SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NXG0

- CNTLN_HUMAN

UniProt

Q9NXG0 - CNTLN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Centlein

Gene
CNTLN, C9orf101, C9orf39
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. phosphorelay sensor kinase activity Source: InterPro
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Centlein
Alternative name(s):
Centrosomal protein
Gene namesi
Name:CNTLN
Synonyms:C9orf101, C9orf39
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 9

Organism-specific databases

HGNCiHGNC:23432. CNTLN.

Subcellular locationi

Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole
Note: Colocalizes with gamma-tubulin during interphase and mitosis. Appears to associated with the mother centriole during G1 phase and with daughter centrioles towards G1/S phase By similarity.

GO - Cellular componenti

  1. centriole Source: UniProtKB-SubCell
  2. extracellular vesicular exosome Source: UniProt
  3. membrane Source: InterPro
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162382646.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed By similarity
Chaini2 – 14051404CentleinPRO_0000227567Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine By similarity
Modified residuei5 – 51Phosphoserine By similarity

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

PaxDbiQ9NXG0.
PRIDEiQ9NXG0.

PTM databases

PhosphoSiteiQ9NXG0.

Expressioni

Gene expression databases

ArrayExpressiQ9NXG0.
BgeeiQ9NXG0.
CleanExiHS_CNTLN.
GenevestigatoriQ9NXG0.

Organism-specific databases

HPAiHPA036728.
HPA036729.

Interactioni

Protein-protein interaction databases

BioGridi120223. 5 interactions.
DIPiDIP-47295N.
STRINGi9606.ENSP00000370021.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili95 – 12632 Reviewed predictionAdd
BLAST
Coiled coili613 – 65543 Reviewed predictionAdd
BLAST
Coiled coili681 – 793113 Reviewed predictionAdd
BLAST
Coiled coili980 – 1311332 Reviewed predictionAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi1398 – 14058Poly-Ser

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG129417.
HOGENOMiHOG000111849.
HOVERGENiHBG107737.
KOiK16467.
OMAiKEMHEKM.
OrthoDBiEOG7FXZXM.
PhylomeDBiQ9NXG0.
TreeFamiTF329190.

Family and domain databases

InterProiIPR003661. EnvZ-like_dim/P.
[Graphical view]
SMARTiSM00388. HisKA. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NXG0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAARSPPSPH PSPPARQLGP RSPRVGRGAE VHAMRSEASG FAGAAREVVA     50
DESDKIWVGE EGSGGRRGPG GAAPAHAPLL SAPMGSRRLE GISVEEAMVT 100
RTQLLEEELS SLKEELALCQ ADKEFVWSLW KRLQVTNPDL TQVVSLVVER 150
EKQKSEAKDR KVLEILQVKD AKIQEFEQRE SVLKQEINDL VKRKIAVDEE 200
NAFLRKEFSD LEKKFKDKSQ EIKDTKECVQ NKEEQNRLVI KNLEEENKKL 250
STRCTDLLND LEKLRKQEAH LRKEKYSTDA KIKTFEDNLI EARKEVEVSQ 300
SKYNALSLQL SNKQTELIQK DMDITLVRKE LQELQNLYKQ NSTHTAQQAE 350
LIQQLQVLNM DTQKVLRNQE DVHTAESISY QKLYNELHIC FETTKSNEAM 400
LRQSVTNLQD QLLQKEQENA KLKEKLQESQ GAPLPLPQES DPDYSAQVPH 450
RPSLSSLETL MVSQKSEIEY LQEKLKIANE KLSENISANK GFSRKSIMTS 500
AEGKHKEPPV KRSRSLSPKS SFTDSEELQK LRKAERKIEN LEKALQLKSQ 550
ENDELRDAHE KRKERLQMLQ TNYRAVKEQL KQWEEGSGMT EIRKIKRADP 600
QQLRQEDSDA VWNELAYFKR ENQELMIQKM NLEEELDELK VHISIDKAAI 650
QELNRCVAER REEQLFRSGE DDEVKRSTPE KNGKEMLEQT LQKVTELENR 700
LKSFEKRSRK LKEGNKKLMK ENDFLKSLLK QQQEDTETRE KELEQIIKGS 750
KDVEKENTEL QVKISELETE VTSLRRQVAE ANALRNENEE LINPMEKSHQ 800
SADRAKSEMA TMKVRSGRYD CKTTMTKVKF KAAKKNCSVG RHHTVLNHSI 850
KVMSNVFENL SKDGWEDVSE SSSDSEAQTS QTLGTIIVET SQKISPTEDG 900
KDQKESDPTE DSQTQGKEIV QTYLNIDGKT PKDYFHDKNA KKPTFQKKNC 950
KMQKSSHTAV PTRVNREKYK NITAQKSSSN IILLRERIIS LQQQNSVLQN 1000
AKKTAELSVK EYKEVNEKLL HQQQVSDQRF QTSRQTIKKL NLDLAGLRKE 1050
KEDLLKKLES SSEITSLAEE NSQVTFPRIQ VTSLSPSRSM DLEMKQLQYK 1100
LKNATNELTK QSSNVKTLKF ELLAKEEHIK EMHEKISRME RDITMKRHLI 1150
EDLKFRQKVN LESNKSFSEM LQNLDKKVKT LTEECSNKKV SIDSLKQRLN 1200
VAVKEKSQYE QMYQKSKEEL EKKDLKLTLL VSRISETESA MAEIETAASK 1250
QLQELALQSE QVLEGAQKTL LLANEKVEEF TTFVKALAKE LQNDVHVVRR 1300
QIRELKKMKK NRDACKTSTH KAQTLAASIL NISRSDLEEI LDTEDQVEIE 1350
KTKIDAENDK EWMLYIQKLL EGQSLTLSPR LKCNGAIMAH QNLRLPDSSS 1400
SASAS 1405

