Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NXG6

- P4HTM_HUMAN

UniProt

Q9NXG6 - P4HTM_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Transmembrane prolyl 4-hydroxylase

Gene

P4HTM

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. Hydroxylates HIF1A at 'Pro-402' and 'Pro-564'. May function as a cellular oxygen sensor and, under normoxic conditions, may target HIF through the hydroxylation for proteasomal degradation via the von Hippel-Lindau ubiquitination complex.1 Publication

Catalytic activityi

An HIF alpha chain L-proline + 2-oxoglutarate + O2 = An HIF alpha chain trans-4-hydroxy-L-proline + succinate + CO2.

Cofactori

Binds 1 Fe2+ ion per subunit.PROSITE-ProRule annotation
Ascorbate.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi328 – 3281IronPROSITE-ProRule annotation
Metal bindingi330 – 3301IronPROSITE-ProRule annotation
Metal bindingi374 – 3741IronPROSITE-ProRule annotation
Binding sitei451 – 45112-oxoglutaratePROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi198 – 210131Sequence AnalysisAdd
BLAST
Calcium bindingi237 – 249132Sequence AnalysisAdd
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: InterPro
  2. iron ion binding Source: InterPro
  3. L-ascorbic acid binding Source: UniProtKB-KW
  4. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Dioxygenase, Oxidoreductase

Keywords - Ligandi

Calcium, Iron, Metal-binding, Vitamin C

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane prolyl 4-hydroxylase (EC:1.14.11.-)
Short name:
P4H-TM
Alternative name(s):
Hypoxia-inducible factor prolyl hydroxylase 4
Short name:
HIF-PH4
Short name:
HIF-prolyl hydroxylase 4
Short name:
HPH-4
Gene namesi
Name:P4HTM
Synonyms:PH4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:28858. P4HTM.

Subcellular locationi

Endoplasmic reticulum membrane 2 Publications; Single-pass type II membrane protein 2 Publications

GO - Cellular componenti

  1. endoplasmic reticulum Source: UniProtKB-KW
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164724295.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 502502Transmembrane prolyl 4-hydroxylasePRO_0000206668Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi348 – 3481N-linked (GlcNAc...)Sequence Analysis
Glycosylationi368 – 3681N-linked (GlcNAc...)Sequence Analysis
Glycosylationi382 – 3821N-linked (GlcNAc...)Sequence Analysis

Post-translational modificationi

Glycosylated.1 Publication

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ9NXG6.
PaxDbiQ9NXG6.
PRIDEiQ9NXG6.

PTM databases

PhosphoSiteiQ9NXG6.

Expressioni

Tissue specificityi

Widely expressed with highest levels in adult pancreas, heart, skeletal muscle, brain, placenta, kidney and adrenal gland. Expressed at lower levels in epiphyseal cartilage and in fibroblasts.2 Publications

Inductioni

By hypoxia in many cultured cell lines.1 Publication

Gene expression databases

BgeeiQ9NXG6.
ExpressionAtlasiQ9NXG6. baseline and differential.
GenevestigatoriQ9NXG6.

Organism-specific databases

HPAiHPA007199.

Interactioni

Subunit structurei

Homodimer.1 Publication

Protein-protein interaction databases

BioGridi120100. 5 interactions.
IntActiQ9NXG6. 1 interaction.
STRINGi9606.ENSP00000341422.

