Reviewed,
UniProtKB/Swiss-Prot Q9NWF9 (RN216_HUMAN)
Last modified
June 16, 2009.
Version 78.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase RNF216 EC=6.3.2.- Alternative name(s): RING finger protein 216 Ubiquitin-conjugating enzyme 7-interacting protein 1 Zinc finger protein inhibiting NF-kappa-B Triad domain-containing protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 866 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Isoform 1 acts as an E3 ubiquitin ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Promotes degradation of TLR4 amd TLR9. Isoform 3/ZIN inhibits TNF and IL-1 mediated activation of NF-kappa-B. Promotes TNF and RIP mediated apoptosis. Ref.2 |
| Pathway | |
| Subunit structure | Interacts with UBE2L3 and to some extent with UBE2L6. Interacts with TLR3, TLR4, TLR5 and TLR9. Isoform 3/ZIN binds RIPK1 and HIV VIF. Ref.2 Ref.1 Ref.8 |
| Subcellular location | |
| Tissue specificity | Ubiquitous, with the highest levels of expression in testis and peripheral blood leukocytes. |
| Domain | The RING-type zinc finger domain mediates binding to an E2 ubiquitin-conjugating enzyme By similarity. |
| Post-translational modification | Auto-ubiquitinated. |
| Sequence similarities | Contains 1 IBR-type zinc finger. Contains 2 RING-type zinc fingers. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis Host-virus interaction Ubl conjugation pathway |
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | Ligase |
| PTM | Phosphoprotein Ubl conjugation |
| Gene Ontology (GO) | |
| Biological process | apoptosis Inferred from electronic annotation. Source: UniProtKB-KW interspecies interaction between organismsInferred from electronic annotation. Source: UniProtKB-KW modification-dependent protein catabolic processInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from direct assay. Source: LIFEdb |
| Molecular function | ligase activity Inferred from electronic annotation. Source: UniProtKB-KW protein binding Ref.8Inferred from physical interaction. Source: IntAct zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| vif | P12504 | 2 | EBI-723337,EBI-779991 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NWF9-2) Also known as: TRIAD3A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NWF9-1) Also known as: TRIAD3B; The sequence of this isoform differs from the canonical sequence as follows: 67-67: E → ETNKPQRSRPNLIKPAAQWQDLKRLGEERPKKSRAAFESDKSSYFSVCNNPLFDSGAQ | ||||||
| Isoform 3 (identifier: Q9NWF9-3) Also known as: ZIN; TRIAD3; The sequence of this isoform differs from the canonical sequence as follows: 1-378: Missing. | ||||||
| Note: 4 different alternatively spliced mRNAs code for this protein isoform. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 866 | 866 | E3 ubiquitin-protein ligase RNF216 | PRO_0000056293 | |||||
Regions | |||||||||
| Zinc finger | 515 – 566 | 52 | RING-type 1 | ||||||
| Zinc finger | 583 – 648 | 66 | IBR-type | ||||||
| Zinc finger | 675 – 714 | 40 | RING-type 2 | ||||||
| Coiled coil | 475 – 491 | 17 | Potential | ||||||
| Coiled coil | 737 – 763 | 27 | Potential | ||||||
| Compositional bias | 769 – 862 | 94 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 35 | 1 | Phosphoserine Ref.9 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 378 | 378 | Missing in isoform 3. | VSP_012443 | |||||
| Alternative sequence | 67 | 1 | E → ETNKPQRSRPNLIKPAAQWQ DLKRLGEERPKKSRAAFESD KSSYFSVCNNPLFDSGAQ in isoform 2. | VSP_012444 | |||||
Experimental info | |||||||||
| Sequence conflict | 408 | 1 | L → F Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel zinc finger protein interacts with receptor-interacting protein (RIP) and inhibits tumor necrosis factor (TNF)- and IL1-induced NF-kappa B activation." Chen D., Li X., Zhai Z., Shu H.-B. J. Biol. Chem. 277:15985-15991(2002) [PubMed: 11854271] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH RIPK1. |
