Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NXE4

- NSMA3_HUMAN

UniProt

Q9NXE4 - NSMA3_HUMAN

Protein

Sphingomyelin phosphodiesterase 4

Gene

SMPD4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 90 (01 Oct 2014)
      Sequence version 2 (23 Jan 2007)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Catalyzes the hydrolysis of membrane sphingomyelin to form phosphorylcholine and ceramide.1 Publication

    Catalytic activityi

    Sphingomyelin + H2O = N-acylsphingosine + phosphocholine.

    Cofactori

    Magnesium.1 Publication

    Enzyme regulationi

    Activated by phosphatidylserine and tumor necrosis factor (TNF). Inhibited by scyphostatin.1 Publication

    pH dependencei

    Optimum pH is 7.0.1 Publication

    GO - Molecular functioni

    1. metal ion binding Source: UniProtKB-KW
    2. sphingomyelin phosphodiesterase activity Source: Reactome
    3. sphingomyelin phosphodiesterase D activity Source: HGNC

    GO - Biological processi

    1. cellular response to tumor necrosis factor Source: BHF-UCL
    2. ceramide biosynthetic process Source: BHF-UCL
    3. glycerophospholipid catabolic process Source: BHF-UCL
    4. glycosphingolipid metabolic process Source: Reactome
    5. small molecule metabolic process Source: Reactome
    6. sphingolipid metabolic process Source: Reactome
    7. sphingomyelin catabolic process Source: HGNC

    Keywords - Molecular functioni

    Hydrolase

    Keywords - Ligandi

    Magnesium, Metal-binding

    Enzyme and pathway databases

    ReactomeiREACT_116105. Glycosphingolipid metabolism.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sphingomyelin phosphodiesterase 4 (EC:3.1.4.12)
    Alternative name(s):
    Neutral sphingomyelinase 3
    Short name:
    nSMase-3
    Short name:
    nSMase3
    Neutral sphingomyelinase III
    Gene namesi
    Name:SMPD4
    Synonyms:KIAA1418
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:32949. SMPD4.

    Subcellular locationi

    Endoplasmic reticulum membrane 1 Publication; Single-pass membrane protein 1 Publication. Golgi apparatus membrane 1 Publication; Single-pass membrane protein 1 Publication

    GO - Cellular componenti

    1. endoplasmic reticulum Source: BHF-UCL
    2. endoplasmic reticulum membrane Source: Reactome
    3. Golgi apparatus Source: HGNC
    4. Golgi membrane Source: UniProtKB-SubCell
    5. integral component of membrane Source: UniProtKB-KW
    6. trans-Golgi network Source: HGNC

    Keywords - Cellular componenti

    Endoplasmic reticulum, Golgi apparatus, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA145148067.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 827827Sphingomyelin phosphodiesterase 4PRO_0000273163Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei130 – 1301Phosphoserine2 Publications
    Modified residuei669 – 6691Phosphothreonine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9NXE4.
    PaxDbiQ9NXE4.
    PRIDEiQ9NXE4.

    PTM databases

    PhosphoSiteiQ9NXE4.

    Expressioni

    Tissue specificityi

    Widely expressed, with highest levels in heart and skeletal muscle.1 Publication

    Gene expression databases

    ArrayExpressiQ9NXE4.
    BgeeiQ9NXE4.
    CleanExiHS_SMPD4.
    GenevestigatoriQ9NXE4.

    Organism-specific databases

    HPAiHPA046279.
    HPA049426.

    Interactioni

    Protein-protein interaction databases

    BioGridi120766. 7 interactions.
    IntActiQ9NXE4. 2 interactions.
    MINTiMINT-4995095.
    STRINGi9606.ENSP00000376704.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NXE4.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei783 – 80321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG240539.
    HOVERGENiHBG082060.
    InParanoidiQ9NXE4.
    KOiK12353.
    PhylomeDBiQ9NXE4.
    TreeFamiTF324409.

    Family and domain databases

    InterProiIPR024129. Sphingomy_SMPD4.
    [Graphical view]
    PANTHERiPTHR12988. PTHR12988. 1 hit.
    PfamiPF14724. mit_SMPDase. 1 hit.
    [Graphical view]

    Sequences (10)i

    Sequence statusi: Complete.

