SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NXE4

- NSMA3_HUMAN

UniProt

Q9NXE4 - NSMA3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Sphingomyelin phosphodiesterase 4

Gene
SMPD4, KIAA1418
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Catalyzes the hydrolysis of membrane sphingomyelin to form phosphorylcholine and ceramide.1 Publication

Catalytic activityi

Sphingomyelin + H2O = N-acylsphingosine + phosphocholine.

Cofactori

Magnesium.1 Publication

Enzyme regulationi

Activated by phosphatidylserine and tumor necrosis factor (TNF). Inhibited by scyphostatin.1 Publication

pH dependencei

Optimum pH is 7.0.1 Publication

GO - Molecular functioni

  1. metal ion binding Source: UniProtKB-KW
  2. sphingomyelin phosphodiesterase activity Source: Reactome
  3. sphingomyelin phosphodiesterase D activity Source: InterPro

GO - Biological processi

  1. cellular response to tumor necrosis factor Source: BHF-UCL
  2. ceramide biosynthetic process Source: BHF-UCL
  3. glycerophospholipid catabolic process Source: BHF-UCL
  4. glycosphingolipid metabolic process Source: Reactome
  5. small molecule metabolic process Source: Reactome
  6. sphingolipid metabolic process Source: Reactome
  7. sphingomyelin catabolic process Source: HGNC
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Keywords - Ligandi

Magnesium, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_116105. Glycosphingolipid metabolism.

Names & Taxonomyi

Protein namesi
Recommended name:
Sphingomyelin phosphodiesterase 4 (EC:3.1.4.12)
Alternative name(s):
Neutral sphingomyelinase 3
Short name:
nSMase-3
Short name:
nSMase3
Neutral sphingomyelinase III
Gene namesi
Name:SMPD4
Synonyms:KIAA1418
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:32949. SMPD4.

Subcellular locationi

Endoplasmic reticulum membrane; Single-pass membrane protein. Golgi apparatus membrane; Single-pass membrane protein 1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei783 – 80321Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. endoplasmic reticulum Source: BHF-UCL
  2. endoplasmic reticulum membrane Source: Reactome
  3. Golgi apparatus Source: HGNC
  4. Golgi membrane Source: UniProtKB-SubCell
  5. integral component of membrane Source: UniProtKB-KW
  6. trans-Golgi network Source: HGNC
Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145148067.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 827827Sphingomyelin phosphodiesterase 4PRO_0000273163Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei130 – 1301Phosphoserine2 Publications
Modified residuei669 – 6691Phosphothreonine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9NXE4.
PaxDbiQ9NXE4.
PRIDEiQ9NXE4.

PTM databases

PhosphoSiteiQ9NXE4.

Expressioni

Tissue specificityi

Widely expressed, with highest levels in heart and skeletal muscle.1 Publication

Gene expression databases

ArrayExpressiQ9NXE4.
BgeeiQ9NXE4.
CleanExiHS_SMPD4.
GenevestigatoriQ9NXE4.

Organism-specific databases

HPAiHPA046279.
HPA049426.

Interactioni

Protein-protein interaction databases

BioGridi120766. 7 interactions.
IntActiQ9NXE4. 2 interactions.
MINTiMINT-4995095.
STRINGi9606.ENSP00000376704.

Structurei

3D structure databases

ProteinModelPortaliQ9NXE4.

Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG240539.
HOVERGENiHBG082060.
InParanoidiQ9NXE4.
KOiK12353.
PhylomeDBiQ9NXE4.
TreeFamiTF324409.