Structurei

3D structure databases

ProteinModelPortaliQ9NXG6.
SMRiQ9NXG6. Positions 191-252, 263-462.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 6060CytoplasmicSequence AnalysisAdd
BLAST
Topological domaini82 – 502421LumenalSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei61 – 8121Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini185 – 22036EF-hand 1Add
BLAST
Domaini224 – 25936EF-hand 2Add
BLAST
Domaini310 – 460151Fe2OG dioxygenasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 2 EF-hand domains.Curated
Contains 1 Fe2OG dioxygenase domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG284419.
GeneTreeiENSGT00390000014570.
HOGENOMiHOG000115323.
InParanoidiQ9NXG6.
KOiK06711.
OMAiNMDLRDF.
OrthoDBiEOG7VDXP9.
PhylomeDBiQ9NXG6.
TreeFamiTF332923.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR005123. Oxoglu/Fe-dep_dioxygenase.
IPR006620. Pro_4_hyd_alph.
[Graphical view]
PfamiPF13640. 2OG-FeII_Oxy_3. 1 hit.
PF13202. EF-hand_5. 1 hit.
[Graphical view]
SMARTiSM00702. P4Hc. 1 hit.
[Graphical view]
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS51471. FE2OG_OXY. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NXG6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAAVTGQR PETAAAEEAS RPQWAPPDHC QAQAAAGLGD GEDAPVRPLC
60 70 80 90 100
KPRGICSRAY FLVLMVFVHL YLGNVLALLL FVHYSNGDES SDPGPQHRAQ
110 120 130 140 150
GPGPEPTLGP LTRLEGIKVG HERKVQLVTD RDHFIRTLSL KPLLFEIPGF
160 170 180 190 200
LTDEECRLII HLAQMKGLQR SQILPTEEYE EAMSTMQVSQ LDLFRLLDQN
210 220 230 240 250
RDGHLQLREV LAQTRLGNGW WMTPESIQEM YAAIKADPDG DGVLSLQEFS
260 270 280 290 300
NMDLRDFHKY MRSHKAESSE LVRNSHHTWL YQGEGAHHIM RAIRQRVLRL
310 320 330 340 350
TRLSPEIVEL SEPLQVVRYG EGGHYHAHVD SGPVYPETIC SHTKLVANES
360 370 380 390 400
VPFETSCRYM TVLFYLNNVT GGGETVFPVA DNRTYDEMSL IQDDVDLRDT
410 420 430 440 450
RRHCDKGNLR VKPQQGTAVF WYNYLPDGQG WVGDVDDYSL HGGCLVTRGT
460 470 480 490 500
KWIANNWINV DPSRARQALF QQEMARLARE GGTDSQPEWA LDRAYRDARV

EL
Length:502
Mass (Da):56,661
Last modified:June 16, 2003 - v2
Checksum:iA2DAE4ACF4A2E18C
GO
Isoform 2 (identifier: Q9NXG6-2) [UniParc]FASTAAdd to Basket

Also known as: b

The sequence of this isoform differs from the canonical sequence as follows:
     359-502: YMTVLFYLNN...RAYRDARVEL → QVSPNWGLPS...WLERGGYWSS

Note: No experimental confirmation available.

Show »
Length:423
Mass (Da):47,211
Checksum:i5540388F142E76E4
GO
Isoform 3 (identifier: Q9NXG6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     358-358: R → RQVSPNWGLPSILRPGTPMTQAQPCTVGVPLGMGPGDHWVIPVSPWEHPQLGTCSVPPLPYS

Note: No experimental confirmation available.

Show »
Length:563
Mass (Da):63,112
Checksum:i9154ADD79EA6BE78
GO

Sequence cautioni

The sequence AAH60321.1 differs from that shown. Reason: Intron retention.
The sequence CAD28518.2 differs from that shown. Reason: Intron retention.
The sequence BAA91045.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti213 – 2131Q → K in AAH47566. (PubMed:15489334)Curated
Sequence conflicti240 – 2401G → A in AAO43431. (PubMed:12163023)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei358 – 3581R → RQVSPNWGLPSILRPGTPMT QAQPCTVGVPLGMGPGDHWV IPVSPWEHPQLGTCSVPPLP YS in isoform 3. 1 PublicationVSP_007573
Alternative sequencei359 – 502144YMTVL…ARVEL → QVSPNWGLPSILRPGTPMTQ AQPCTVGVPLGMGPGDHWVI PVSDALTSPHKLFTQWLERG GYWSS in isoform 2. 2 PublicationsVSP_007574Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY198406 mRNA. Translation: AAO43431.1.
AL713728 mRNA. Translation: CAD28518.2. Sequence problems.
BC000580 mRNA. Translation: AAH00580.1.
BC011710 mRNA. Translation: AAH11710.3.
BC047566 mRNA. Translation: AAH47566.1.
BC060321 mRNA. Translation: AAH60321.1. Sequence problems.
AK000269 mRNA. Translation: BAA91045.1. Different initiation.
CCDSiCCDS2781.2. [Q9NXG6-3]
CCDS43089.1. [Q9NXG6-1]
RefSeqiNP_808807.2. NM_177938.2. [Q9NXG6-3]
NP_808808.1. NM_177939.2. [Q9NXG6-1]
UniGeneiHs.654944.