    This entry describes 10 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NXE4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAFPHLQQPS FLLASLKADS INKPFAQQCQ DLVKVIEDFP AKELHTIFPW    50
    LVESIFGSLD GVLVGWNLRC LQGRVNPVEY SIVMEFLDPG GPMMKLVYKL 100
    QAEDYKFDFP VSYLPGPVKA SIQECILPDS PLYHNKVQFT PTGGLGLNLA 150
    LNPFEYYIFF FALSLITQKP LPVSLHVRTS DCAYFILVDR YLSWFLPTEG 200
    SVPPPLSSSP GGTSPSPPPR TPAIPFASYG LHHTSLLKRH ISHQTSVNAD 250
    PASHEIWRSE TLLQVFVEMW LHHYSLEMYQ KMQSPHAKLE VLHYRLSVSS 300
    ALYSPAQPSL QALHAYQESF TPTEEHVLVV RLLLKHLHAF ANSLKPEQAS 350
    PSAHSHATSP LEEFKRAAVP RFVQQKLYLF LQHCFGHWPL DASFRAVLEM 400
    WLSYLQPWRY APDKQAPGSD SQPRCVSEKW APFVQENLLM YTKLFVGFLN 450
    RALRTDLVSP KHALMVFRVA KVFAQPNLAE MIQKGEQLFL EPELVIPHRQ 500
    HRLFTAPTFT GSFLSPWPPA VTDASFKVKS HVYSLEGQDC KYTPMFGPEA 550
    RTLVLRLAQL ITQAKHTAKS ISDQCAESPA GHSFLSWLGF SSMDTNGSYT 600
    ANDLDEMGQD SVRKTDEYLE KALEYLRQIF RLSEAQLRQF TLALGTTQDE 650
    NGKKQLPDCI VGEDGLILTP LGRYQIINGL RRFEIEYQGD PELQPIRSYE 700
    IASLVRTLFR LSSAINHRFA GQMAALCSRD DFLGSFCRYH LTEPGLASRH 750
    LLSPVGRRQV AGHTRGPRLS LRFLGSYRTL VSLLLAFFVA SLFCVGPLPC 800
    TLLLTLGYVL YASAMTLLTE RGKLHQP 827
    Length:827
    Mass (Da):93,352
    Last modified:January 23, 2007 - v2
    Checksum:iE9B68BF1D0895EC8
    GO
    Isoform 2 (identifier: Q9NXE4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         289-317: Missing.

    Show »
    Length:798
    Mass (Da):90,127
    Checksum:iCB503C2FE7FF5260
    GO
    Isoform 3 (identifier: Q9NXE4-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-92: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:735
    Mass (Da):83,071
    Checksum:iD8AB07DB58C4FC79
    GO
    Isoform 4 (identifier: Q9NXE4-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         365-365: K → KRMGLNLPEVPSALPRRSQPSLMGALGSSVSRASLLGKQQVTLPIPC

    Note: No experimental confirmation available.

    Show »
    Length:873
    Mass (Da):98,148
    Checksum:i404647021BE6D555
    GO
    Isoform 5 (identifier: Q9NXE4-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-429: Missing.
         430-484: WAPFVQENLL...QPNLAEMIQK → MSATYCVGDA...VGARFVSCLL

    Note: No experimental confirmation available.

    Show »
    Length:398
    Mass (Da):44,223
    Checksum:i93961860F90846E4
    GO
    Isoform 6 (identifier: Q9NXE4-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAM
         43-115: Missing.
         289-317: Missing.

    Show »
    Length:764
    Mass (Da):86,193
    Checksum:iB9110FD449F73E04
    GO
    Isoform 7 (identifier: Q9NXE4-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-96: MAFPHLQQPS...LDPGGPMMKL → MQTPPPTRSG...FSSGCVQDEE
         97-316: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:607
    Mass (Da):68,254
    Checksum:i34101AA98A60F6BE
    GO
    Isoform 8 (identifier: Q9NXE4-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAM
         43-115: Missing.
         116-264: Missing.
         289-317: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:615
    Mass (Da):69,804
    Checksum:i0C84F51DDCC86612
    GO
    Isoform 9 (identifier: Q9NXE4-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-40: MAFPHLQQPS...DLVKVIEDFP → MQTPPPTRSG...CIKKCSPLMP
         41-365: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:502
    Mass (Da):56,805
    Checksum:iC9DC3697BFF9243D
    GO
    Isoform 10 (identifier: Q9NXE4-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-268: Missing.
         289-317: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:530
    Mass (Da):60,173
    Checksum:iE9572BAAA322C832
    GO

