Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NXE4 (NSMA3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 88. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Sphingomyelin phosphodiesterase 4

EC=3.1.4.12
Alternative name(s):
Neutral sphingomyelinase 3
Short name=nSMase-3
Short name=nSMase3
Neutral sphingomyelinase III
Gene names
Name:SMPD4
Synonyms:KIAA1418
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length827 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the hydrolysis of membrane sphingomyelin to form phosphorylcholine and ceramide. Ref.8

Catalytic activity

Sphingomyelin + H2O = N-acylsphingosine + phosphocholine.

Cofactor

Magnesium. Ref.8

Enzyme regulation

Activated by phosphatidylserine and tumor necrosis factor (TNF). Inhibited by scyphostatin. Ref.8

Subcellular location

Endoplasmic reticulum membrane; Single-pass membrane protein. Golgi apparatus membrane; Single-pass membrane protein Ref.8.

Tissue specificity

Widely expressed, with highest levels in heart and skeletal muscle. Ref.8

Biophysicochemical properties

pH dependence:

Optimum pH is 7.0. Ref.8

Sequence caution

The sequence BAA91368.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAA91567.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAA92656.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Keywords
   Cellular componentEndoplasmic reticulum
Golgi apparatus
Membrane
   Coding sequence diversityAlternative splicing
   DomainTransmembrane
Transmembrane helix
   LigandMagnesium
Metal-binding
   Molecular functionHydrolase
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processcellular response to tumor necrosis factor

Inferred from direct assay Ref.8. Source: BHF-UCL

ceramide biosynthetic process

Inferred from direct assay Ref.8. Source: BHF-UCL

glycerophospholipid catabolic process

Inferred from direct assay Ref.8. Source: BHF-UCL

glycosphingolipid metabolic process

Traceable author statement. Source: Reactome

small molecule metabolic process

Traceable author statement. Source: Reactome

sphingolipid metabolic process

Traceable author statement. Source: Reactome

sphingomyelin catabolic process

Inferred from direct assay Ref.8. Source: HGNC

   Cellular_componentGolgi apparatus

Inferred from direct assay Ref.8. Source: HGNC

Golgi membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

endoplasmic reticulum

Inferred from direct assay PubMed 18505924. Source: BHF-UCL

endoplasmic reticulum membrane

Traceable author statement. Source: Reactome

integral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

trans-Golgi network

Inferred from direct assay Ref.8. Source: HGNC

   Molecular_functionmetal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

sphingomyelin phosphodiesterase D activity

Inferred from direct assay Ref.8. Source: HGNC

sphingomyelin phosphodiesterase activity

Traceable author statement. Source: Reactome

Complete GO annotation...

Alternative products

This entry describes 10 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NXE4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NXE4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     289-317: Missing.
Isoform 3 (identifier: Q9NXE4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     1-92: Missing.
Note: No experimental confirmation available.
Isoform 4 (identifier: Q9NXE4-4)

The sequence of this isoform differs from the canonical sequence as follows:
     365-365: K → KRMGLNLPEVPSALPRRSQPSLMGALGSSVSRASLLGKQQVTLPIPC
Note: No experimental confirmation available.
Isoform 5 (identifier: Q9NXE4-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-429: Missing.
     430-484: WAPFVQENLL...QPNLAEMIQK → MSATYCVGDA...VGARFVSCLL
Note: No experimental confirmation available.
Isoform 6 (identifier: Q9NXE4-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAM
     43-115: Missing.
     289-317: Missing.
Isoform 7 (identifier: Q9NXE4-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-96: MAFPHLQQPS...LDPGGPMMKL → MQTPPPTRSG...FSSGCVQDEE
     97-316: Missing.
Note: No experimental confirmation available.
Isoform 8 (identifier: Q9NXE4-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAM
     43-115: Missing.
     116-264: Missing.
     289-317: Missing.
Note: No experimental confirmation available.
Isoform 9 (identifier: Q9NXE4-9)

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MAFPHLQQPS...DLVKVIEDFP → MQTPPPTRSG...CIKKCSPLMP
     41-365: Missing.
Note: No experimental confirmation available.
Isoform 10 (identifier: Q9NXE4-10)

The sequence of this isoform differs from the canonical sequence as follows:
     1-268: Missing.
     289-317: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 827827Sphingomyelin phosphodiesterase 4
PRO_0000273163

Regions

Transmembrane783 – 80321Helical; Potential

Amino acid modifications

Modified residue1301Phosphoserine Ref.9 Ref.10
Modified residue6691Phosphothreonine Ref.9

Natural variations

Alternative sequence1 – 429429Missing in isoform 5.
VSP_022479
Alternative sequence1 – 268268Missing in isoform 10.
VSP_055343
Alternative sequence1 – 9696MAFPH…PMMKL → MQTPPPTRSGGQKLCSRFLL KCGFITIPWRCIKKCSPLMP SWRFCTTDSVSPAPSTAPPN PASRPSTPTKSLGNRGSDAR GFYWAEFSSGCVQDEE in isoform 7.
VSP_054382
Alternative sequence1 – 9292Missing in isoform 3.
VSP_022480
Alternative sequence1 – 4040MAFPH…IEDFP → MQTPPPTRSGGQKLCSRFLL KCGFITIPWRCIKKCSPLMP in isoform 9.
VSP_054383
Alternative sequence11M → MTTFGAVAEWRLPSLRRATL WIPQWFAKKAIFNSPLEAAM in isoform 6 and isoform 8.
VSP_044494
Alternative sequence41 – 365325Missing in isoform 9.
VSP_054384
Alternative sequence43 – 11573Missing in isoform 6 and isoform 8.
VSP_044495
Alternative sequence97 – 316220Missing in isoform 7.
VSP_054385
Alternative sequence116 – 264149Missing in isoform 8.
VSP_054386
Alternative sequence289 – 31729Missing in isoform 2, isoform 6, isoform 8 and isoform 10.
VSP_022481
Alternative sequence3651K → KRMGLNLPEVPSALPRRSQP SLMGALGSSVSRASLLGKQQ VTLPIPC in isoform 4.
VSP_022482
Alternative sequence430 – 48455WAPFV…EMIQK → MSATYCVGDAARQGLRRTPL GHGSPDTSETPQNPKGSSRV LCLREVGARFVSCLL in isoform 5.
VSP_022483

Experimental info

Sequence conflict1641S → G in BAG61230. Ref.2
Sequence conflict5401C → R in BAA91567. Ref.2
Sequence conflict6921E → K in BAA91368. Ref.2
Sequence conflict6931L → Q in BAA91567. Ref.2
Sequence conflict7031S → G in BAC86751. Ref.2
Sequence conflict8231K → E in BAG61230. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 23, 2007. Version 2.
Checksum: E9B68BF1D0895EC8

FASTA82793,352
        10         20         30         40         50         60 
MAFPHLQQPS FLLASLKADS INKPFAQQCQ DLVKVIEDFP AKELHTIFPW LVESIFGSLD 

        70         80         90        100        110        120 
GVLVGWNLRC LQGRVNPVEY SIVMEFLDPG GPMMKLVYKL QAEDYKFDFP VSYLPGPVKA 

       130        140        150        160        170        180 
SIQECILPDS PLYHNKVQFT PTGGLGLNLA LNPFEYYIFF FALSLITQKP LPVSLHVRTS 

       190        200        210        220        230        240 
DCAYFILVDR YLSWFLPTEG SVPPPLSSSP GGTSPSPPPR TPAIPFASYG LHHTSLLKRH 

       250        260        270        280        290        300 
ISHQTSVNAD PASHEIWRSE TLLQVFVEMW LHHYSLEMYQ KMQSPHAKLE VLHYRLSVSS 

       310        320        330        340        350        360 
ALYSPAQPSL QALHAYQESF TPTEEHVLVV RLLLKHLHAF ANSLKPEQAS PSAHSHATSP 

       370        380        390        400        410        420 
LEEFKRAAVP RFVQQKLYLF LQHCFGHWPL DASFRAVLEM WLSYLQPWRY APDKQAPGSD 

       430        440        450        460        470        480 
SQPRCVSEKW APFVQENLLM YTKLFVGFLN RALRTDLVSP KHALMVFRVA KVFAQPNLAE 

       490        500        510        520        530        540 
MIQKGEQLFL EPELVIPHRQ HRLFTAPTFT GSFLSPWPPA VTDASFKVKS HVYSLEGQDC 

       550        560        570        580        590        600 
KYTPMFGPEA RTLVLRLAQL ITQAKHTAKS ISDQCAESPA GHSFLSWLGF SSMDTNGSYT 

       610        620        630        640        650        660 
ANDLDEMGQD SVRKTDEYLE KALEYLRQIF RLSEAQLRQF TLALGTTQDE NGKKQLPDCI 

       670        680        690        700        710        720 
VGEDGLILTP LGRYQIINGL RRFEIEYQGD PELQPIRSYE IASLVRTLFR LSSAINHRFA 

       730        740        750        760        770        780 
GQMAALCSRD DFLGSFCRYH LTEPGLASRH LLSPVGRRQV AGHTRGPRLS LRFLGSYRTL 

       790        800        810        820 
VSLLLAFFVA SLFCVGPLPC TLLLTLGYVL YASAMTLLTE RGKLHQP 

« Hide

Isoform 2 [UniParc].

Checksum: CB503C2FE7FF5260
Show »

FASTA79890,127
Isoform 3 [UniParc].

Checksum: D8AB07DB58C4FC79
Show »

FASTA73583,071
Isoform 4 [UniParc].

Checksum: 404647021BE6D555
Show »

FASTA87398,148
Isoform 5 [UniParc].

Checksum: 93961860F90846E4
Show »

FASTA39844,223
Isoform 6 [UniParc].

Checksum: B9110FD449F73E04
Show »

FASTA76486,193
Isoform 7 [UniParc].

Checksum: 34101AA98A60F6BE
Show »

FASTA60768,254
Isoform 8 [UniParc].

