Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NW68

- BSDC1_HUMAN

UniProt

Q9NW68 - BSDC1_HUMAN

Protein

BSD domain-containing protein 1

Gene

BSDC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 92 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    BSD domain-containing protein 1
    Gene namesi
    Name:BSDC1
    ORF Names:UNQ2494/PRO5781
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:25501. BSDC1.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672548.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 430430BSD domain-containing protein 1PRO_0000282639Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei92 – 921Phosphoserine1 Publication
    Modified residuei418 – 4181Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9NW68.
    PaxDbiQ9NW68.
    PRIDEiQ9NW68.

    PTM databases

    PhosphoSiteiQ9NW68.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9NW68.
    BgeeiQ9NW68.
    CleanExiHS_BSDC1.
    GenevestigatoriQ9NW68.

    Organism-specific databases

    HPAiHPA031358.
    HPA031360.

    Interactioni

    Protein-protein interaction databases

    BioGridi120418. 4 interactions.
    IntActiQ9NW68. 5 interactions.
    MINTiMINT-8343011.
    STRINGi9606.ENSP00000397759.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NW68.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini146 – 19853BSDPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 BSD domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG249350.
    HOVERGENiHBG106482.
    OMAiEDVEWED.
    OrthoDBiEOG71G9V2.
    PhylomeDBiQ9NW68.
    TreeFamiTF313210.

    Family and domain databases

    InterProiIPR005607. BSD.
    [Graphical view]
    PfamiPF03909. BSD. 1 hit.
    [Graphical view]
    SMARTiSM00751. BSD. 1 hit.
    [Graphical view]
    PROSITEiPS50858. BSD. 1 hit.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NW68-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAEGEDVGWW RSWLQQSYQA VKEKSSEALE FMKRDLTEFT QVVQHDTACT    50
    IAATASVVKE KLATEGSSGA TEKMKKGLSD FLGVISDTFA PSPDKTIDCD 100
    VITLMGTPSG TAEPYDGTKA RLYSLQSDPA TYCNEPDGPP ELFDAWLSQF 150
    CLEEKKGEIS ELLVGSPSIR ALYTKMVPAA VSHSEFWHRY FYKVHQLEQE 200
    QARRDALKQR AEQSISEEPG WEEEEEELMG ISPISPKEAK VPVAKISTFP 250
    EGEPGPQSPC EENLVTSVEP PAEVTPSESS ESISLVTQIA NPATAPEARV 300
    LPKDLSQKLL EASLEEQGLA VDVGETGPSP PIHSKPLTPA GHTGGPEPRP 350
    PARVETLREE APTDLRVFEL NSDSGKSTPS NNGKKGSSTD ISEDWEKDFD 400
    LDMTEEEVQM ALSKVDASGE LEDVEWEDWE 430
    Length:430
    Mass (Da):47,163
    Last modified:October 1, 2000 - v1
    Checksum:i4031A3DC18A33646
    GO
    Isoform 2 (identifier: Q9NW68-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         386-386: G → ETRSQFTVDFLWKISVTLLEPLGQSASPLFSNLPFPRLKHGHQ
         387-430: Missing.

    Show »
    Length:428
    Mass (Da):46,860
    Checksum:iCAF6314F34758FBC
    GO
    Isoform 3 (identifier: Q9NW68-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-63: A → AIAACSRGACFLCPFSIQ
         421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

    Show »
    Length:474
    Mass (Da):51,167
    Checksum:iAE097F0DE5C2D6E4
    GO
    Isoform 4 (identifier: Q9NW68-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-104: Missing.
         421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

    Show »
    Length:353
    Mass (Da):37,994
    Checksum:i8E2AE07789DDEE97
    GO
    Isoform 5 (identifier: Q9NW68-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         146-173: WLSQFCLEEKKGEISELLVGSPSIRALY → CQPELWAQILVAPCWPSWASAHTWEGAL
         174-430: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:173
    Mass (Da):18,901
    Checksum:i56B1ADA0DEBEFC6F
    GO
    Isoform 6 (identifier: Q9NW68-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-359: Missing.
         360-385: EAPTDLRVFELNSDSGKSTPSNNGKK → MLSPQLHPLQVPLPCLLLLFTLWLVVP
         421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

    Note: No experimental confirmation available.

    Show »
    Length:99
    Mass (Da):10,525
    Checksum:i7676A2A4241391BC
    GO
    Isoform 7 (identifier: Q9NW68-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-63: A → AIAACSRGACFLCPFSIQ

    Show »
    Length:447
    Mass (Da):48,932
    Checksum:iA18E2B7A4B640F92
    GO
    Isoform 8 (identifier: Q9NW68-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         64-120: TEGSSGATEKMKKGLSDFLGVISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKA → A

    Show »
    Length:374
    Mass (Da):41,412
    Checksum:iB3126EBBE72FC029
    GO
    Isoform 9 (identifier: Q9NW68-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         25-119: Missing.