Family and domain databases

InterProiIPR024129. Sphingomy_SMPD4.
[Graphical view]
PANTHERiPTHR12988. PTHR12988. 1 hit.
PfamiPF14724. mit_SMPDase. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NXE4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAFPHLQQPS FLLASLKADS INKPFAQQCQ DLVKVIEDFP AKELHTIFPW    50
LVESIFGSLD GVLVGWNLRC LQGRVNPVEY SIVMEFLDPG GPMMKLVYKL 100
QAEDYKFDFP VSYLPGPVKA SIQECILPDS PLYHNKVQFT PTGGLGLNLA 150
LNPFEYYIFF FALSLITQKP LPVSLHVRTS DCAYFILVDR YLSWFLPTEG 200
SVPPPLSSSP GGTSPSPPPR TPAIPFASYG LHHTSLLKRH ISHQTSVNAD 250
PASHEIWRSE TLLQVFVEMW LHHYSLEMYQ KMQSPHAKLE VLHYRLSVSS 300
ALYSPAQPSL QALHAYQESF TPTEEHVLVV RLLLKHLHAF ANSLKPEQAS 350
PSAHSHATSP LEEFKRAAVP RFVQQKLYLF LQHCFGHWPL DASFRAVLEM 400
WLSYLQPWRY APDKQAPGSD SQPRCVSEKW APFVQENLLM YTKLFVGFLN 450
RALRTDLVSP KHALMVFRVA KVFAQPNLAE MIQKGEQLFL EPELVIPHRQ 500
HRLFTAPTFT GSFLSPWPPA VTDASFKVKS HVYSLEGQDC KYTPMFGPEA 550
RTLVLRLAQL ITQAKHTAKS ISDQCAESPA GHSFLSWLGF SSMDTNGSYT 600
ANDLDEMGQD SVRKTDEYLE KALEYLRQIF RLSEAQLRQF TLALGTTQDE 650
NGKKQLPDCI VGEDGLILTP LGRYQIINGL RRFEIEYQGD PELQPIRSYE 700
IASLVRTLFR LSSAINHRFA GQMAALCSRD DFLGSFCRYH LTEPGLASRH 750
LLSPVGRRQV AGHTRGPRLS LRFLGSYRTL VSLLLAFFVA SLFCVGPLPC 800
TLLLTLGYVL YASAMTLLTE RGKLHQP 827
Length:827
Mass (Da):93,352
Last modified:January 23, 2007 - v2
Checksum:iE9B68BF1D0895EC8
GO
Isoform 2 (identifier: Q9NXE4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     289-317: Missing.

Show »
Length:798
Mass (Da):90,127
Checksum:iCB503C2FE7FF5260
GO
Isoform 3 (identifier: Q9NXE4-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: Missing.

Note: No experimental confirmation available.

Show »
Length:735
Mass (Da):83,071
Checksum:iD8AB07DB58C4FC79
GO
Isoform 4 (identifier: Q9NXE4-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     365-365: K → KRMGLNLPEVPSALPRRSQPSLMGALGSSVSRASLLGKQQVTLPIPC

Note: No experimental confirmation available.

Show »
Length:873
Mass (Da):98,148
Checksum:i404647021BE6D555
GO
Isoform 5 (identifier: Q9NXE4-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-429: Missing.
     430-484: WAPFVQENLL...QPNLAEMIQK → MSATYCVGDA...VGARFVSCLL

Note: No experimental confirmation available.

Show »
Length:398
Mass (Da):44,223
Checksum:i93961860F90846E4
GO
Isoform 6 (identifier: Q9NXE4-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAM
     43-115: Missing.
     289-317: Missing.

Show »
Length:764
Mass (Da):86,193
Checksum:iB9110FD449F73E04
GO
Isoform 7 (identifier: Q9NXE4-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: MAFPHLQQPS...LDPGGPMMKL → MQTPPPTRSG...FSSGCVQDEE
     97-316: Missing.

Note: No experimental confirmation available.

Show »
Length:607
Mass (Da):68,254
Checksum:i34101AA98A60F6BE
GO
Isoform 8 (identifier: Q9NXE4-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAM
     43-115: Missing.
     116-264: Missing.
     289-317: Missing.

Note: No experimental confirmation available.

Show »
Length:615
Mass (Da):69,804
Checksum:i0C84F51DDCC86612
GO
Isoform 9 (identifier: Q9NXE4-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MAFPHLQQPS...DLVKVIEDFP → MQTPPPTRSG...CIKKCSPLMP
     41-365: Missing.

Note: No experimental confirmation available.

Show »
Length:502
Mass (Da):56,805
Checksum:iC9DC3697BFF9243D
GO
Isoform 10 (identifier: Q9NXE4-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-268: Missing.
     289-317: Missing.

Note: No experimental confirmation available.