    Sequence cautioni

    The sequence BAA91368.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA91567.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA92656.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti164 – 1641S → G in BAG61230. (PubMed:14702039)Curated
    Sequence conflicti540 – 5401C → R in BAA91567. (PubMed:14702039)Curated
    Sequence conflicti692 – 6921E → K in BAA91368. (PubMed:14702039)Curated
    Sequence conflicti693 – 6931L → Q in BAA91567. (PubMed:14702039)Curated
    Sequence conflicti703 – 7031S → G in BAC86751. (PubMed:14702039)Curated
    Sequence conflicti823 – 8231K → E in BAG61230. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 429429Missing in isoform 5. 1 PublicationVSP_022479Add
    BLAST
    Alternative sequencei1 – 268268Missing in isoform 10. 1 PublicationVSP_055343Add
    BLAST
    Alternative sequencei1 – 9696MAFPH…PMMKL → MQTPPPTRSGGQKLCSRFLL KCGFITIPWRCIKKCSPLMP SWRFCTTDSVSPAPSTAPPN PASRPSTPTKSLGNRGSDAR GFYWAEFSSGCVQDEE in isoform 7. 1 PublicationVSP_054382Add
    BLAST
    Alternative sequencei1 – 9292Missing in isoform 3. 1 PublicationVSP_022480Add
    BLAST
    Alternative sequencei1 – 4040MAFPH…IEDFP → MQTPPPTRSGGQKLCSRFLL KCGFITIPWRCIKKCSPLMP in isoform 9. 1 PublicationVSP_054383Add
    BLAST
    Alternative sequencei1 – 11M → MTTFGAVAEWRLPSLRRATL WIPQWFAKKAIFNSPLEAAM in isoform 6 and isoform 8. 1 PublicationVSP_044494
    Alternative sequencei41 – 365325Missing in isoform 9. 1 PublicationVSP_054384Add
    BLAST
    Alternative sequencei43 – 11573Missing in isoform 6 and isoform 8. 1 PublicationVSP_044495Add
    BLAST
    Alternative sequencei97 – 316220Missing in isoform 7. 1 PublicationVSP_054385Add
    BLAST
    Alternative sequencei116 – 264149Missing in isoform 8. 1 PublicationVSP_054386Add
    BLAST
    Alternative sequencei289 – 31729Missing in isoform 2, isoform 6, isoform 8 and isoform 10. 1 PublicationVSP_022481Add
    BLAST
    Alternative sequencei365 – 3651K → KRMGLNLPEVPSALPRRSQP SLMGALGSSVSRASLLGKQQ VTLPIPC in isoform 4. 1 PublicationVSP_022482
    Alternative sequencei430 – 48455WAPFV…EMIQK → MSATYCVGDAARQGLRRTPL GHGSPDTSETPQNPKGSSRV LCLREVGARFVSCLL in isoform 5. 1 PublicationVSP_022483Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB037839 mRNA. Translation: BAA92656.1. Different initiation.
    AK000304 mRNA. Translation: BAA91070.1.
    AK000763 mRNA. Translation: BAA91368.1. Different initiation.
    AK001227 mRNA. Translation: BAA91567.1. Different initiation.
    AK126920 mRNA. Translation: BAC86751.1.
    AK297257 mRNA. Translation: BAG59735.1.
    AK298609 mRNA. Translation: BAG60793.1.
    AK299185 mRNA. Translation: BAG61230.1.
    AK303427 mRNA. Translation: BAG64478.1.
    AK301576 mRNA. Translation: BAG63069.1.
    AC018804 Genomic DNA. Translation: AAY14883.1.
    CH471263 Genomic DNA. Translation: EAW55600.1.
    BC064947 mRNA. Translation: AAH64947.1.
    AL136737 mRNA. Translation: CAB66671.2.
    CR533550 mRNA. Translation: CAG38581.1.
    CCDSiCCDS54398.1. [Q9NXE4-6]
    RefSeqiNP_001164554.1. NM_001171083.2. [Q9NXE4-6]
    NP_060221.2. NM_017751.4.
    XP_005263761.1. XM_005263704.2.
    UniGeneiHs.516450.