    Show »
    Length:335
    Mass (Da):37,160
    Checksum:iB95AAECFDBBF6B00
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti128 – 1281D → G in CAH18084. (PubMed:17974005)Curated
    Sequence conflicti137 – 1371D → G in AAH26322. (PubMed:15489334)Curated
    Sequence conflicti143 – 1431F → L in BAB13825. (PubMed:14702039)Curated
    Sequence conflicti149 – 1491Q → K in AAH26322. (PubMed:15489334)Curated
    Sequence conflicti250 – 2501P → H in AAH26322. (PubMed:15489334)Curated
    Sequence conflicti287 – 2871T → A in AAH26322. (PubMed:15489334)Curated
    Sequence conflicti430 – 4301E → D in CAG33533. 1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 359359Missing in isoform 6. 1 PublicationVSP_024216Add
    BLAST
    Alternative sequencei1 – 104104Missing in isoform 4. 2 PublicationsVSP_024217Add
    BLAST
    Alternative sequencei25 – 11995Missing in isoform 9. 1 PublicationVSP_041672Add
    BLAST
    Alternative sequencei63 – 631A → AIAACSRGACFLCPFSIQ in isoform 3 and isoform 7. 2 PublicationsVSP_024218
    Alternative sequencei64 – 12057TEGSS…DGTKA → A in isoform 8. 1 PublicationVSP_041673Add
    BLAST
    Alternative sequencei146 – 17328WLSQF…IRALY → CQPELWAQILVAPCWPSWAS AHTWEGAL in isoform 5. 1 PublicationVSP_024219Add
    BLAST
    Alternative sequencei174 – 430257Missing in isoform 5. 1 PublicationVSP_024220Add
    BLAST
    Alternative sequencei360 – 38526EAPTD…NNGKK → MLSPQLHPLQVPLPCLLLLF TLWLVVP in isoform 6. 1 PublicationVSP_024221Add
    BLAST
    Alternative sequencei386 – 3861G → ETRSQFTVDFLWKISVTLLE PLGQSASPLFSNLPFPRLKH GHQ in isoform 2. 1 PublicationVSP_024222
    Alternative sequencei387 – 43044Missing in isoform 2. 1 PublicationVSP_024223Add
    BLAST
    Alternative sequencei421 – 43010LEDVEWEDWE → VSGPGGSEGSEPNGPGCESS PQPAQLSPQEGPCSCLR in isoform 3, isoform 4 and isoform 6. 3 PublicationsVSP_024224

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358230 mRNA. Translation: AAQ88597.1.
    AK001138 mRNA. Translation: BAA91517.1.
    AK021440 mRNA. Translation: BAB13825.1.
    AK297604 mRNA. Translation: BAG59989.1.
    AK300231 mRNA. Translation: BAG61999.1.
    AK300306 mRNA. Translation: BAG62059.1.
    AK304477 mRNA. Translation: BAG65290.1.
    CR457252 mRNA. Translation: CAG33533.1.
    BX641056 mRNA. Translation: CAE46029.1.
    CR749228 mRNA. Translation: CAH18084.1.
    AL109945 Genomic DNA. Translation: CAI22889.1.
    AL109945 Genomic DNA. Translation: CAI22890.1.
    CH471059 Genomic DNA. Translation: EAX07526.1.
    BC026322 mRNA. Translation: AAH26322.1.
    BC028381 mRNA. Translation: AAH28381.1.
    CCDSiCCDS363.2. [Q9NW68-1]
    CCDS44101.1. [Q9NW68-9]
    CCDS44102.1. [Q9NW68-8]
    CCDS44103.1. [Q9NW68-7]
    RefSeqiNP_001137360.1. NM_001143888.1. [Q9NW68-7]
    NP_001137361.1. NM_001143889.1. [Q9NW68-8]
    NP_001137362.1. NM_001143890.1. [Q9NW68-9]
    NP_060515.3. NM_018045.6. [Q9NW68-1]
    XP_005271042.1. XM_005270985.1. [Q9NW68-3]
    UniGeneiHs.353454.

    Genome annotation databases

    EnsembliENST00000341071; ENSP00000344816; ENSG00000160058. [Q9NW68-3]
    ENST00000419121; ENSP00000405752; ENSG00000160058. [Q9NW68-8]
    ENST00000444377; ENSP00000414103; ENSG00000160058. [Q9NW68-2]
    ENST00000446293; ENSP00000397759; ENSG00000160058. [Q9NW68-7]
    ENST00000455895; ENSP00000412173; ENSG00000160058. [Q9NW68-1]
    ENST00000526031; ENSP00000432382; ENSG00000160058. [Q9NW68-9]
    GeneIDi55108.
    KEGGihsa:55108.
    UCSCiuc001bvh.4. human. [Q9NW68-1]
    uc001bvi.3. human. [Q9NW68-3]
    uc001bvj.3. human. [Q9NW68-4]
    uc010ohg.2. human. [Q9NW68-7]
    uc010ohh.2. human. [Q9NW68-8]
    uc010ohi.2. human. [Q9NW68-9]