Show »
Length:530
Mass (Da):60,173
Checksum:iE9572BAAA322C832
GO

Sequence cautioni

The sequence BAA91368.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA91567.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA92656.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 429429Missing in isoform 5. VSP_022479Add
BLAST
Alternative sequencei1 – 268268Missing in isoform 10. VSP_055343Add
BLAST
Alternative sequencei1 – 9696MAFPH…PMMKL → MQTPPPTRSGGQKLCSRFLL KCGFITIPWRCIKKCSPLMP SWRFCTTDSVSPAPSTAPPN PASRPSTPTKSLGNRGSDAR GFYWAEFSSGCVQDEE in isoform 7. VSP_054382Add
BLAST
Alternative sequencei1 – 9292Missing in isoform 3. VSP_022480Add
BLAST
Alternative sequencei1 – 4040MAFPH…IEDFP → MQTPPPTRSGGQKLCSRFLL KCGFITIPWRCIKKCSPLMP in isoform 9. VSP_054383Add
BLAST
Alternative sequencei1 – 11M → MTTFGAVAEWRLPSLRRATL WIPQWFAKKAIFNSPLEAAM in isoform 6 and isoform 8. VSP_044494
Alternative sequencei41 – 365325Missing in isoform 9. VSP_054384Add
BLAST
Alternative sequencei43 – 11573Missing in isoform 6 and isoform 8. VSP_044495Add
BLAST
Alternative sequencei97 – 316220Missing in isoform 7. VSP_054385Add
BLAST
Alternative sequencei116 – 264149Missing in isoform 8. VSP_054386Add
BLAST
Alternative sequencei289 – 31729Missing in isoform 2, isoform 6, isoform 8 and isoform 10. VSP_022481Add
BLAST
Alternative sequencei365 – 3651K → KRMGLNLPEVPSALPRRSQP SLMGALGSSVSRASLLGKQQ VTLPIPC in isoform 4. VSP_022482
Alternative sequencei430 – 48455WAPFV…EMIQK → MSATYCVGDAARQGLRRTPL GHGSPDTSETPQNPKGSSRV LCLREVGARFVSCLL in isoform 5. VSP_022483Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti164 – 1641S → G in BAG61230. 1 Publication
Sequence conflicti540 – 5401C → R in BAA91567. 1 Publication
Sequence conflicti692 – 6921E → K in BAA91368. 1 Publication
Sequence conflicti693 – 6931L → Q in BAA91567. 1 Publication
Sequence conflicti703 – 7031S → G in BAC86751. 1 Publication
Sequence conflicti823 – 8231K → E in BAG61230. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB037839 mRNA. Translation: BAA92656.1. Different initiation.
AK000304 mRNA. Translation: BAA91070.1.
AK000763 mRNA. Translation: BAA91368.1. Different initiation.
AK001227 mRNA. Translation: BAA91567.1. Different initiation.
AK126920 mRNA. Translation: BAC86751.1.
AK297257 mRNA. Translation: BAG59735.1.
AK298609 mRNA. Translation: BAG60793.1.
AK299185 mRNA. Translation: BAG61230.1.
AK303427 mRNA. Translation: BAG64478.1.
AK301576 mRNA. Translation: BAG63069.1.
AC018804 Genomic DNA. Translation: AAY14883.1.
CH471263 Genomic DNA. Translation: EAW55600.1.
BC064947 mRNA. Translation: AAH64947.1.
AL136737 mRNA. Translation: CAB66671.2.
CR533550 mRNA. Translation: CAG38581.1.
CCDSiCCDS54398.1. [Q9NXE4-6]
RefSeqiNP_001164554.1. NM_001171083.2. [Q9NXE4-6]
NP_060221.2. NM_017751.4.
XP_005263761.1. XM_005263704.2.
UniGeneiHs.516450.

Genome annotation databases

EnsembliENST00000426662; ENSP00000397479; ENSG00000136699.
ENST00000431183; ENSP00000405187; ENSG00000136699. [Q9NXE4-6]
ENST00000443958; ENSP00000391896; ENSG00000136699.
ENST00000452225; ENSP00000387762; ENSG00000136699.
ENST00000453750; ENSP00000394313; ENSG00000136699.
GeneIDi55627.
KEGGihsa:55627.
UCSCiuc002tqo.2. human. [Q9NXE4-5]
uc002tqs.2. human. [Q9NXE4-1]
uc002tqt.2. human. [Q9NXE4-2]
uc010zab.2. human. [Q9NXE4-6]