Note: No experimental confirmation available.

Length:1,405
Mass (Da):161,603
Last modified:January 11, 2011 - v5
Checksum:i6161171F6995E843
GO
Isoform 2 (identifier: Q9NXG0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1374-1405: SLTLSPRLKCNGAIMAHQNLRLPDSSSSASAS → LPFASYLLEAVLEKINEKKKLVEGYFTIMKDIR

Note: No experimental confirmation available.

Show »
Length:1,406
Mass (Da):162,190
Checksum:i6F6D3FAA60C90837
GO
Isoform 3 (identifier: Q9NXG0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     383-391: LYNELHICF → VCFYSVIKM
     392-1405: Missing.

Note: No experimental confirmation available.

Show »
Length:391
Mass (Da):44,587
Checksum:i2D42ACFC8A710C21
GO

Sequence cautioni

The sequence BAA91052.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAB13850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti284 – 2841T → A.
Corresponds to variant rs3808795 [ dbSNP | Ensembl ].
VAR_056840
Natural varianti291 – 2911E → D.
Corresponds to variant rs3808794 [ dbSNP | Ensembl ].
VAR_056841
Natural varianti562 – 5621R → C.
Corresponds to variant rs3808782 [ dbSNP | Ensembl ].
VAR_025608
Natural varianti695 – 6951T → I.1 Publication
Corresponds to variant rs7035276 [ dbSNP | Ensembl ].
VAR_025609
Natural varianti1376 – 13761T → A.
Corresponds to variant rs2499057 [ dbSNP | Ensembl ].
VAR_025610

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei383 – 3919LYNELHICF → VCFYSVIKM in isoform 3. VSP_032864
Alternative sequencei392 – 14051014Missing in isoform 3. VSP_032865Add
BLAST
Alternative sequencei1374 – 140532SLTLS…SASAS → LPFASYLLEAVLEKINEKKK LVEGYFTIMKDIR in isoform 2. VSP_017558Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti700 – 7001R → Q in BAB13850. 1 Publication
Sequence conflicti871 – 8711Missing in BAB13850. 1 Publication
Sequence conflicti1004 – 10041T → A in BAB13850. 1 Publication
Sequence conflicti1240 – 12401A → V in BAB13850. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000283 mRNA. Translation: BAA91052.1. Different initiation.
AK021596 mRNA. Translation: BAB13850.1. Different initiation.
AK098502 mRNA. Translation: BAC05319.1.
AL133214
, AL162725, AL354711, AL354738, AL590377 Genomic DNA. Translation: CAH70743.2.
AL162725
, AL133214, AL354711, AL354738, AL590377 Genomic DNA. Translation: CAH70424.1.
AL162725, AL354711 Genomic DNA. Translation: CAH70425.1.
AL354711
, AL133214, AL162725, AL354738, AL590377 Genomic DNA. Translation: CAH72682.2.
AL354711, AL162725 Genomic DNA. Translation: CAH72684.1.
AL354738
, AL133214, AL162725, AL354711, AL590377 Genomic DNA. Translation: CAI16195.2.
AL590377
, AL133214, AL162725, AL354711, AL354738 Genomic DNA. Translation: CAI14630.2.
CCDSiCCDS43789.1. [Q9NXG0-2]
CCDS47953.1. [Q9NXG0-3]
RefSeqiNP_001107867.1. NM_001114395.2. [Q9NXG0-3]
NP_060208.2. NM_017738.3. [Q9NXG0-2]
UniGeneiHs.435381.

