Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NXG0 (CNTLN_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 90. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Centlein
Alternative name(s):
Centrosomal protein
Gene names
Name:CNTLN
Synonyms:C9orf101, C9orf39
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1405 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole. Note: Colocalizes with gamma-tubulin during interphase and mitosis. Appears to associated with the mother centriole during G1 phase and with daughter centrioles towards G1/S phase By similarity.

Sequence caution

The sequence BAA91052.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAB13850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NXG0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q9NXG0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1374-1405: SLTLSPRLKCNGAIMAHQNLRLPDSSSSASAS → LPFASYLLEAVLEKINEKKKLVEGYFTIMKDIR
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9NXG0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     383-391: LYNELHICF → VCFYSVIKM
     392-1405: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Initiator methionine11Removed By similarity
Chain2 – 14051404Centlein
PRO_0000227567

Regions

Coiled coil95 – 12632 Potential
Coiled coil613 – 65543 Potential
Coiled coil681 – 793113 Potential
Coiled coil980 – 1311332 Potential
Compositional bias1398 – 14058Poly-Ser

Amino acid modifications

Modified residue21N-acetylalanine By similarity
Modified residue51Phosphoserine By similarity

Natural variations

Alternative sequence383 – 3919LYNELHICF → VCFYSVIKM in isoform 3.
VSP_032864
Alternative sequence392 – 14051014Missing in isoform 3.
VSP_032865
Alternative sequence1374 – 140532SLTLS…SASAS → LPFASYLLEAVLEKINEKKK LVEGYFTIMKDIR in isoform 2.
VSP_017558
Natural variant2841T → A.
Corresponds to variant rs3808795 [ dbSNP | Ensembl ].
VAR_056840
Natural variant2911E → D.
Corresponds to variant rs3808794 [ dbSNP | Ensembl ].
VAR_056841
Natural variant5621R → C.
Corresponds to variant rs3808782 [ dbSNP | Ensembl ].
VAR_025608
Natural variant6951T → I. Ref.1
Corresponds to variant rs7035276 [ dbSNP | Ensembl ].
VAR_025609
Natural variant13761T → A.
Corresponds to variant rs2499057 [ dbSNP | Ensembl ].
VAR_025610

Experimental info

Sequence conflict7001R → Q in BAB13850. Ref.1
Sequence conflict8711Missing in BAB13850. Ref.1
Sequence conflict10041T → A in BAB13850. Ref.1
Sequence conflict12401A → V in BAB13850. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 11, 2011. Version 5.
Checksum: 6161171F6995E843

FASTA1,405161,603
        10         20         30         40         50         60 
MAARSPPSPH PSPPARQLGP RSPRVGRGAE VHAMRSEASG FAGAAREVVA DESDKIWVGE 

        70         80         90        100        110        120 
EGSGGRRGPG GAAPAHAPLL SAPMGSRRLE GISVEEAMVT RTQLLEEELS SLKEELALCQ 

       130        140        150        160        170        180 
ADKEFVWSLW KRLQVTNPDL TQVVSLVVER EKQKSEAKDR KVLEILQVKD AKIQEFEQRE 

       190        200        210        220        230        240 
SVLKQEINDL VKRKIAVDEE NAFLRKEFSD LEKKFKDKSQ EIKDTKECVQ NKEEQNRLVI 

       250        260        270        280        290        300 
KNLEEENKKL STRCTDLLND LEKLRKQEAH LRKEKYSTDA KIKTFEDNLI EARKEVEVSQ 

       310        320        330        340        350        360 
SKYNALSLQL SNKQTELIQK DMDITLVRKE LQELQNLYKQ NSTHTAQQAE LIQQLQVLNM 

       370        380        390        400        410        420 
DTQKVLRNQE DVHTAESISY QKLYNELHIC FETTKSNEAM LRQSVTNLQD QLLQKEQENA 

       430        440        450        460        470        480 
KLKEKLQESQ GAPLPLPQES DPDYSAQVPH RPSLSSLETL MVSQKSEIEY LQEKLKIANE 

       490        500        510        520        530        540 
KLSENISANK GFSRKSIMTS AEGKHKEPPV KRSRSLSPKS SFTDSEELQK LRKAERKIEN 

       550        560        570        580        590        600 
LEKALQLKSQ ENDELRDAHE KRKERLQMLQ TNYRAVKEQL KQWEEGSGMT EIRKIKRADP 

       610        620        630        640        650        660 
QQLRQEDSDA VWNELAYFKR ENQELMIQKM NLEEELDELK VHISIDKAAI QELNRCVAER 

       670        680        690        700        710        720 
REEQLFRSGE DDEVKRSTPE KNGKEMLEQT LQKVTELENR LKSFEKRSRK LKEGNKKLMK 

       730        740        750        760        770        780 
ENDFLKSLLK QQQEDTETRE KELEQIIKGS KDVEKENTEL QVKISELETE VTSLRRQVAE 

       790        800        810        820        830        840 
ANALRNENEE LINPMEKSHQ SADRAKSEMA TMKVRSGRYD CKTTMTKVKF KAAKKNCSVG 

       850        860        870        880        890        900 
RHHTVLNHSI KVMSNVFENL SKDGWEDVSE SSSDSEAQTS QTLGTIIVET SQKISPTEDG 