Polymorphism databases

DMDMi124015179.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB037839 mRNA. Translation: BAA92656.1 . Different initiation.
AK000304 mRNA. Translation: BAA91070.1 .
AK000763 mRNA. Translation: BAA91368.1 . Different initiation.
AK001227 mRNA. Translation: BAA91567.1 . Different initiation.
AK126920 mRNA. Translation: BAC86751.1 .
AK297257 mRNA. Translation: BAG59735.1 .
AK298609 mRNA. Translation: BAG60793.1 .
AK299185 mRNA. Translation: BAG61230.1 .
AK303427 mRNA. Translation: BAG64478.1 .
AK301576 mRNA. Translation: BAG63069.1 .
AC018804 Genomic DNA. Translation: AAY14883.1 .
CH471263 Genomic DNA. Translation: EAW55600.1 .
BC064947 mRNA. Translation: AAH64947.1 .
AL136737 mRNA. Translation: CAB66671.2 .
CR533550 mRNA. Translation: CAG38581.1 .
CCDSi CCDS54398.1. [Q9NXE4-6 ]
RefSeqi NP_001164554.1. NM_001171083.2. [Q9NXE4-6 ]
NP_060221.2. NM_017751.4.
XP_005263761.1. XM_005263704.2.
UniGenei Hs.516450.

3D structure databases

ProteinModelPortali Q9NXE4.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120766. 7 interactions.
IntActi Q9NXE4. 2 interactions.
MINTi MINT-4995095.
STRINGi 9606.ENSP00000376704.

Chemistry

DrugBanki DB00144. Phosphatidylserine.

PTM databases

PhosphoSitei Q9NXE4.

Polymorphism databases

DMDMi 124015179.

Proteomic databases

MaxQBi Q9NXE4.
PaxDbi Q9NXE4.
PRIDEi Q9NXE4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000426662 ; ENSP00000397479 ; ENSG00000136699 .
ENST00000431183 ; ENSP00000405187 ; ENSG00000136699 . [Q9NXE4-6 ]
ENST00000443958 ; ENSP00000391896 ; ENSG00000136699 .
ENST00000452225 ; ENSP00000387762 ; ENSG00000136699 .
ENST00000453750 ; ENSP00000394313 ; ENSG00000136699 .
GeneIDi 55627.
KEGGi hsa:55627.
UCSCi uc002tqo.2. human. [Q9NXE4-5 ]
uc002tqs.2. human. [Q9NXE4-1 ]
uc002tqt.2. human. [Q9NXE4-2 ]
uc010zab.2. human. [Q9NXE4-6 ]

Organism-specific databases

CTDi 55627.
GeneCardsi GC02M130908.
HGNCi HGNC:32949. SMPD4.
HPAi HPA046279.
HPA049426.
MIMi 610457. gene.
neXtProti NX_Q9NXE4.
PharmGKBi PA145148067.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG240539.
HOVERGENi HBG082060.
InParanoidi Q9NXE4.
KOi K12353.
PhylomeDBi Q9NXE4.
TreeFami TF324409.

Enzyme and pathway databases

Reactomei REACT_116105. Glycosphingolipid metabolism.

Miscellaneous databases

ChiTaRSi SMPD4. human.
GeneWikii SMPD4.
GenomeRNAii 55627.
NextBioi 35473200.
PROi Q9NXE4.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9NXE4.
Bgeei Q9NXE4.
CleanExi HS_SMPD4.
Genevestigatori Q9NXE4.

Family and domain databases

InterProi IPR024129. Sphingomy_SMPD4.
[Graphical view ]
PANTHERi PTHR12988. PTHR12988. 1 hit.
Pfami PF14724. mit_SMPDase. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
    DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6; 7; 8; 9 AND 10), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 134-827 (ISOFORM 4).
    Tissue: Mammary gland and Thymus.
  3. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Lung.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 397-827.
    Tissue: Testis.
  7. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 400-827.
  8. "Novel tumor necrosis factor-responsive mammalian neutral sphingomyelinase-3 is a C-tail-anchored protein."
    Krut O., Wiegmann K., Kashkar H., Yazdanpanah B., Kroenke M.
    J. Biol. Chem. 281:13784-13793(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, COFACTOR, BIOPHYSICOCHEMICAL PROPERTIES, ENZYME REGULATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  9. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130 AND THR-669, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiNSMA3_HUMAN
AccessioniPrimary (citable) accession number: Q9NXE4
Secondary accession number(s): B4DM23
, B4DQ31, B4DRB8, B4DWK7, B4E0L6, E7ESA2, E9PCE6, Q6FI76, Q6P1P7, Q6ZT43, Q9H0M2, Q9NW20, Q9NWL2, Q9P2C9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 23, 2007
Last modified: September 3, 2014
This is version 89 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi