Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NXG0

- CNTLN_HUMAN

UniProt

Q9NXG0 - CNTLN_HUMAN

Protein

Centlein

Gene

CNTLN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 93 (01 Oct 2014)
      Sequence version 5 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. phosphorelay sensor kinase activity Source: InterPro
    2. protein binding, bridging Source: UniProtKB
    3. protein domain specific binding Source: UniProtKB
    4. protein kinase binding Source: UniProtKB

    GO - Biological processi

    1. centriole-centriole cohesion Source: UniProtKB
    2. protein localization to organelle Source: UniProtKB

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Centlein
    Alternative name(s):
    Centrosomal protein
    Gene namesi
    Name:CNTLN
    Synonyms:C9orf101, C9orf39
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 9

    Organism-specific databases

    HGNCiHGNC:23432. CNTLN.

    Subcellular locationi

    Cytoplasmcytoskeletonmicrotubule organizing centercentrosomecentriole
    Note: Colocalizes with gamma-tubulin during interphase and mitosis. Appears to associated with the mother centriole during G1 phase and with daughter centrioles towards G1/S phase By similarity.By similarity

    GO - Cellular componenti

    1. centriole Source: UniProtKB
    2. cytoplasm Source: UniProtKB
    3. extracellular vesicular exosome Source: UniProt
    4. membrane Source: InterPro

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162382646.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11RemovedBy similarity
    Chaini2 – 14051404CentleinPRO_0000227567Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanineBy similarity
    Modified residuei5 – 51PhosphoserineBy similarity

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    PaxDbiQ9NXG0.
    PRIDEiQ9NXG0.

    PTM databases

    PhosphoSiteiQ9NXG0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9NXG0.
    BgeeiQ9NXG0.
    CleanExiHS_CNTLN.
    GenevestigatoriQ9NXG0.

    Organism-specific databases

    HPAiHPA036728.
    HPA036729.

    Interactioni

    Protein-protein interaction databases

    BioGridi120223. 5 interactions.
    DIPiDIP-47295N.
    IntActiQ9NXG0. 2 interactions.
    STRINGi9606.ENSP00000370021.

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili95 – 12632Sequence AnalysisAdd
    BLAST
    Coiled coili613 – 65543Sequence AnalysisAdd
    BLAST
    Coiled coili681 – 793113Sequence AnalysisAdd
    BLAST
    Coiled coili980 – 1311332Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi1398 – 14058Poly-Ser

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG129417.
    HOGENOMiHOG000111849.
    HOVERGENiHBG107737.
    KOiK16467.
    OMAiKEMHEKM.
    OrthoDBiEOG7FXZXM.
    PhylomeDBiQ9NXG0.
    TreeFamiTF329190.

    Family and domain databases

    InterProiIPR003661. EnvZ-like_dim/P.
    [Graphical view]
    SMARTiSM00388. HisKA. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NXG0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAARSPPSPH PSPPARQLGP RSPRVGRGAE VHAMRSEASG FAGAAREVVA     50
    DESDKIWVGE EGSGGRRGPG GAAPAHAPLL SAPMGSRRLE GISVEEAMVT 100
    RTQLLEEELS SLKEELALCQ ADKEFVWSLW KRLQVTNPDL TQVVSLVVER 150
    EKQKSEAKDR KVLEILQVKD AKIQEFEQRE SVLKQEINDL VKRKIAVDEE 200
    NAFLRKEFSD LEKKFKDKSQ EIKDTKECVQ NKEEQNRLVI KNLEEENKKL 250
    STRCTDLLND LEKLRKQEAH LRKEKYSTDA KIKTFEDNLI EARKEVEVSQ 300
    SKYNALSLQL SNKQTELIQK DMDITLVRKE LQELQNLYKQ NSTHTAQQAE 350
    LIQQLQVLNM DTQKVLRNQE DVHTAESISY QKLYNELHIC FETTKSNEAM 400
    LRQSVTNLQD QLLQKEQENA KLKEKLQESQ GAPLPLPQES DPDYSAQVPH 450
    RPSLSSLETL MVSQKSEIEY LQEKLKIANE KLSENISANK GFSRKSIMTS 500
    AEGKHKEPPV KRSRSLSPKS SFTDSEELQK LRKAERKIEN LEKALQLKSQ 550
    ENDELRDAHE KRKERLQMLQ TNYRAVKEQL KQWEEGSGMT EIRKIKRADP 600
    QQLRQEDSDA VWNELAYFKR ENQELMIQKM NLEEELDELK VHISIDKAAI 650
    QELNRCVAER REEQLFRSGE DDEVKRSTPE KNGKEMLEQT LQKVTELENR 700
    LKSFEKRSRK LKEGNKKLMK ENDFLKSLLK QQQEDTETRE KELEQIIKGS 750
    KDVEKENTEL QVKISELETE VTSLRRQVAE ANALRNENEE LINPMEKSHQ 800
    SADRAKSEMA TMKVRSGRYD CKTTMTKVKF KAAKKNCSVG RHHTVLNHSI 850
    KVMSNVFENL SKDGWEDVSE SSSDSEAQTS QTLGTIIVET SQKISPTEDG 900
    KDQKESDPTE DSQTQGKEIV QTYLNIDGKT PKDYFHDKNA KKPTFQKKNC 950
    KMQKSSHTAV PTRVNREKYK NITAQKSSSN IILLRERIIS LQQQNSVLQN 1000
    AKKTAELSVK EYKEVNEKLL HQQQVSDQRF QTSRQTIKKL NLDLAGLRKE 1050
    KEDLLKKLES SSEITSLAEE NSQVTFPRIQ VTSLSPSRSM DLEMKQLQYK 1100
    LKNATNELTK QSSNVKTLKF ELLAKEEHIK EMHEKISRME RDITMKRHLI 1150
    EDLKFRQKVN LESNKSFSEM LQNLDKKVKT LTEECSNKKV SIDSLKQRLN 1200
    VAVKEKSQYE QMYQKSKEEL EKKDLKLTLL VSRISETESA MAEIETAASK 1250
    QLQELALQSE QVLEGAQKTL LLANEKVEEF TTFVKALAKE LQNDVHVVRR 1300
    QIRELKKMKK NRDACKTSTH KAQTLAASIL NISRSDLEEI LDTEDQVEIE 1350
    KTKIDAENDK EWMLYIQKLL EGQSLTLSPR LKCNGAIMAH QNLRLPDSSS 1400
    SASAS 1405