    Genome annotation databases

    EnsembliENST00000431183; ENSP00000405187; ENSG00000136699. [Q9NXE4-6]
    GeneIDi55627.
    KEGGihsa:55627.
    UCSCiuc002tqo.2. human. [Q9NXE4-5]
    uc002tqs.2. human. [Q9NXE4-1]
    uc002tqt.2. human. [Q9NXE4-2]
    uc010zab.2. human. [Q9NXE4-6]

    Polymorphism databases

    DMDMi124015179.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB037839 mRNA. Translation: BAA92656.1 . Different initiation.
    AK000304 mRNA. Translation: BAA91070.1 .
    AK000763 mRNA. Translation: BAA91368.1 . Different initiation.
    AK001227 mRNA. Translation: BAA91567.1 . Different initiation.
    AK126920 mRNA. Translation: BAC86751.1 .
    AK297257 mRNA. Translation: BAG59735.1 .
    AK298609 mRNA. Translation: BAG60793.1 .
    AK299185 mRNA. Translation: BAG61230.1 .
    AK303427 mRNA. Translation: BAG64478.1 .
    AK301576 mRNA. Translation: BAG63069.1 .
    AC018804 Genomic DNA. Translation: AAY14883.1 .
    CH471263 Genomic DNA. Translation: EAW55600.1 .
    BC064947 mRNA. Translation: AAH64947.1 .
    AL136737 mRNA. Translation: CAB66671.2 .
    CR533550 mRNA. Translation: CAG38581.1 .
    CCDSi CCDS54398.1. [Q9NXE4-6 ]
    RefSeqi NP_001164554.1. NM_001171083.2. [Q9NXE4-6 ]
    NP_060221.2. NM_017751.4.
    XP_005263761.1. XM_005263704.2.
    UniGenei Hs.516450.

    3D structure databases

    ProteinModelPortali Q9NXE4.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120766. 7 interactions.
    IntActi Q9NXE4. 2 interactions.
    MINTi MINT-4995095.
    STRINGi 9606.ENSP00000376704.

    Chemistry

    DrugBanki DB00144. Phosphatidylserine.

    PTM databases

    PhosphoSitei Q9NXE4.

    Polymorphism databases

    DMDMi 124015179.

    Proteomic databases

    MaxQBi Q9NXE4.
    PaxDbi Q9NXE4.
    PRIDEi Q9NXE4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000431183 ; ENSP00000405187 ; ENSG00000136699 . [Q9NXE4-6 ]
    GeneIDi 55627.
    KEGGi hsa:55627.
    UCSCi uc002tqo.2. human. [Q9NXE4-5 ]
    uc002tqs.2. human. [Q9NXE4-1 ]
    uc002tqt.2. human. [Q9NXE4-2 ]
    uc010zab.2. human. [Q9NXE4-6 ]

    Organism-specific databases

    CTDi 55627.
    GeneCardsi GC02M130908.
    HGNCi HGNC:32949. SMPD4.
    HPAi HPA046279.
    HPA049426.
    MIMi 610457. gene.
    neXtProti NX_Q9NXE4.
    PharmGKBi PA145148067.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG240539.
    HOVERGENi HBG082060.
    InParanoidi Q9NXE4.
    KOi K12353.
    PhylomeDBi Q9NXE4.
    TreeFami TF324409.

    Enzyme and pathway databases

    Reactomei REACT_116105. Glycosphingolipid metabolism.

    Miscellaneous databases

    ChiTaRSi SMPD4. human.
    GeneWikii SMPD4.
    GenomeRNAii 55627.
    NextBioi 35473200.
    PROi Q9NXE4.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NXE4.
    Bgeei Q9NXE4.
    CleanExi HS_SMPD4.
    Genevestigatori Q9NXE4.

    Family and domain databases

    InterProi IPR024129. Sphingomy_SMPD4.
    [Graphical view ]
    PANTHERi PTHR12988. PTHR12988. 1 hit.
    Pfami PF14724. mit_SMPDase. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6; 7; 8; 9 AND 10), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 134-827 (ISOFORM 4).
      Tissue: Mammary gland and Thymus.
    3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Lung.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 397-827.
      Tissue: Testis.
    7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 400-827.
    8. "Novel tumor necrosis factor-responsive mammalian neutral sphingomyelinase-3 is a C-tail-anchored protein."
      Krut O., Wiegmann K., Kashkar H., Yazdanpanah B., Kroenke M.
      J. Biol. Chem. 281:13784-13793(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, COFACTOR, BIOPHYSICOCHEMICAL PROPERTIES, ENZYME REGULATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    9. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130 AND THR-669, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiNSMA3_HUMAN
    AccessioniPrimary (citable) accession number: Q9NXE4
    Secondary accession number(s): B4DM23
    , B4DQ31, B4DRB8, B4DWK7, B4E0L6, E7ESA2, E9PCE6, Q6FI76, Q6P1P7, Q6ZT43, Q9H0M2, Q9NW20, Q9NWL2, Q9P2C9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 23, 2007
    Last sequence update: January 23, 2007
    Last modified: October 1, 2014
    This is version 90 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3