Genome annotation databases

EnsembliENST00000380641; ENSP00000370015; ENSG00000044459. [Q9NXG0-3]
ENST00000380647; ENSP00000370021; ENSG00000044459. [Q9NXG0-2]
GeneIDi54875.
KEGGihsa:54875.
UCSCiuc003zmx.4. human. [Q9NXG0-3]
uc003zmy.3. human. [Q9NXG0-2]
uc003zmz.2. human. [Q9NXG0-1]

Polymorphism databases

DMDMi317373585.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000283 mRNA. Translation: BAA91052.1 . Different initiation.
AK021596 mRNA. Translation: BAB13850.1 . Different initiation.
AK098502 mRNA. Translation: BAC05319.1 .
AL133214
, AL162725 , AL354711 , AL354738 , AL590377 Genomic DNA. Translation: CAH70743.2 .
AL162725
, AL133214 , AL354711 , AL354738 , AL590377 Genomic DNA. Translation: CAH70424.1 .
AL162725 , AL354711 Genomic DNA. Translation: CAH70425.1 .
AL354711
, AL133214 , AL162725 , AL354738 , AL590377 Genomic DNA. Translation: CAH72682.2 .
AL354711 , AL162725 Genomic DNA. Translation: CAH72684.1 .
AL354738
, AL133214 , AL162725 , AL354711 , AL590377 Genomic DNA. Translation: CAI16195.2 .
AL590377
, AL133214 , AL162725 , AL354711 , AL354738 Genomic DNA. Translation: CAI14630.2 .
CCDSi CCDS43789.1. [Q9NXG0-2 ]
CCDS47953.1. [Q9NXG0-3 ]
RefSeqi NP_001107867.1. NM_001114395.2. [Q9NXG0-3 ]
NP_060208.2. NM_017738.3. [Q9NXG0-2 ]
UniGenei Hs.435381.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120223. 5 interactions.
DIPi DIP-47295N.
STRINGi 9606.ENSP00000370021.

PTM databases

PhosphoSitei Q9NXG0.

Polymorphism databases

DMDMi 317373585.

Proteomic databases

PaxDbi Q9NXG0.
PRIDEi Q9NXG0.

Protocols and materials databases

DNASUi 54875.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000380641 ; ENSP00000370015 ; ENSG00000044459 . [Q9NXG0-3 ]
ENST00000380647 ; ENSP00000370021 ; ENSG00000044459 . [Q9NXG0-2 ]
GeneIDi 54875.
KEGGi hsa:54875.
UCSCi uc003zmx.4. human. [Q9NXG0-3 ]
uc003zmy.3. human. [Q9NXG0-2 ]
uc003zmz.2. human. [Q9NXG0-1 ]

Organism-specific databases

CTDi 54875.
GeneCardsi GC09P017124.
HGNCi HGNC:23432. CNTLN.
HPAi HPA036728.
HPA036729.
MIMi 611870. gene.
neXtProti NX_Q9NXG0.
PharmGKBi PA162382646.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG129417.
HOGENOMi HOG000111849.
HOVERGENi HBG107737.
KOi K16467.
OMAi KEMHEKM.
OrthoDBi EOG7FXZXM.
PhylomeDBi Q9NXG0.
TreeFami TF329190.

Miscellaneous databases

GeneWikii CNTLN.
GenomeRNAii 54875.
NextBioi 57805.
PROi Q9NXG0.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9NXG0.
Bgeei Q9NXG0.
CleanExi HS_CNTLN.
Genevestigatori Q9NXG0.

Family and domain databases

InterProi IPR003661. EnvZ-like_dim/P.
[Graphical view ]
SMARTi SM00388. HisKA. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 278-1405 (ISOFORM 1), VARIANT ILE-695.
    Tissue: Embryo and Gastric mucosa.
  2. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiCNTLN_HUMAN
AccessioniPrimary (citable) accession number: Q9NXG0
Secondary accession number(s): A5Z2X6
, Q5VYJ0, Q8N1G9, Q9HAJ5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: January 11, 2011
Last modified: July 9, 2014
This is version 92 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi