Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Gypsy retrotransposon integrase-like protein 1

Gene

GIN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000145723-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Gypsy retrotransposon integrase-like protein 1
Short name:
GIN-1
Alternative name(s):
Ty3/Gypsy integrase 1
Zinc finger H2C2 domain-containing protein
Gene namesi
Name:GIN1
Synonyms:TGIN1, ZH2C2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:25959. GIN1.

Pathology & Biotechi

Organism-specific databases

DisGeNETi54826.
OpenTargetsiENSG00000145723.
PharmGKBiPA162389674.

Polymorphism and mutation databases

BioMutaiGIN1.
DMDMi296439336.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003330161 – 522Gypsy retrotransposon integrase-like protein 1Add BLAST522

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei502PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9NXP7.
MaxQBiQ9NXP7.
PaxDbiQ9NXP7.
PeptideAtlasiQ9NXP7.
PRIDEiQ9NXP7.

PTM databases

iPTMnetiQ9NXP7.
PhosphoSitePlusiQ9NXP7.

Expressioni

Tissue specificityi

Widely expressed. Also found in tumors originating from parathyroid gland, colon, stomach, bladder, uterus and prostate.1 Publication

Gene expression databases

BgeeiENSG00000145723.
CleanExiHS_GIN1.
GenevisibleiQ9NXP7. HS.

Organism-specific databases

HPAiHPA037402.
HPA061362.

Interactioni

Protein-protein interaction databases

BioGridi120180. 2 interactors.
IntActiQ9NXP7. 2 interactors.
MINTiMINT-1455288.
STRINGi9606.ENSP00000381970.

Structurei

3D structure databases

ProteinModelPortaliQ9NXP7.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini135 – 292Integrase catalyticPROSITE-ProRule annotationAdd BLAST158

Sequence similaritiesi

Contains 1 integrase catalytic domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0017. Eukaryota.
COG2801. LUCA.
GeneTreeiENSGT00800000124067.
HOGENOMiHOG000074147.
HOVERGENiHBG107947.
InParanoidiQ9NXP7.
OMAiECHENGP.
OrthoDBiEOG091G00AJ.
PhylomeDBiQ9NXP7.
TreeFamiTF352301.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
InterProiIPR001584. Integrase_cat-core.
IPR012337. RNaseH-like_dom.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
PROSITEiPS50994. INTEGRASE. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NXP7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRSGKNGDL HLKQIAYYKR TGEYHSTTLP SERSGIRRAA KKFVFKEKKL
60 70 80 90 100
FYVGKDRKQN RLVIVSEEEK KKVLRECHEN DSGAHHGISR TLTLVESNYY
110 120 130 140 150
WTSVTNDVKQ WVYACQHCQV AKNTVIVAPK QHLLKVENPW SLVTVDLMGP
160 170 180 190 200
FHTSNRSHVY AIIMTDLFTK WIVILPLCDV SASEVSKAII NIFFLYGPPQ
210 220 230 240 250
KIIMDQRDEF IQQINIELYR LFGIKQIVIS HTSGTVNPTE STPNTIKAFL
260 270 280 290 300
SKHCADHPNN WDDHLSAVSF AFNVTHLEPT KNTPYFQMFS RNPYMPETSD
310 320 330 340 350
SLHEVDGDNT SMFAKILDAI KEADKIMENK TTSLGQMENN NLDELNKSKI
360 370 380 390 400
IVKKKPKQLN PFHLKVGHEV LRQRKNWWKD GRFQSEWVGP CVIDYITESG
410 420 430 440 450
CAVLRDNTGV RLKRPIKMSH LKPYIRESSE QESLYLLQGS VVADHDYIGL
460 470 480 490 500
PEIPIGAYQA NILVEDATIG IVDNELLTSS KDRELLEYRN TKISPLIDDH
510 520
SSLEKQTFSL LDSSNQVLEY LS
Length:522
Mass (Da):59,842
Last modified:May 18, 2010 - v3
Checksum:i5375EC9B009D8B9F
GO
Isoform 2 (identifier: Q9NXP7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     47-80: EKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHEN → GICLSALPSGKKYSYCSTETAPSQGGKSMEFSYC
     81-522: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:80
Mass (Da):8,891
Checksum:i12EF0D2C163C56EF
GO
Isoform 3 (identifier: Q9NXP7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     214-222: INIELYRLF → KVFISCKVQ
     223-522: Missing.

