGENiHBG107947.
InParanoidiQ9NXP7.
OMAiECHENGP.
OrthoDBiEOG73NG68.
PhylomeDBiQ9NXP7.
TreeFamiTF352301.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
InterProiIPR001584. Integrase_cat-core.
IPR012337. RNaseH-like_dom.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
PROSITEiPS50994. INTEGRASE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NXP7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRSGKNGDL HLKQIAYYKR TGEYHSTTLP SERSGIRRAA KKFVFKEKKL
60 70 80 90 100
FYVGKDRKQN RLVIVSEEEK KKVLRECHEN DSGAHHGISR TLTLVESNYY
110 120 130 140 150
WTSVTNDVKQ WVYACQHCQV AKNTVIVAPK QHLLKVENPW SLVTVDLMGP
160 170 180 190 200
FHTSNRSHVY AIIMTDLFTK WIVILPLCDV SASEVSKAII NIFFLYGPPQ
210 220 230 240 250
KIIMDQRDEF IQQINIELYR LFGIKQIVIS HTSGTVNPTE STPNTIKAFL
260 270 280 290 300
SKHCADHPNN WDDHLSAVSF AFNVTHLEPT KNTPYFQMFS RNPYMPETSD
310 320 330 340 350
SLHEVDGDNT SMFAKILDAI KEADKIMENK TTSLGQMENN NLDELNKSKI
360 370 380 390 400
IVKKKPKQLN PFHLKVGHEV LRQRKNWWKD GRFQSEWVGP CVIDYITESG
410 420 430 440 450
CAVLRDNTGV RLKRPIKMSH LKPYIRESSE QESLYLLQGS VVADHDYIGL
460 470 480 490 500
PEIPIGAYQA NILVEDATIG IVDNELLTSS KDRELLEYRN TKISPLIDDH
510 520
SSLEKQTFSL LDSSNQVLEY LS
Length:522
Mass (Da):59,842
Last modified:May 18, 2010 - v3
Checksum:i5375EC9B009D8B9F
GO
Isoform 2 (identifier: Q9NXP7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-80: EKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHEN → GICLSALPSGKKYSYCSTETAPSQGGKSMEFSYC
     81-522: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:80
Mass (Da):8,891
Checksum:i12EF0D2C163C56EF
GO
Isoform 3 (identifier: Q9NXP7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-222: INIELYRLF → KVFISCKVQ
     223-522: Missing.

Show »
Length:222
Mass (Da):25,703
Checksum:i9241917EAEB27B52
GO

Sequence cautioni

The sequence BAA90963.1 differs from that shown. Reason: Frameshift at position 375. Curated
The sequence CAH10511.1 differs from that shown.Wrong choice of CDS.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti108 – 1081V → A in BAA90963 (PubMed:14702039).Curated
Sequence conflicti313 – 3131F → L in CAH10511 (PubMed:17974005).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti22 – 221G → C.1 Publication
Corresponds to variant rs17851289 [ dbSNP | Ensembl ].
VAR_043041
Natural varianti239 – 2391T → M.2 Publications
Corresponds to variant rs34813 [ dbSNP | Ensembl ].
VAR_043042

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei47 – 8034EKKLF…ECHEN → GICLSALPSGKKYSYCSTET APSQGGKSMEFSYC in isoform 2. 1 PublicationVSP_038518Add
BLAST
Alternative sequencei81 – 522442Missing in isoform 2. 1 PublicationVSP_038519Add
BLAST
Alternative sequencei214 – 2229INIELYRLF → KVFISCKVQ in isoform 3. 1 PublicationVSP_033438
Alternative sequencei223 – 522300Missing in isoform 3. 1 PublicationVSP_033439Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000132 mRNA. Translation: BAA90963.1. Frameshift.
AK295796 mRNA. Translation: BAG58616.1.
CR627424 mRNA. Translation: CAH10511.1. Sequence problems.
AC008447 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW49080.1.
BC015325 mRNA. Translation: AAH15325.1.
BC151135 mRNA. Translation: AAI51136.1.
BC157835 mRNA. Translation: AAI57836.1.
CCDSiCCDS43349.1. [Q9NXP7-1]
RefSeqiNP_001304883.1. NM_001317954.1.
NP_060146.2. NM_017676.2. [Q9NXP7-1]
UniGeneiHs.24088.