       910        920        930        940        950        960 
KDQKESDPTE DSQTQGKEIV QTYLNIDGKT PKDYFHDKNA KKPTFQKKNC KMQKSSHTAV 

       970        980        990       1000       1010       1020 
PTRVNREKYK NITAQKSSSN IILLRERIIS LQQQNSVLQN AKKTAELSVK EYKEVNEKLL 

      1030       1040       1050       1060       1070       1080 
HQQQVSDQRF QTSRQTIKKL NLDLAGLRKE KEDLLKKLES SSEITSLAEE NSQVTFPRIQ 

      1090       1100       1110       1120       1130       1140 
VTSLSPSRSM DLEMKQLQYK LKNATNELTK QSSNVKTLKF ELLAKEEHIK EMHEKISRME 

      1150       1160       1170       1180       1190       1200 
RDITMKRHLI EDLKFRQKVN LESNKSFSEM LQNLDKKVKT LTEECSNKKV SIDSLKQRLN 

      1210       1220       1230       1240       1250       1260 
VAVKEKSQYE QMYQKSKEEL EKKDLKLTLL VSRISETESA MAEIETAASK QLQELALQSE 

      1270       1280       1290       1300       1310       1320 
QVLEGAQKTL LLANEKVEEF TTFVKALAKE LQNDVHVVRR QIRELKKMKK NRDACKTSTH 

      1330       1340       1350       1360       1370       1380 
KAQTLAASIL NISRSDLEEI LDTEDQVEIE KTKIDAENDK EWMLYIQKLL EGQSLTLSPR 

      1390       1400 
LKCNGAIMAH QNLRLPDSSS SASAS 

« Hide

Isoform 2 [UniParc].

Checksum: 6F6D3FAA60C90837
Show »

FASTA1,406162,190
Isoform 3 [UniParc].

Checksum: 2D42ACFC8A710C21
Show »

FASTA39144,587

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 278-1405 (ISOFORM 1), VARIANT ILE-695.
Tissue: Embryo and Gastric mucosa.
[2]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK000283 mRNA. Translation: BAA91052.1. Different initiation.
AK021596 mRNA. Translation: BAB13850.1. Different initiation.
AK098502 mRNA. Translation: BAC05319.1.
AL133214 expand/collapse EMBL AC list , AL162725, AL354711, AL354738, AL590377 Genomic DNA. Translation: CAH70743.2.
AL162725 expand/collapse EMBL AC list , AL133214, AL354711, AL354738, AL590377 Genomic DNA. Translation: CAH70424.1.
AL162725, AL354711 Genomic DNA. Translation: CAH70425.1.
AL354711 expand/collapse EMBL AC list , AL133214, AL162725, AL354738, AL590377 Genomic DNA. Translation: CAH72682.2.
AL354711, AL162725 Genomic DNA. Translation: CAH72684.1.
AL354738 expand/collapse EMBL AC list , AL133214, AL162725, AL354711, AL590377 Genomic DNA. Translation: CAI16195.2.
AL590377 expand/collapse EMBL AC list , AL133214, AL162725, AL354711, AL354738 Genomic DNA. Translation: CAI14630.2.
RefSeqNP_001107867.1. NM_001114395.2.
NP_060208.2. NM_017738.3.
UniGeneHs.435381.

3D structure databases

ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120223. 5 interactions.
DIPDIP-47295N.
STRING9606.ENSP00000370021.

PTM databases

PhosphoSiteQ9NXG0.

Polymorphism databases

DMDM317373585.

Proteomic databases

PaxDbQ9NXG0.
PRIDEQ9NXG0.

Protocols and materials databases

DNASU54875.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000380641; ENSP00000370015; ENSG00000044459. [Q9NXG0-3]
ENST00000380647; ENSP00000370021; ENSG00000044459. [Q9NXG0-2]
GeneID54875.
KEGGhsa:54875.
UCSCuc003zmx.4. human. [Q9NXG0-3]
uc003zmy.3. human. [Q9NXG0-2]
uc003zmz.2. human. [Q9NXG0-1]

Organism-specific databases

CTD54875.
GeneCardsGC09P017124.
HGNCHGNC:23432. CNTLN.
HPAHPA036728.
HPA036729.
MIM611870. gene.
neXtProtNX_Q9NXG0.
PharmGKBPA162382646.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG129417.
HOGENOMHOG000111849.
HOVERGENHBG107737.
KOK16467.
OMAKEMHEKM.
OrthoDBEOG7FXZXM.
PhylomeDBQ9NXG0.
TreeFamTF329190.

Gene expression databases

ArrayExpressQ9NXG0.
BgeeQ9NXG0.
CleanExHS_CNTLN.
GenevestigatorQ9NXG0.

Family and domain databases

InterProIPR003661. EnvZ-like_dim/P.
[Graphical view]
SMARTSM00388. HisKA. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCNTLN.
GenomeRNAi54875.
NextBio57805.
PROQ9NXG0.
SOURCESearch...

Entry information

Entry nameCNTLN_HUMAN
AccessionPrimary (citable) accession number: Q9NXG0
Secondary accession number(s): A5Z2X6 expand/collapse secondary AC list , Q5VYJ0, Q8N1G9, Q9HAJ5
Entry history
Integrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: January 11, 2011
Last modified: April 16, 2014
This is version 90 of the entry and version 5 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM