Q9NXG6 (P4HTM_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 115.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Transmembrane prolyl 4-hydroxylase Short name=P4H-TM EC=1.14.11.- Alternative name(s): Hypoxia-inducible factor prolyl hydroxylase 4 Short name=HIF-PH4 Short name=HIF-prolyl hydroxylase 4 Short name=HPH-4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 502 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF1A at 'Pro-402' and 'Pro-564'. May function as a cellular oxygen sensor and, under normoxic conditions, may target HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex. Ref.5 |
| Catalytic activity | An HIF alpha chain L-proline + 2-oxoglutarate + O2 = An HIF alpha chain trans-4-hydroxy-L-proline + succinate + CO2. |
| Cofactor | Binds 1 Fe2+ ion per subunit By similarity. Ascorbate By similarity. |
| Subunit structure | Homodimer. Ref.5 |
| Subcellular location | Endoplasmic reticulum membrane; Single-pass type II membrane protein Ref.1 Ref.5. |
| Tissue specificity | Widely expressed with highest levels in adult pancreas, heart, skeletal muscle, brain, placenta, kidney and adrenal gland. Expressed at lower levels in epiphyseal cartilage and in fibroblasts. Ref.1 Ref.5 |
| Induction | By hypoxia in many cultured cell lines. Ref.5 |
| Post-translational modification | Glycosylated. Ref.5 |
| Sequence similarities | Contains 2 EF-hand domains. Contains 1 Fe2OG dioxygenase domain. |
| Sequence caution | The sequence AAH60321.1 differs from that shown. Reason: Intron retention. The sequence BAA91045.1 differs from that shown. Reason: Erroneous initiation. The sequence CAD28518.2 differs from that shown. Reason: Intron retention. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NXG6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NXG6-2) Also known as: b; The sequence of this isoform differs from the canonical sequence as follows: 359-502: YMTVLFYLNN...RAYRDARVEL → QVSPNWGLPS...WLERGGYWSS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9NXG6-3) The sequence of this isoform differs from the canonical sequence as follows: 358-358: R → RQVSPNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 502 | 502 | Transmembrane prolyl 4-hydroxylase | PRO_0000206668 | |||||
Regions | |||||||||
| Topological domain | 1 – 60 | 60 | Cytoplasmic Potential | ||||||
| Transmembrane | 61 – 81 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 82 – 502 | 421 | Lumenal Potential | ||||||
| Domain | 185 – 220 | 36 | EF-hand 1 | ||||||
| Domain | 224 – 259 | 36 | EF-hand 2 | ||||||
| Domain | 310 – 460 | 151 | Fe2OG dioxygenase | ||||||
| Calcium binding | 198 – 210 | 13 | 1 Potential | ||||||
| Calcium binding | 237 – 249 | 13 | 2 Potential | ||||||
Sites | |||||||||
| Metal binding | 328 | 1 | Iron By similarity | ||||||
| Metal binding | 330 | 1 | Iron By similarity | ||||||
| Metal binding | 374 | 1 | Iron By similarity | ||||||
| Binding site | 451 | 1 | 2-oxoglutarate Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 348 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 368 | 1 | N-linked (GlcNAc...) Potential | ||||||
| Glycosylation | 382 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 358 | 1 | R → RQVSPNWGLPSILRPGTPMT QAQPCTVGVPLGMGPGDHWV IPVSPWEHPQLGTCSVPPLP YS in isoform 3. | VSP_007573 | |||||
| Alternative sequence | 359 – 502 | 144 | YMTVL…ARVEL → QVSPNWGLPSILRPGTPMTQ AQPCTVGVPLGMGPGDHWVI PVSDALTSPHKLFTQWLERG GYWSS in isoform 2. | VSP_007574 | |||||
Experimental info | |||||||||
| Sequence conflict | 213 | 1 | Q → K in AAH47566. Ref.3 | ||||||
| Sequence conflict | 240 | 1 | G → A in AAO43431. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Overexpression of PH-4, a novel putative proline 4-hydroxylase, modulates activity of hypoxia-inducible transcription factors." Oehme F., Ellinghaus P., Kolkhof P., Smith T.J., Ramakrishnan S., Huetter J., Schramm M., Flamme I. Biochem. Biophys. Res. Commun. 296:343-349(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 166-502 (ISOFORM 1). Tissue: Duodenum, Hippocampus and Lung. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 84-502 (ISOFORM 2). Tissue: Colon mucosa. |
| [5] | "An endoplasmic reticulum transmembrane prolyl 4-hydroxylase is induced by hypoxia and acts on hypoxia-inducible factor alpha." Koivunen P., Tiainen P., Hyvaerinen J., Williams K.E., Sormunen R., Klaus S.J., Kivirikko K.I., Myllyharju J. J. Biol. Chem. 282:30544-30552(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION, TOPOLOGY, GLYCOSYLATION. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY198406 mRNA. Translation: AAO43431.1. AL713728 mRNA. Translation: CAD28518.2. Sequence problems. BC000580 mRNA. Translation: AAH00580.1. BC011710 mRNA. Translation: AAH11710.3. BC047566 mRNA. Translation: AAH47566.1. BC060321 mRNA. Translation: AAH60321.1. Sequence problems. AK000269 mRNA. Translation: BAA91045.1. Different initiation. |
| IPI | IPI00219456. IPI00328950. IPI00479623. |
| RefSeq | NP_808807.2. NM_177938.2. NP_808808.1. NM_177939.2. |
| UniGene | Hs.654944. |
3D structure databases | |
| ProteinModelPortal | Q9NXG6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NXG6. 1 interaction. |
| STRING | 9606.ENSP00000341422. |
PTM databases | |
| PhosphoSite | Q9NXG6. |
Polymorphism databases | |
| DMDM | 32129516. |
Proteomic databases | |
| PaxDb | Q9NXG6. |
| PRIDE | Q9NXG6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000343546; ENSP00000341422; ENSG00000178467. ENST00000383729; ENSP00000373235; ENSG00000178467. |
| GeneID | 54681. |
| KEGG | hsa:54681. |
| UCSC | uc003cvg.3. human. uc003cvh.3. human. |
Organism-specific databases | |
| CTD | 54681. |
| GeneCards | GC03P049027. |
| HGNC | HGNC:28858. P4HTM. |
| HPA | HPA007199. |
| MIM | 614584. gene. |
| neXtProt | NX_Q9NXG6. |
| PharmGKB | PA164724295. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG284419. |
| HOGENOM | HOG000115323. |
| KO | K06711. |
| OMA | QQGTAVF. |
Gene expression databases | |
| Bgee | Q9NXG6. |
| Genevestigator | Q9NXG6. |
| GermOnline | ENSG00000178467. Homo sapiens. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 1 hit. |
| InterPro | IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR002048. EF_hand_dom. IPR005123. Oxoglu/Fe-dep_dioxygenase. IPR006620. Pro_4_hyd_alph. [Graphical view] |
| Pfam | PF13640. 2OG-FeII_Oxy_3. 1 hit. PF13202. EF_hand_3. 1 hit. [Graphical view] |
| SMART | SM00702. P4Hc. 1 hit. [Graphical view] |
| PROSITE | PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. False negative. PS51471. FE2OG_OXY. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| BindingDB | Q9NXG6. |
| ChEMBL | CHEMBL3047. |
| ChiTaRS | P4HTM. human. |
| DrugBank | DB00126. Vitamin C. |
| GenomeRNAi | 54681. |
| NextBio | 57244. |
| SOURCE | Search... |
Entry information
| Entry name | P4HTM_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NXG6 Secondary accession number(s): Q6PAG6 Q9BW77 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
