Q9NW68 (BSDC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 81.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: BSD domain-containing protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 430 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Contains 1 BSD domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NW68-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NW68-2) The sequence of this isoform differs from the canonical sequence as follows: 386-386: G → ETRSQFTVDFLWKISVTLLEPLGQSASPLFSNLPFPRLKHGHQ 387-430: Missing. | ||||||
| Isoform 3 (identifier: Q9NW68-3) The sequence of this isoform differs from the canonical sequence as follows: 63-63: A → AIAACSRGACFLCPFSIQ 421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR | ||||||
| Isoform 4 (identifier: Q9NW68-4) The sequence of this isoform differs from the canonical sequence as follows: 1-104: Missing. 421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR | ||||||
| Isoform 5 (identifier: Q9NW68-5) The sequence of this isoform differs from the canonical sequence as follows: 146-173: WLSQFCLEEKKGEISELLVGSPSIRALY → CQPELWAQILVAPCWPSWASAHTWEGAL 174-430: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 6 (identifier: Q9NW68-6) The sequence of this isoform differs from the canonical sequence as follows: 1-359: Missing. 360-385: EAPTDLRVFELNSDSGKSTPSNNGKK → MLSPQLHPLQVPLPCLLLLFTLWLVVP 421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 7 (identifier: Q9NW68-7) The sequence of this isoform differs from the canonical sequence as follows: 63-63: A → AIAACSRGACFLCPFSIQ | ||||||
| Isoform 8 (identifier: Q9NW68-8) The sequence of this isoform differs from the canonical sequence as follows: 64-120: TEGSSGATEKMKKGLSDFLGVISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKA → A | ||||||
| Isoform 9 (identifier: Q9NW68-9) The sequence of this isoform differs from the canonical sequence as follows: 25-119: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 430 | 430 | BSD domain-containing protein 1 | PRO_0000282639 | |||||
Regions | |||||||||
| Domain | 146 – 198 | 53 | BSD | ||||||
Amino acid modifications | |||||||||
| Modified residue | 92 | 1 | Phosphoserine Ref.8 | ||||||
| Modified residue | 418 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 359 | 359 | Missing in isoform 6. | VSP_024216 | |||||
| Alternative sequence | 1 – 104 | 104 | Missing in isoform 4. | VSP_024217 | |||||
| Alternative sequence | 25 – 119 | 95 | Missing in isoform 9. | VSP_041672 | |||||
| Alternative sequence | 63 | 1 | A → AIAACSRGACFLCPFSIQ in isoform 3 and isoform 7. | VSP_024218 | |||||
| Alternative sequence | 64 – 120 | 57 | TEGSS…DGTKA → A in isoform 8. | VSP_041673 | |||||
| Alternative sequence | 146 – 173 | 28 | WLSQF…IRALY → CQPELWAQILVAPCWPSWAS AHTWEGAL in isoform 5. | VSP_024219 | |||||
| Alternative sequence | 174 – 430 | 257 | Missing in isoform 5. | VSP_024220 | |||||
| Alternative sequence | 360 – 385 | 26 | EAPTD…NNGKK → MLSPQLHPLQVPLPCLLLLF TLWLVVP in isoform 6. | VSP_024221 | |||||
| Alternative sequence | 386 | 1 | G → ETRSQFTVDFLWKISVTLLE PLGQSASPLFSNLPFPRLKH GHQ in isoform 2. | VSP_024222 | |||||
| Alternative sequence | 387 – 430 | 44 | Missing in isoform 2. | VSP_024223 | |||||
| Alternative sequence | 421 – 430 | 10 | LEDVEWEDWE → VSGPGGSEGSEPNGPGCESS PQPAQLSPQEGPCSCLR in isoform 3, isoform 4 and isoform 6. | VSP_024224 | |||||
Experimental info | |||||||||
| Sequence conflict | 128 | 1 | D → G in CAH18084. Ref.4 | ||||||
| Sequence conflict | 137 | 1 | D → G in AAH26322. Ref.7 | ||||||
| Sequence conflict | 143 | 1 | F → L in BAB13825. Ref.2 | ||||||