    Polymorphism databases

    DMDMi74753009.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY358230 mRNA. Translation: AAQ88597.1 .
    AK001138 mRNA. Translation: BAA91517.1 .
    AK021440 mRNA. Translation: BAB13825.1 .
    AK297604 mRNA. Translation: BAG59989.1 .
    AK300231 mRNA. Translation: BAG61999.1 .
    AK300306 mRNA. Translation: BAG62059.1 .
    AK304477 mRNA. Translation: BAG65290.1 .
    CR457252 mRNA. Translation: CAG33533.1 .
    BX641056 mRNA. Translation: CAE46029.1 .
    CR749228 mRNA. Translation: CAH18084.1 .
    AL109945 Genomic DNA. Translation: CAI22889.1 .
    AL109945 Genomic DNA. Translation: CAI22890.1 .
    CH471059 Genomic DNA. Translation: EAX07526.1 .
    BC026322 mRNA. Translation: AAH26322.1 .
    BC028381 mRNA. Translation: AAH28381.1 .
    CCDSi CCDS363.2. [Q9NW68-1 ]
    CCDS44101.1. [Q9NW68-9 ]
    CCDS44102.1. [Q9NW68-8 ]
    CCDS44103.1. [Q9NW68-7 ]
    RefSeqi NP_001137360.1. NM_001143888.1. [Q9NW68-7 ]
    NP_001137361.1. NM_001143889.1. [Q9NW68-8 ]
    NP_001137362.1. NM_001143890.1. [Q9NW68-9 ]
    NP_060515.3. NM_018045.6. [Q9NW68-1 ]
    XP_005271042.1. XM_005270985.1. [Q9NW68-3 ]
    UniGenei Hs.353454.

    3D structure databases

    ProteinModelPortali Q9NW68.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120418. 4 interactions.
    IntActi Q9NW68. 5 interactions.
    MINTi MINT-8343011.
    STRINGi 9606.ENSP00000397759.

    PTM databases

    PhosphoSitei Q9NW68.

    Polymorphism databases

    DMDMi 74753009.

    Proteomic databases

    MaxQBi Q9NW68.
    PaxDbi Q9NW68.
    PRIDEi Q9NW68.

    Protocols and materials databases

    DNASUi 55108.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000341071 ; ENSP00000344816 ; ENSG00000160058 . [Q9NW68-3 ]
    ENST00000419121 ; ENSP00000405752 ; ENSG00000160058 . [Q9NW68-8 ]
    ENST00000444377 ; ENSP00000414103 ; ENSG00000160058 . [Q9NW68-2 ]
    ENST00000446293 ; ENSP00000397759 ; ENSG00000160058 . [Q9NW68-7 ]
    ENST00000455895 ; ENSP00000412173 ; ENSG00000160058 . [Q9NW68-1 ]
    ENST00000526031 ; ENSP00000432382 ; ENSG00000160058 . [Q9NW68-9 ]
    GeneIDi 55108.
    KEGGi hsa:55108.
    UCSCi uc001bvh.4. human. [Q9NW68-1 ]
    uc001bvi.3. human. [Q9NW68-3 ]
    uc001bvj.3. human. [Q9NW68-4 ]
    uc010ohg.2. human. [Q9NW68-7 ]
    uc010ohh.2. human. [Q9NW68-8 ]
    uc010ohi.2. human. [Q9NW68-9 ]

    Organism-specific databases

    CTDi 55108.
    GeneCardsi GC01M032833.
    HGNCi HGNC:25501. BSDC1.
    HPAi HPA031358.
    HPA031360.
    neXtProti NX_Q9NW68.
    PharmGKBi PA142672548.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG249350.
    HOVERGENi HBG106482.
    OMAi EDVEWED.
    OrthoDBi EOG71G9V2.
    PhylomeDBi Q9NW68.
    TreeFami TF313210.

    Miscellaneous databases

    ChiTaRSi BSDC1. human.
    GenomeRNAii 55108.
    NextBioi 58721.
    PROi Q9NW68.

    Gene expression databases

    ArrayExpressi Q9NW68.
    Bgeei Q9NW68.
    CleanExi HS_BSDC1.
    Genevestigatori Q9NW68.

    Family and domain databases

    InterProi IPR005607. BSD.
    [Graphical view ]
    Pfami PF03909. BSD. 1 hit.
    [Graphical view ]
    SMARTi SM00751. BSD. 1 hit.
    [Graphical view ]
    PROSITEi PS50858. BSD. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4; 5; 7; 8 AND 9).
      Tissue: Brain, Embryo, Placenta and Uterus.
    3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
      Tissue: Prostate.
    5. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-92 AND SER-418, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiBSDC1_HUMAN
    AccessioniPrimary (citable) accession number: Q9NW68
    Secondary accession number(s): B4DMS7
    , B4DTI7, B4DTP7, B4E2X8, Q49AT8, Q68DY6, Q6IAA3, Q6MZK1, Q6UXS1, Q9HAL9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 3, 2007
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 92 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3