Checksum: 0C84F51DDCC86612
Show »

FASTA61569,804
Isoform 9 [UniParc].

Checksum: C9DC3697BFF9243D
Show »

FASTA50256,805
Isoform 10 [UniParc].

Checksum: E9572BAAA322C832
Show »

FASTA53060,173

References

« Hide 'large scale' references
[1]"Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 5; 6; 7; 8; 9 AND 10), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 134-827 (ISOFORM 4).
Tissue: Mammary gland and Thymus.
[3]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Lung.
[6]"Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs."
Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. expand/collapse author list , Tampe J., Heubner D., Wambutt R., Korn B., Klein M., Poustka A.
Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 397-827.
Tissue: Testis.
[7]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 400-827.
[8]"Novel tumor necrosis factor-responsive mammalian neutral sphingomyelinase-3 is a C-tail-anchored protein."
Krut O., Wiegmann K., Kashkar H., Yazdanpanah B., Kroenke M.
J. Biol. Chem. 281:13784-13793(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, COFACTOR, BIOPHYSICOCHEMICAL PROPERTIES, ENZYME REGULATION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[9]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130 AND THR-669, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-130, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[11]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[12]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB037839 mRNA. Translation: BAA92656.1. Different initiation.
AK000304 mRNA. Translation: BAA91070.1.
AK000763 mRNA. Translation: BAA91368.1. Different initiation.
AK001227 mRNA. Translation: BAA91567.1. Different initiation.
AK126920 mRNA. Translation: BAC86751.1.
AK297257 mRNA. Translation: BAG59735.1.
AK298609 mRNA. Translation: BAG60793.1.
AK299185 mRNA. Translation: BAG61230.1.
AK303427 mRNA. Translation: BAG64478.1.
AK301576 mRNA. Translation: BAG63069.1.
AC018804 Genomic DNA. Translation: AAY14883.1.
CH471263 Genomic DNA. Translation: EAW55600.1.
BC064947 mRNA. Translation: AAH64947.1.
AL136737 mRNA. Translation: CAB66671.2.
CR533550 mRNA. Translation: CAG38581.1.
CCDSCCDS54398.1. [Q9NXE4-6]
RefSeqNP_001164554.1. NM_001171083.2. [Q9NXE4-6]
NP_060221.2. NM_017751.4.
UniGeneHs.516450.

3D structure databases

ProteinModelPortalQ9NXE4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120766. 7 interactions.
IntActQ9NXE4. 2 interactions.
MINTMINT-4995095.
STRING9606.ENSP00000376704.

Chemistry

DrugBankDB00144. Phosphatidylserine.

PTM databases

PhosphoSiteQ9NXE4.

Polymorphism databases

DMDM124015179.

Proteomic databases

MaxQBQ9NXE4.
PaxDbQ9NXE4.
PRIDEQ9NXE4.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000426662; ENSP00000397479; ENSG00000136699.
ENST00000431183; ENSP00000405187; ENSG00000136699. [Q9NXE4-6]
ENST00000443958; ENSP00000391896; ENSG00000136699.
ENST00000452225; ENSP00000387762; ENSG00000136699.
ENST00000453750; ENSP00000394313; ENSG00000136699.
GeneID55627.
KEGGhsa:55627.
UCSCuc002tqo.2. human. [Q9NXE4-5]
uc002tqs.2. human. [Q9NXE4-1]
uc002tqt.2. human. [Q9NXE4-2]
uc010zab.2. human. [Q9NXE4-6]

Organism-specific databases

CTD55627.
GeneCardsGC02M130908.
HGNCHGNC:32949. SMPD4.
HPAHPA046279.
HPA049426.
MIM610457. gene.
neXtProtNX_Q9NXE4.
PharmGKBPA145148067.
HUGESearch...
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG240539.
HOVERGENHBG082060.
InParanoidQ9NXE4.
KOK12353.
PhylomeDBQ9NXE4.
TreeFamTF324409.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.

Gene expression databases

ArrayExpressQ9NXE4.
BgeeQ9NXE4.
CleanExHS_SMPD4.
GenevestigatorQ9NXE4.

Family and domain databases

InterProIPR024129. Sphingomy_SMPD4.
[Graphical view]
PANTHERPTHR12988. PTHR12988. 1 hit.
PfamPF14724. mit_SMPDase. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSMPD4. human.
GeneWikiSMPD4.
GenomeRNAi55627.
NextBio35473200.
PROQ9NXE4.
SOURCESearch...

Entry information

Entry nameNSMA3_HUMAN
AccessionPrimary (citable) accession number: Q9NXE4
Secondary accession number(s): B4DM23 expand/collapse secondary AC list , B4DQ31, B4DRB8, B4DWK7, B4E0L6, E7ESA2, E9PCE6, Q6FI76, Q6P1P7, Q6ZT43, Q9H0M2, Q9NW20, Q9NWL2, Q9P2C9
Entry history
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: January 23, 2007
Last modified: July 9, 2014
This is version 88 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM