Q9NWF9 (RN216_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase RNF216 EC=6.3.2.- Alternative name(s): RING finger protein 216 Triad domain-containing protein 3 Ubiquitin-conjugating enzyme 7-interacting protein 1 Zinc finger protein inhibiting NF-kappa-B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 866 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Isoform 1 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Promotes degradation of TRAF3, TLR4 and TLR9. Contributes to the regulation of antiviral responses. Down-regulates activation of NF-kappa-B, IRF3 activation and IFNB production. Isoform 3/ZIN inhibits TNF and IL-1 mediated activation of NF-kappa-B. Promotes TNF and RIP mediated apoptosis. Ref.2 Ref.10 |
| Pathway | |
| Subunit structure | Interacts with UBE2L3 and to some extent with UBE2L6. Interacts with TRAF3, TLR3, TLR4, TLR5 and TLR9. Isoform 3/ZIN binds RIPK1 and HIV VIF. Ref.1 Ref.2 Ref.8 Ref.10 |
| Subcellular location | |
| Tissue specificity | Ubiquitous, with the highest levels of expression in testis and peripheral blood leukocytes. |
| Domain | The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme By similarity. |
| Post-translational modification | Auto-ubiquitinated. |
| Sequence similarities | Contains 1 IBR-type zinc finger. Contains 2 RING-type zinc fingers. |
| Sequence caution | The sequence BAA91422.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| vif | P12504 | 4 | EBI-723337,EBI-779991 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NWF9-2) Also known as: TRIAD3A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NWF9-1) Also known as: TRIAD3B; The sequence of this isoform differs from the canonical sequence as follows: 67-67: E → ETNKPQRSRPNLIKPAAQWQDLKRLGEERPKKSRAAFESDKSSYFSVCNNPLFDSGAQ | ||||||
| Isoform 3 (identifier: Q9NWF9-3) Also known as: ZIN; TRIAD3; The sequence of this isoform differs from the canonical sequence as follows: 1-378: Missing. | ||||||
| Note: 4 different alternatively spliced mRNAs code for this protein isoform. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 866 | 866 | E3 ubiquitin-protein ligase RNF216 | PRO_0000056293 | |||||
Regions | |||||||||
| Zinc finger | 515 – 566 | 52 | RING-type 1 | ||||||
| Zinc finger | 583 – 648 | 66 | IBR-type | ||||||
| Zinc finger | 675 – 714 | 40 | RING-type 2 | ||||||
| Coiled coil | 475 – 491 | 17 | Potential | ||||||
| Coiled coil | 737 – 763 | 27 | Potential | ||||||
| Compositional bias | 769 – 862 | 94 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 35 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 378 | 378 | Missing in isoform 3. | VSP_012443 | |||||
| Alternative sequence | 67 | 1 | E → ETNKPQRSRPNLIKPAAQWQ DLKRLGEERPKKSRAAFESD KSSYFSVCNNPLFDSGAQ in isoform 2. | VSP_012444 | |||||
Experimental info | |||||||||
| Sequence conflict | 408 | 1 | L → F in AAL38043. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel zinc finger protein interacts with receptor-interacting protein (RIP) and inhibits tumor necrosis factor (TNF)- and IL1-induced NF-kappa B activation." Chen D., Li X., Zhai Z., Shu H.-B. J. Biol. Chem. 277:15985-15991(2002) [PubMed: 11854271] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH RIPK1. |
| [2] | "Triad3A, an E3 ubiquitin-protein ligase regulating Toll-like receptors." Chuang T.-H., Ulevitch R.J. Nat. Immunol. 5:495-502(2004) [PubMed: 15107846] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, INTERACTION WITH TLR3; TLR4; TLR5 AND TLR9. Tissue: Placenta. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Endometrium. |
| [4] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney and Uterus. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 450-866 (ISOFORMS 1/2/3). Tissue: Embryo. |
| [7] | "Identification of a novel TRIAD protein, TRIAD3." van der Reijden B.A., Jansen J.H. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 509-866 (ISOFORMS 1/2/3). |
| [8] | "Ring finger protein ZIN interacts with human immunodeficiency virus type 1 Vif." Feng F., Davis A., Lake J.A., Carr J., Xia W., Burrell C., Li P. J. Virol. 78:10574-10581(2004) [PubMed: 15367624] [Abstract] Cited for: INTERACTION WITH HIV VIF PROTEIN (ISOFORM 3). |
| [9] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-35, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "The E3 ubiquitin ligase Triad3A negatively regulates the RIG-I/MAVS signaling pathway by targeting TRAF3 for degradation." Nakhaei P., Mesplede T., Solis M., Sun Q., Zhao T., Yang L., Chuang T.H., Ware C.F., Lin R., Hiscott J. PLoS Pathog. 5:E1000650-E1000650(2009) [PubMed: 19893624] [Abstract] Cited for: FUNCTION, INTERACTION WITH TRAF3. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY062174 mRNA. Translation: AAL38043.1. AF513717 mRNA. Translation: AAP47174.1. AF513718 mRNA. Translation: AAP47175.1. AY177396 mRNA. Translation: AAO60361.1. AY177397 mRNA. Translation: AAO60362.1. AY177398 mRNA. Translation: AAO60363.1. BX537406 mRNA. Translation: CAD97648.1. AC008167 Genomic DNA. Translation: AAS07532.1. BC000787 mRNA. Translation: AAH00787.2. BC063825 mRNA. Translation: AAH63825.1. AK000916 mRNA. Translation: BAA91422.1. Different initiation. AF228527 mRNA. Translation: AAF36723.1. |
| IPI | IPI00375632. IPI00410033. IPI00413022. |
| RefSeq | NP_996994.1. NM_207111.3. NP_996999.1. NM_207116.2. |
| UniGene | Hs.487458. Hs.689456. |
3D structure databases | |
| ProteinModelPortal | Q9NWF9. |
| SMR | Q9NWF9. Positions 512-568, 576-650, 667-711. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NWF9. 3 interactions. |
| MINT | MINT-1194402. |
| STRING | Q9NWF9. |
PTM databases | |
| PhosphoSite | Q9NWF9. |
Polymorphism databases | |
| DMDM | 57015417. |
Proteomic databases | |
| PRIDE | Q9NWF9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000425013; ENSP00000404602; ENSG00000011275. |
| GeneID | 54476. |
| KEGG | hsa:54476. |
| UCSC | uc003sox.1. human. uc003soy.1. human. |
Organism-specific databases | |
| CTD | 54476. |
| GeneCards | GC07M005661. |
| H-InvDB | HIX0006456. HIX0025299. |
| HGNC | HGNC:21698. RNF216. |
| HPA | HPA018955. HPA021123. |
| MIM | 609948. gene. |
| neXtProt | NX_Q9NWF9. |
| PharmGKB | PA162401829. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10173. |
| GeneTree | ENSGT00510000048032. |
| HOVERGEN | HBG102854. |
| OMA | GAQDDSE. |
| OrthoDB | EOG4VDPXT. |
Gene expression databases | |
| ArrayExpress | Q9NWF9. |
| Bgee | Q9NWF9. |
| CleanEx | HS_RNF216. |
| Genevestigator | Q9NWF9. |
| GermOnline | ENSG00000011275. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002867. Znf_C6HC. [Graphical view] |
| KO | K11976. |
| SMART | SM00647. IBR. 2 hits. [Graphical view] |
| PROSITE | PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 56786. |
| SOURCE | Search... |
Entry information
| Entry name | RN216_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NWF9 Secondary accession number(s): Q6Y691 Q9NYT1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with