Genome annotation databases

EnsembliENST00000399004; ENSP00000381970; ENSG00000145723. [Q9NXP7-1]
ENST00000508629; ENSP00000427162; ENSG00000145723. [Q9NXP7-3]
ENST00000512248; ENSP00000422960; ENSG00000145723. [Q9NXP7-2]
ENST00000513747; ENSP00000423031; ENSG00000145723. [Q9NXP7-2]
GeneIDi54826.
KEGGihsa:54826.
UCSCiuc003koa.2. human. [Q9NXP7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000132 mRNA. Translation: BAA90963.1. Frameshift.
AK295796 mRNA. Translation: BAG58616.1.
CR627424 mRNA. Translation: CAH10511.1. Sequence problems.
AC008447 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW49080.1.
BC015325 mRNA. Translation: AAH15325.1.
BC151135 mRNA. Translation: AAI51136.1.
BC157835 mRNA. Translation: AAI57836.1.
CCDSiCCDS43349.1. [Q9NXP7-1]
RefSeqiNP_001304883.1. NM_001317954.1.
NP_060146.2. NM_017676.2. [Q9NXP7-1]
UniGeneiHs.24088.

3D structure databases

ProteinModelPortaliQ9NXP7.
SMRiQ9NXP7. Positions 57-316.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120180. 2 interactions.
IntActiQ9NXP7. 2 interactions.
MINTiMINT-1455288.
STRINGi9606.ENSP00000381970.

PTM databases

iPTMnetiQ9NXP7.
PhosphoSiteiQ9NXP7.

Polymorphism and mutation databases

BioMutaiGIN1.
DMDMi296439336.

Proteomic databases

MaxQBiQ9NXP7.
PaxDbiQ9NXP7.
PRIDEiQ9NXP7.

Protocols and materials databases

DNASUi54826.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399004; ENSP00000381970; ENSG00000145723. [Q9NXP7-1]
ENST00000508629; ENSP00000427162; ENSG00000145723. [Q9NXP7-3]
ENST00000512248; ENSP00000422960; ENSG00000145723. [Q9NXP7-2]
ENST00000513747; ENSP00000423031; ENSG00000145723. [Q9NXP7-2]
GeneIDi54826.
KEGGihsa:54826.
UCSCiuc003koa.2. human. [Q9NXP7-1]

Organism-specific databases

CTDi54826.
GeneCardsiGIN1.
HGNCiHGNC:25959. GIN1.
HPAiHPA037402.
neXtProtiNX_Q9NXP7.
PharmGKBiPA162389674.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0017. Eukaryota.
COG2801. LUCA.
GeneTreeiENSGT00800000124067.
HOGENOMiHOG000074147.
HOVERGENiHBG107947.
InParanoidiQ9NXP7.
OMAiECHENGP.
OrthoDBiEOG73NG68.
PhylomeDBiQ9NXP7.
TreeFamiTF352301.

Miscellaneous databases

GenomeRNAii54826.
NextBioi57588.
PROiQ9NXP7.

Gene expression databases

BgeeiQ9NXP7.
CleanExiHS_GIN1.
GenevisibleiQ9NXP7. HS.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
InterProiIPR001584. Integrase_cat-core.
IPR012337. RNaseH-like_dom.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
PROSITEiPS50994. INTEGRASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-239.
    Tissue: Colon and Hippocampus.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Seminoma.
  3. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS CYS-22 AND MET-239.
    Tissue: Brain and Kidney.
  6. "A mammalian gene evolved from the integrase domain of an LTR retrotransposon."
    Llorens C., Marin I.
    Mol. Biol. Evol. 18:1597-1600(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiGIN1_HUMAN
AccessioniPrimary (citable) accession number: Q9NXP7
Secondary accession number(s): B2RXF7
, B4DIV4, Q6AI03, Q96BR2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 18, 2010
Last modified: March 16, 2016
This is version 100 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.