| Sequence conflict | 149 | 1 | Q → K in AAH26322. Ref.7 | ||||||
| Sequence conflict | 250 | 1 | P → H in AAH26322. Ref.7 | ||||||
| Sequence conflict | 287 | 1 | T → A in AAH26322. Ref.7 | ||||||
| Sequence conflict | 430 | 1 | E → D in CAG33533. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| [1] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4; 5; 7; 8 AND 9). Tissue: Brain, Embryo, Placenta and Uterus. |
| [3] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. |
| [4] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4). Tissue: Prostate. |
| [5] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain. |
| [8] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-92 AND SER-418, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [10] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY358230 mRNA. Translation: AAQ88597.1. AK001138 mRNA. Translation: BAA91517.1. AK021440 mRNA. Translation: BAB13825.1. AK297604 mRNA. Translation: BAG59989.1. AK300231 mRNA. Translation: BAG61999.1. AK300306 mRNA. Translation: BAG62059.1. AK304477 mRNA. Translation: BAG65290.1. CR457252 mRNA. Translation: CAG33533.1. BX641056 mRNA. Translation: CAE46029.1. CR749228 mRNA. Translation: CAH18084.1. AL109945 Genomic DNA. Translation: CAI22889.1. AL109945 Genomic DNA. Translation: CAI22890.1. CH471059 Genomic DNA. Translation: EAX07526.1. BC026322 mRNA. Translation: AAH26322.1. BC028381 mRNA. Translation: AAH28381.1. |
| IPI | IPI00018026. IPI00414093. IPI00844452. IPI00844524. IPI00844527. IPI00844593. IPI00908918. IPI00909833. IPI00941916. |
| RefSeq | NP_001137360.1. NM_001143888.1. NP_001137361.1. NM_001143889.1. NP_001137362.1. NM_001143890.1. NP_060515.3. NM_018045.6. |
| UniGene | Hs.353454. |
3D structure databases | |
| ProteinModelPortal | Q9NW68. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9NW68. 3 interactions. |
| STRING | 9606.ENSP00000397759. |
PTM databases | |
| PhosphoSite | Q9NW68. |
Polymorphism databases | |
| DMDM | 74753009. |
Proteomic databases | |
| PaxDb | Q9NW68. |
| PRIDE | Q9NW68. |
Protocols and materials databases | |
| DNASU | 55108. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000341071; ENSP00000344816; ENSG00000160058. ENST00000419121; ENSP00000405752; ENSG00000160058. ENST00000444377; ENSP00000414103; ENSG00000160058. ENST00000446293; ENSP00000397759; ENSG00000160058. ENST00000455895; ENSP00000412173; ENSG00000160058. ENST00000526031; ENSP00000432382; ENSG00000160058. |
| GeneID | 55108. |
| KEGG | hsa:55108. |
| UCSC | uc001bvh.4. human. uc001bvi.3. human. uc001bvj.3. human. uc010ohg.2. human. uc010ohh.2. human. uc010ohi.2. human. |
Organism-specific databases | |
| CTD | 55108. |
| GeneCards | GC01M032831. |
| HGNC | HGNC:25501. BSDC1. |
| HPA | HPA031360. |
| neXtProt | NX_Q9NW68. |
| PharmGKB | PA142672548. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG249350. |
| HOVERGEN | HBG106482. |
| OMA | RVFELNS. |
| OrthoDB | EOG4RJG20. |
Gene expression databases | |
| ArrayExpress | Q9NW68. |
| Bgee | Q9NW68. |
| CleanEx | HS_BSDC1. |
| Genevestigator | Q9NW68. |
Family and domain databases | |
| InterPro | IPR005607. BSD. [Graphical view] |
| Pfam | PF03909. BSD. 1 hit. [Graphical view] |
| SMART | SM00751. BSD. 1 hit. [Graphical view] |
| PROSITE | PS50858. BSD. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BSDC1. human. |
| GenomeRNAi | 55108. |
| NextBio | 58721. |
Entry information
| Entry name | BSDC1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NW68 Secondary accession number(s): B4DMS7 Q9HAL9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with