Show »
Length:222
Mass (Da):25,703
Checksum:i9241917EAEB27B52
GO

Sequence cautioni

The sequence BAA90963 differs from that shown. Reason: Frameshift at position 375.Curated
The sequence CAH10511 differs from that shown. Wrong choice of CDS.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti108V → A in BAA90963 (PubMed:14702039).Curated1
Sequence conflicti313F → L in CAH10511 (PubMed:17974005).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04304122G → C.1 PublicationCorresponds to variant rs17851289dbSNPEnsembl.1
Natural variantiVAR_043042239T → M.2 PublicationsCorresponds to variant rs34813dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03851847 – 80EKKLF…ECHEN → GICLSALPSGKKYSYCSTET APSQGGKSMEFSYC in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_03851981 – 522Missing in isoform 2. 1 PublicationAdd BLAST442
Alternative sequenceiVSP_033438214 – 222INIELYRLF → KVFISCKVQ in isoform 3. 1 Publication9
Alternative sequenceiVSP_033439223 – 522Missing in isoform 3. 1 PublicationAdd BLAST300

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000132 mRNA. Translation: BAA90963.1. Frameshift.
AK295796 mRNA. Translation: BAG58616.1.
CR627424 mRNA. Translation: CAH10511.1. Sequence problems.
AC008447 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW49080.1.
BC015325 mRNA. Translation: AAH15325.1.
BC151135 mRNA. Translation: AAI51136.1.
BC157835 mRNA. Translation: AAI57836.1.
CCDSiCCDS43349.1. [Q9NXP7-1]
RefSeqiNP_001304883.1. NM_001317954.1.
NP_060146.2. NM_017676.2. [Q9NXP7-1]
XP_016865088.1. XM_017009599.1. [Q9NXP7-1]
UniGeneiHs.24088.

Genome annotation databases

EnsembliENST00000399004; ENSP00000381970; ENSG00000145723. [Q9NXP7-1]
ENST00000508629; ENSP00000427162; ENSG00000145723. [Q9NXP7-3]
ENST00000512248; ENSP00000422960; ENSG00000145723. [Q9NXP7-2]
ENST00000513747; ENSP00000423031; ENSG00000145723. [Q9NXP7-2]
GeneIDi54826.
KEGGihsa:54826.
UCSCiuc003koa.2. human. [Q9NXP7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000132 mRNA. Translation: BAA90963.1. Frameshift.
AK295796 mRNA. Translation: BAG58616.1.
CR627424 mRNA. Translation: CAH10511.1. Sequence problems.
AC008447 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW49080.1.
BC015325 mRNA. Translation: AAH15325.1.
BC151135 mRNA. Translation: AAI51136.1.
BC157835 mRNA. Translation: AAI57836.1.
CCDSiCCDS43349.1. [Q9NXP7-1]
RefSeqiNP_001304883.1. NM_001317954.1.
NP_060146.2. NM_017676.2. [Q9NXP7-1]
XP_016865088.1. XM_017009599.1. [Q9NXP7-1]
UniGeneiHs.24088.

3D structure databases

ProteinModelPortaliQ9NXP7.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120180. 2 interactors.
IntActiQ9NXP7. 2 interactors.
MINTiMINT-1455288.
STRINGi9606.ENSP00000381970.

PTM databases

iPTMnetiQ9NXP7.
PhosphoSitePlusiQ9NXP7.

Polymorphism and mutation databases

BioMutaiGIN1.
DMDMi296439336.

Proteomic databases

EPDiQ9NXP7.
MaxQBiQ9NXP7.
PaxDbiQ9NXP7.
PeptideAtlasiQ9NXP7.
PRIDEiQ9NXP7.

Protocols and materials databases

DNASUi54826.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399004; ENSP00000381970; ENSG00000145723. [Q9NXP7-1]
ENST00000508629; ENSP00000427162; ENSG00000145723. [Q9NXP7-3]
ENST00000512248; ENSP00000422960; ENSG00000145723. [Q9NXP7-2]
ENST00000513747; ENSP00000423031; ENSG00000145723. [Q9NXP7-2]
GeneIDi54826.
KEGGihsa:54826.
UCSCiuc003koa.2. human. [Q9NXP7-1]

Organism-specific databases

CTDi54826.
DisGeNETi54826.
GeneCardsiGIN1.
HGNCiHGNC:25959. GIN1.
HPAiHPA037402.
HPA061362.
neXtProtiNX_Q9NXP7.
OpenTargetsiENSG00000145723.
PharmGKBiPA162389674.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0017. Eukaryota.
COG2801. LUCA.
GeneTreeiENSGT00800000124067.
HOGENOMiHOG000074147.
HOVERGENiHBG107947.
InParanoidiQ9NXP7.
OMAiECHENGP.
OrthoDBiEOG091G00AJ.
PhylomeDBiQ9NXP7.
TreeFamiTF352301.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000145723-MONOMER.

Miscellaneous databases

GenomeRNAii54826.
PROiQ9NXP7.

Gene expression databases

BgeeiENSG00000145723.
CleanExiHS_GIN1.
GenevisibleiQ9NXP7. HS.

Family and domain databases

Gene3Di3.30.420.10. 1 hit.
InterProiIPR001584. Integrase_cat-core.
IPR012337. RNaseH-like_dom.
[Graphical view]
SUPFAMiSSF53098. SSF53098. 1 hit.
PROSITEiPS50994. INTEGRASE. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGIN1_HUMAN
AccessioniPrimary (citable) accession number: Q9NXP7
Secondary accession number(s): B2RXF7
, B4DIV4, Q6AI03, Q96BR2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 18, 2010
Last modified: November 2, 2016
This is version 105 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.