Genome annotation databases

EnsembliENST00000343546; ENSP00000341422; ENSG00000178467. [Q9NXG6-3]
ENST00000383729; ENSP00000373235; ENSG00000178467. [Q9NXG6-1]
ENST00000475629; ENSP00000477191; ENSG00000178467.
GeneIDi54681.
KEGGihsa:54681.
UCSCiuc003cvg.3. human. [Q9NXG6-1]
uc003cvh.3. human. [Q9NXG6-3]

Polymorphism databases

DMDMi32129516.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY198406 mRNA. Translation: AAO43431.1 .
AL713728 mRNA. Translation: CAD28518.2 . Sequence problems.
BC000580 mRNA. Translation: AAH00580.1 .
BC011710 mRNA. Translation: AAH11710.3 .
BC047566 mRNA. Translation: AAH47566.1 .
BC060321 mRNA. Translation: AAH60321.1 . Sequence problems.
AK000269 mRNA. Translation: BAA91045.1 . Different initiation.
CCDSi CCDS2781.2. [Q9NXG6-3 ]
CCDS43089.1. [Q9NXG6-1 ]
RefSeqi NP_808807.2. NM_177938.2. [Q9NXG6-3 ]
NP_808808.1. NM_177939.2. [Q9NXG6-1 ]
UniGenei Hs.654944.

3D structure databases

ProteinModelPortali Q9NXG6.
SMRi Q9NXG6. Positions 191-252, 263-462.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120100. 5 interactions.
IntActi Q9NXG6. 1 interaction.
STRINGi 9606.ENSP00000341422.

Chemistry

BindingDBi Q9NXG6.
ChEMBLi CHEMBL3047.
DrugBanki DB00126. Vitamin C.

PTM databases

PhosphoSitei Q9NXG6.

Polymorphism databases

DMDMi 32129516.

Proteomic databases

MaxQBi Q9NXG6.
PaxDbi Q9NXG6.
PRIDEi Q9NXG6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000343546 ; ENSP00000341422 ; ENSG00000178467 . [Q9NXG6-3 ]
ENST00000383729 ; ENSP00000373235 ; ENSG00000178467 . [Q9NXG6-1 ]
ENST00000475629 ; ENSP00000477191 ; ENSG00000178467 .
GeneIDi 54681.
KEGGi hsa:54681.
UCSCi uc003cvg.3. human. [Q9NXG6-1 ]
uc003cvh.3. human. [Q9NXG6-3 ]

Organism-specific databases

CTDi 54681.
GeneCardsi GC03P049027.
HGNCi HGNC:28858. P4HTM.
HPAi HPA007199.
MIMi 614584. gene.
neXtProti NX_Q9NXG6.
PharmGKBi PA164724295.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG284419.
GeneTreei ENSGT00390000014570.
HOGENOMi HOG000115323.
InParanoidi Q9NXG6.
KOi K06711.
OMAi NMDLRDF.
OrthoDBi EOG7VDXP9.
PhylomeDBi Q9NXG6.
TreeFami TF332923.

Miscellaneous databases

ChiTaRSi P4HTM. human.
GenomeRNAii 54681.
NextBioi 57244.
PROi Q9NXG6.
SOURCEi Search...

Gene expression databases

Bgeei Q9NXG6.
ExpressionAtlasi Q9NXG6. baseline and differential.
Genevestigatori Q9NXG6.

Family and domain databases

Gene3Di 1.10.238.10. 1 hit.
InterProi IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR005123. Oxoglu/Fe-dep_dioxygenase.
IPR006620. Pro_4_hyd_alph.
[Graphical view ]
Pfami PF13640. 2OG-FeII_Oxy_3. 1 hit.
PF13202. EF-hand_5. 1 hit.
[Graphical view ]
SMARTi SM00702. P4Hc. 1 hit.
[Graphical view ]
PROSITEi PS00018. EF_HAND_1. 2 hits.
PS51471. FE2OG_OXY. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Overexpression of PH-4, a novel putative proline 4-hydroxylase, modulates activity of hypoxia-inducible transcription factors."
    Oehme F., Ellinghaus P., Kolkhof P., Smith T.J., Ramakrishnan S., Huetter J., Schramm M., Flamme I.
    Biochem. Biophys. Res. Commun. 296:343-349(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Uterus.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 166-502 (ISOFORM 1).
    Tissue: Duodenum, Hippocampus and Lung.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 84-502 (ISOFORM 2).
    Tissue: Colon mucosa.
  5. "An endoplasmic reticulum transmembrane prolyl 4-hydroxylase is induced by hypoxia and acts on hypoxia-inducible factor alpha."
    Koivunen P., Tiainen P., Hyvaerinen J., Williams K.E., Sormunen R., Klaus S.J., Kivirikko K.I., Myllyharju J.
    J. Biol. Chem. 282:30544-30552(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBUNIT, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, INDUCTION, TOPOLOGY, GLYCOSYLATION.

Entry informationi

Entry nameiP4HTM_HUMAN
AccessioniPrimary (citable) accession number: Q9NXG6
Secondary accession number(s): Q6PAG6
, Q8TCJ9, Q8WV55, Q96F22, Q9BW77
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 16, 2003
Last sequence update: June 16, 2003
Last modified: October 29, 2014
This is version 129 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3