Q9NXG0 (CNTLN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 83.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Centlein Alternative name(s): Centrosomal protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1405 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Cytoplasm › cytoskeleton › centrosome › centriole. Note: Colocalizes with gamma-tubulin during interphase and mitosis. Appears to associated with the mother centriole during G1 phase and with daughter centrioles towards G1/S phase By similarity. |
| Sequence caution | The sequence BAA91052.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence BAB13850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Cytoskeleton |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | phosphorelay signal transduction system Inferred from electronic annotation. Source: GOC signal transduction by phosphorylationInferred from electronic annotation. Source: GOC |
| Cellular_component | centriole Inferred from electronic annotation. Source: UniProtKB-SubCell centrosomeInferred from direct assay. Source: HPA membraneInferred from electronic annotation. Source: InterPro mitochondrionInferred from direct assay. Source: HPA |
| Molecular_function | phosphorelay sensor kinase activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NXG0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q9NXG0-2) The sequence of this isoform differs from the canonical sequence as follows: 1374-1405: SLTLSPRLKCNGAIMAHQNLRLPDSSSSASAS → LPFASYLLEAVLEKINEKKKLVEGYFTIMKDIR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9NXG0-3) The sequence of this isoform differs from the canonical sequence as follows: 383-391: LYNELHICF → VCFYSVIKM 392-1405: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1405 | 1405 | Centlein | PRO_0000227567 | |||||
Regions | |||||||||
| Coiled coil | 95 – 126 | 32 | Potential | ||||||
| Coiled coil | 613 – 655 | 43 | Potential | ||||||
| Coiled coil | 681 – 793 | 113 | Potential | ||||||
| Coiled coil | 980 – 1311 | 332 | Potential | ||||||
| Compositional bias | 1398 – 1405 | 8 | Poly-Ser | ||||||
Amino acid modifications | |||||||||
| Modified residue | 5 | 1 | Phosphoserine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 383 – 391 | 9 | LYNELHICF → VCFYSVIKM in isoform 3. | VSP_032864 | |||||
| Alternative sequence | 392 – 1405 | 1014 | Missing in isoform 3. | VSP_032865 | |||||
| Alternative sequence | 1374 – 1405 | 32 | SLTLS…SASAS → LPFASYLLEAVLEKINEKKK LVEGYFTIMKDIR in isoform 2. | VSP_017558 | |||||
| Natural variant | 284 | 1 | T → A. Corresponds to variant rs3808795 [ dbSNP | Ensembl ]. | VAR_056840 | |||||
| Natural variant | 291 | 1 | E → D. Corresponds to variant rs3808794 [ dbSNP | Ensembl ]. | VAR_056841 | |||||
| Natural variant | 562 | 1 | R → C. Corresponds to variant rs3808782 [ dbSNP | Ensembl ]. | VAR_025608 | |||||
| Natural variant | 695 | 1 | T → I. Ref.1 Corresponds to variant rs7035276 [ dbSNP | Ensembl ]. | VAR_025609 | |||||
| Natural variant | 1376 | 1 | T → A. Corresponds to variant rs2499057 [ dbSNP | Ensembl ]. | VAR_025610 | |||||
Experimental info | |||||||||
| Sequence conflict | 700 | 1 | R → Q in BAB13850. Ref.1 | ||||||
| Sequence conflict | 871 | 1 | Missing in BAB13850. Ref.1 | ||||||
| Sequence conflict | 1004 | 1 | T → A in BAB13850. Ref.1 | ||||||
| Sequence conflict | 1240 | 1 | A → V in BAB13850. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 278-1405 (ISOFORM 1), VARIANT ILE-695. Tissue: Embryo and Gastric mucosa. |
| [2] | "DNA sequence and analysis of human chromosome 9." Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. Dunham I.Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK000283 mRNA. Translation: BAA91052.1. Different initiation. AK021596 mRNA. Translation: BAB13850.1. Different initiation. AK098502 mRNA. Translation: BAC05319.1. AL133214 AL590377 Genomic DNA. Translation: CAH70743.2.AL162725 AL590377 Genomic DNA. Translation: CAH70424.1.AL162725, AL354711 Genomic DNA. Translation: CAH70425.1. AL354711 AL590377 Genomic DNA. Translation: CAH72682.2.AL354711, AL162725 Genomic DNA. Translation: CAH72684.1. AL354738 AL590377 Genomic DNA. Translation: CAI16195.2.AL590377 AL354738 Genomic DNA. Translation: CAI14630.2. |
| IPI | IPI00657839. IPI00815832. IPI00889646. |
| RefSeq | NP_001107867.1. NM_001114395.1. NP_060208.2. NM_017738.2. |
| UniGene | Hs.435381. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP-47295N. |
| STRING | 9606.ENSP00000370021. |
PTM databases | |
| PhosphoSite | Q9NXG0. |
Polymorphism databases | |
| DMDM | 160419146. |
Proteomic databases | |
| PaxDb | Q9NXG0. |
| PRIDE | Q9NXG0. |
Protocols and materials databases | |
| DNASU | 54875. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000380641; ENSP00000370015; ENSG00000044459. ENST00000380647; ENSP00000370021; ENSG00000044459. |
| GeneID | 54875. |
| KEGG | hsa:54875. |
| UCSC | uc003zmx.4. human. uc003zmy.3. human. uc003zmz.2. human. |
Organism-specific databases | |
| CTD | 54875. |
| GeneCards | GC09P017124. |
| HGNC | HGNC:23432. CNTLN. |
| HPA | HPA036728. HPA036729. |
| MIM | 611870. gene. |
| neXtProt | NX_Q9NXG0. |
| PharmGKB | PA162382646. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG129417. |
| HOGENOM | HOG000111849. |
| HOVERGEN | HBG107737. |
| KO | K16467. |
| OMA | MDLEMKQ. |
Gene expression databases | |
| ArrayExpress | Q9NXG0. |
| Bgee | Q9NXG0. |
| CleanEx | HS_CNTLN. |
| Genevestigator | Q9NXG0. |
| GermOnline | ENSG00000044459. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003661. Sig_transdc_His_kin_sub1_dim/P. [Graphical view] |
| SMART | SM00388. HisKA. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 54875. |
| NextBio | 57805. |
| SOURCE | Search... |
Entry information
| Entry name | CNTLN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NXG0 Secondary accession number(s): A5Z2X6 Q9HAJ5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