| [2] | "Triad3A, an E3 ubiquitin-protein ligase regulating Toll-like receptors." Chuang T.-H., Ulevitch R.J. Nat. Immunol. 5:495-502(2004) [PubMed: 15107846] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), FUNCTION, INTERACTION WITH TLR3; TLR4; TLR5 AND TLR9. Tissue: Placenta. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Blocker H., Heubner D., Hoerlein A., Michel G., Wedler H., Kohrer K., Ottenwalder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Endometrium. |
| [4] | "The DNA sequence of human chromosome 7." Hillier L.W., Fulton R.S., Fulton L.A., Graves T.A., Pepin K.H., Wagner-McPherson C., Layman D., Maas J., Jaeger S., Walker R., Wylie K., Sekhon M., Becker M.C., O'Laughlin M.D., Schaller M.E., Fewell G.A., Delehaunty K.D., Miner T.L. Wilson R.K.Nature 424:157-164(2003) [PubMed: 12853948] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney and Uterus. |
| [6] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 453-866 (ISOFORMS 1/2/3). Tissue: Embryo. |
| [7] | "Identification of a novel TRIAD protein, TRIAD3." van der Reijden B.A., Jansen J.H. Submitted (JAN-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 509-866 (ISOFORMS 1/2/3). |
| [8] | "Ring finger protein ZIN interacts with human immunodeficiency virus type 1 Vif." Feng F., Davis A., Lake J.A., Carr J., Xia W., Burrell C., Li P. J. Virol. 78:10574-10581(2004) [PubMed: 15367624] [Abstract] Cited for: INTERACTION WITH HIV VIF PROTEIN (ISOFORM 3). |
| [9] | "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra." Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D. J. Proteome Res. 6:4150-4162(2007) [PubMed: 17924679] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-35, MASS SPECTROMETRY. Tissue: Epithelium. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AY062174 mRNA. Translation: AAL38043.1. AF513717 mRNA. Translation: AAP47174.1. AF513718 mRNA. Translation: AAP47175.1. AY177396 mRNA. Translation: AAO60361.1. AY177397 mRNA. Translation: AAO60362.1. AY177398 mRNA. Translation: AAO60363.1. BX537406 mRNA. Translation: CAD97648.1. AC008167 Genomic DNA. Translation: AAS07532.1. BC000787 mRNA. Translation: AAH00787.2. BC063825 mRNA. Translation: AAH63825.1. AK000916 mRNA. Translation: BAA91422.1. Different initiation. AF228527 mRNA. Translation: AAF36723.1. | |
| IPI | IPI00375632. IPI00410033. IPI00413022. |
| RefSeq | NP_996994.1. NP_996999.1. |
| UniGene | Hs.487458 Hs.689456 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NWF9. 2 interactions. |
PTM databases | |
| PhosphoSite | Q9NWF9. |
Proteomic databases | |
| PRIDE | Q9NWF9. |
Genome annotation databases | |
| Ensembl | ENSG00000011275. Homo sapiens. [Contig view] |
| GeneID | 54476. |
| KEGG | hsa:54476. |
Organism-specific databases | |
| GeneCards | GC07M005627. |
| HGNC | HGNC:21698. RNF216. |
| HPA | HPA018955. |
| MIM | 609948. gene. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9NWF9. |
| OMA | Q9NWF9. QVVPQER. |
Gene expression databases | |
| ArrayExpress | Q9NWF9. |
| Bgee | Q9NWF9. |
| CleanEx | HS_RNF216. |
| GermOnline | ENSG00000011275. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002867. Znf_C6HC. IPR017907. Znf_RING_CS. [Graphical view] |
| SMART | SM00647. IBR. 2 hits. [Graphical view] |
| PROSITE | PS00518. ZF_RING_1. False negative. PS50089. ZF_RING_2. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 56786. |
| SOURCE | Search... |
Entry information
| Entry name | RN216_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NWF9 Secondary accession number(s): Q6Y691 Q9NYT1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with