    Note: No experimental confirmation available.

    Length:1,405
    Mass (Da):161,603
    Last modified:January 11, 2011 - v5
    Checksum:i6161171F6995E843
    GO
    Isoform 2 (identifier: Q9NXG0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1374-1405: SLTLSPRLKCNGAIMAHQNLRLPDSSSSASAS → LPFASYLLEAVLEKINEKKKLVEGYFTIMKDIR

    Note: No experimental confirmation available.

    Show »
    Length:1,406
    Mass (Da):162,190
    Checksum:i6F6D3FAA60C90837
    GO
    Isoform 3 (identifier: Q9NXG0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         383-391: LYNELHICF → VCFYSVIKM
         392-1405: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:391
    Mass (Da):44,587
    Checksum:i2D42ACFC8A710C21
    GO

    Sequence cautioni

    The sequence BAA91052.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAB13850.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti700 – 7001R → Q in BAB13850. (PubMed:14702039)Curated
    Sequence conflicti871 – 8711Missing in BAB13850. (PubMed:14702039)Curated
    Sequence conflicti1004 – 10041T → A in BAB13850. (PubMed:14702039)Curated
    Sequence conflicti1240 – 12401A → V in BAB13850. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti284 – 2841T → A.
    Corresponds to variant rs3808795 [ dbSNP | Ensembl ].
    VAR_056840
    Natural varianti291 – 2911E → D.
    Corresponds to variant rs3808794 [ dbSNP | Ensembl ].
    VAR_056841
    Natural varianti562 – 5621R → C.
    Corresponds to variant rs3808782 [ dbSNP | Ensembl ].
    VAR_025608
    Natural varianti695 – 6951T → I.1 Publication
    Corresponds to variant rs7035276 [ dbSNP | Ensembl ].
    VAR_025609
    Natural varianti1376 – 13761T → A.
    Corresponds to variant rs2499057 [ dbSNP | Ensembl ].
    VAR_025610

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei383 – 3919LYNELHICF → VCFYSVIKM in isoform 3. 1 PublicationVSP_032864
    Alternative sequencei392 – 14051014Missing in isoform 3. 1 PublicationVSP_032865Add
    BLAST
    Alternative sequencei1374 – 140532SLTLS…SASAS → LPFASYLLEAVLEKINEKKK LVEGYFTIMKDIR in isoform 2. CuratedVSP_017558Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000283 mRNA. Translation: BAA91052.1. Different initiation.
    AK021596 mRNA. Translation: BAB13850.1. Different initiation.
    AK098502 mRNA. Translation: BAC05319.1.
    AL133214
    , AL162725, AL354711, AL354738, AL590377 Genomic DNA. Translation: CAH70743.2.
    AL162725
    , AL133214, AL354711, AL354738, AL590377 Genomic DNA. Translation: CAH70424.1.
    AL162725, AL354711 Genomic DNA. Translation: CAH70425.1.
    AL354711
    , AL133214, AL162725, AL354738, AL590377 Genomic DNA. Translation: CAH72682.2.
    AL354711, AL162725 Genomic DNA. Translation: CAH72684.1.
    AL354738
    , AL133214, AL162725, AL354711, AL590377 Genomic DNA. Translation: CAI16195.2.
    AL590377
    , AL133214, AL162725, AL354711, AL354738 Genomic DNA. Translation: CAI14630.2.
    CCDSiCCDS43789.1. [Q9NXG0-2]
    CCDS47953.1. [Q9NXG0-3]
    RefSeqiNP_001107867.1. NM_001114395.2. [Q9NXG0-3]
    NP_060208.2. NM_017738.3. [Q9NXG0-2]
    UniGeneiHs.435381.

    Genome annotation databases

    EnsembliENST00000380641; ENSP00000370015; ENSG00000044459. [Q9NXG0-3]
    ENST00000380647; ENSP00000370021; ENSG00000044459. [Q9NXG0-2]
    GeneIDi54875.
    KEGGihsa:54875.
    UCSCiuc003zmx.4. human. [Q9NXG0-3]
    uc003zmy.3. human. [Q9NXG0-2]
    uc003zmz.2. human. [Q9NXG0-1]

    Polymorphism databases

    DMDMi317373585.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000283 mRNA. Translation: BAA91052.1 . Different initiation.
    AK021596 mRNA. Translation: BAB13850.1 . Different initiation.
    AK098502 mRNA. Translation: BAC05319.1 .
    AL133214
    , AL162725 , AL354711 , AL354738 , AL590377 Genomic DNA. Translation: CAH70743.2 .
    AL162725
    , AL133214 , AL354711 , AL354738 , AL590377 Genomic DNA. Translation: CAH70424.1 .
    AL162725 , AL354711 Genomic DNA. Translation: CAH70425.1 .
    AL354711
    , AL133214 , AL162725 , AL354738 , AL590377 Genomic DNA. Translation: CAH72682.2 .
    AL354711 , AL162725 Genomic DNA. Translation: CAH72684.1 .
    AL354738
    , AL133214 , AL162725 , AL354711 , AL590377 Genomic DNA. Translation: CAI16195.2 .
    AL590377
    , AL133214 , AL162725 , AL354711 , AL354738 Genomic DNA. Translation: CAI14630.2 .
    CCDSi CCDS43789.1. [Q9NXG0-2 ]
    CCDS47953.1. [Q9NXG0-3 ]
    RefSeqi NP_001107867.1. NM_001114395.2. [Q9NXG0-3 ]
    NP_060208.2. NM_017738.3. [Q9NXG0-2 ]
    UniGenei Hs.435381.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120223. 5 interactions.
    DIPi DIP-47295N.
    IntActi Q9NXG0. 2 interactions.
    STRINGi 9606.ENSP00000370021.

    PTM databases

    PhosphoSitei Q9NXG0.

    Polymorphism databases

    DMDMi 317373585.

    Proteomic databases

    PaxDbi Q9NXG0.
    PRIDEi Q9NXG0.

    Protocols and materials databases

    DNASUi 54875.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000380641 ; ENSP00000370015 ; ENSG00000044459 . [Q9NXG0-3 ]
    ENST00000380647 ; ENSP00000370021 ; ENSG00000044459 . [Q9NXG0-2 ]
    GeneIDi 54875.
    KEGGi hsa:54875.
    UCSCi uc003zmx.4. human. [Q9NXG0-3 ]
    uc003zmy.3. human. [Q9NXG0-2 ]
    uc003zmz.2. human. [Q9NXG0-1 ]

    Organism-specific databases

    CTDi 54875.
    GeneCardsi GC09P017124.
    HGNCi HGNC:23432. CNTLN.
    HPAi HPA036728.
    HPA036729.
    MIMi 611870. gene.
    neXtProti NX_Q9NXG0.
    PharmGKBi PA162382646.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG129417.
    HOGENOMi HOG000111849.
    HOVERGENi HBG107737.
    KOi K16467.
    OMAi KEMHEKM.
    OrthoDBi EOG7FXZXM.
    PhylomeDBi Q9NXG0.
    TreeFami TF329190.

    Miscellaneous databases

    GeneWikii CNTLN.
    GenomeRNAii 54875.
    NextBioi 57805.
    PROi Q9NXG0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NXG0.
    Bgeei Q9NXG0.
    CleanExi HS_CNTLN.
    Genevestigatori Q9NXG0.

    Family and domain databases

    InterProi IPR003661. EnvZ-like_dim/P.
    [Graphical view ]
    SMARTi SM00388. HisKA. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 278-1405 (ISOFORM 1), VARIANT ILE-695.
      Tissue: Embryo and Gastric mucosa.
    2. "DNA sequence and analysis of human chromosome 9."
      Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
      , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
      Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

    Entry informationi

    Entry nameiCNTLN_HUMAN
    AccessioniPrimary (citable) accession number: Q9NXG0
    Secondary accession number(s): A5Z2X6
    , Q5VYJ0, Q8N1G9, Q9HAJ5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 21, 2006
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 93 of the entry and version 5 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 9
      Human chromosome 9: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3