SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NW68

- BSDC1_HUMAN

UniProt

Q9NW68 - BSDC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
BSD domain-containing protein 1
Gene
BSDC1, UNQ2494/PRO5781
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
BSD domain-containing protein 1
Gene namesi
Name:BSDC1
ORF Names:UNQ2494/PRO5781
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:25501. BSDC1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672548.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 430430BSD domain-containing protein 1
PRO_0000282639Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei92 – 921Phosphoserine1 Publication
Modified residuei418 – 4181Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9NW68.
PaxDbiQ9NW68.
PRIDEiQ9NW68.

PTM databases

PhosphoSiteiQ9NW68.

Expressioni

Gene expression databases

ArrayExpressiQ9NW68.
BgeeiQ9NW68.
CleanExiHS_BSDC1.
GenevestigatoriQ9NW68.

Organism-specific databases

HPAiHPA031358.
HPA031360.

Interactioni

Protein-protein interaction databases

BioGridi120418. 4 interactions.
IntActiQ9NW68. 5 interactions.
MINTiMINT-8343011.
STRINGi9606.ENSP00000397759.

Structurei

3D structure databases

ProteinModelPortaliQ9NW68.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini146 – 19853BSD
Add
BLAST

Sequence similaritiesi

Contains 1 BSD domain.

Phylogenomic databases

eggNOGiNOG249350.
HOVERGENiHBG106482.
OMAiEDVEWED.
OrthoDBiEOG71G9V2.
PhylomeDBiQ9NW68.
TreeFamiTF313210.

Family and domain databases

InterProiIPR005607. BSD.
[Graphical view]
PfamiPF03909. BSD. 1 hit.
[Graphical view]
SMARTiSM00751. BSD. 1 hit.
[Graphical view]
PROSITEiPS50858. BSD. 1 hit.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NW68-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAEGEDVGWW RSWLQQSYQA VKEKSSEALE FMKRDLTEFT QVVQHDTACT    50
IAATASVVKE KLATEGSSGA TEKMKKGLSD FLGVISDTFA PSPDKTIDCD 100
VITLMGTPSG TAEPYDGTKA RLYSLQSDPA TYCNEPDGPP ELFDAWLSQF 150
CLEEKKGEIS ELLVGSPSIR ALYTKMVPAA VSHSEFWHRY FYKVHQLEQE 200
QARRDALKQR AEQSISEEPG WEEEEEELMG ISPISPKEAK VPVAKISTFP 250
EGEPGPQSPC EENLVTSVEP PAEVTPSESS ESISLVTQIA NPATAPEARV 300
LPKDLSQKLL EASLEEQGLA VDVGETGPSP PIHSKPLTPA GHTGGPEPRP 350
PARVETLREE APTDLRVFEL NSDSGKSTPS NNGKKGSSTD ISEDWEKDFD 400
LDMTEEEVQM ALSKVDASGE LEDVEWEDWE 430
Length:430
Mass (Da):47,163
Last modified:October 1, 2000 - v1
Checksum:i4031A3DC18A33646
GO
Isoform 2 (identifier: Q9NW68-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     386-386: G → ETRSQFTVDFLWKISVTLLEPLGQSASPLFSNLPFPRLKHGHQ
     387-430: Missing.

Show »
Length:428
Mass (Da):46,860
Checksum:iCAF6314F34758FBC
GO
Isoform 3 (identifier: Q9NW68-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: A → AIAACSRGACFLCPFSIQ
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

Show »
Length:474
Mass (Da):51,167
Checksum:iAE097F0DE5C2D6E4
GO
Isoform 4 (identifier: Q9NW68-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

Show »
Length:353
Mass (Da):37,994
Checksum:i8E2AE07789DDEE97
GO
Isoform 5 (identifier: Q9NW68-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     146-173: WLSQFCLEEKKGEISELLVGSPSIRALY → CQPELWAQILVAPCWPSWASAHTWEGAL
     174-430: Missing.

Note: No experimental confirmation available.

Show »
Length:173
Mass (Da):18,901
Checksum:i56B1ADA0DEBEFC6F
GO
Isoform 6 (identifier: Q9NW68-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.
     360-385: EAPTDLRVFELNSDSGKSTPSNNGKK → MLSPQLHPLQVPLPCLLLLFTLWLVVP
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR

Note: No experimental confirmation available.

Show »
Length:99
Mass (Da):10,525
Checksum:i7676A2A4241391BC
GO
Isoform 7 (identifier: Q9NW68-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: A → AIAACSRGACFLCPFSIQ

Show »
Length:447
Mass (Da):48,932
Checksum:iA18E2B7A4B640F92
GO
Isoform 8 (identifier: Q9NW68-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     64-120: TEGSSGATEKMKKGLSDFLGVISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKA → A

Show »
Length:374
Mass (Da):41,412
Checksum:iB3126EBBE72FC029
GO
Isoform 9 (identifier: Q9NW68-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-119: Missing.

Show »
Length:335
Mass (Da):37,160
Checksum:iB95AAECFDBBF6B00
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 359359Missing in isoform 6.
VSP_024216Add
BLAST
Alternative sequencei1 – 104104Missing in isoform 4.
VSP_024217Add
BLAST
Alternative sequencei25 – 11995Missing in isoform 9.
VSP_041672Add
BLAST
Alternative sequencei63 – 631A → AIAACSRGACFLCPFSIQ in isoform 3 and isoform 7.
VSP_024218
Alternative sequencei64 – 12057TEGSS…DGTKA → A in isoform 8.
VSP_041673Add
BLAST
Alternative sequencei146 – 17328WLSQF…IRALY → CQPELWAQILVAPCWPSWAS AHTWEGAL in isoform 5.
VSP_024219Add
BLAST
Alternative sequencei174 – 430257Missing in isoform 5.
VSP_024220Add
BLAST
Alternative sequencei360 – 38526EAPTD…NNGKK → MLSPQLHPLQVPLPCLLLLF TLWLVVP in isoform 6.
VSP_024221Add
BLAST
Alternative sequencei386 – 3861G → ETRSQFTVDFLWKISVTLLE PLGQSASPLFSNLPFPRLKH GHQ in isoform 2.
VSP_024222
Alternative sequencei387 – 43044Missing in isoform 2.
VSP_024223Add
BLAST
Alternative sequencei421 – 43010LEDVEWEDWE → VSGPGGSEGSEPNGPGCESS PQPAQLSPQEGPCSCLR in isoform 3, isoform 4 and isoform 6.
VSP_024224

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti128 – 1281D → G in CAH18084. 1 Publication
Sequence conflicti137 – 1371D → G in AAH26322. 1 Publication
Sequence conflicti143 – 1431F → L in BAB13825. 1 Publication
Sequence conflicti149 – 1491Q → K in AAH26322. 1 Publication
Sequence conflicti250 – 2501P → H in AAH26322. 1 Publication
Sequence conflicti287 – 2871T → A in AAH26322. 1 Publication
Sequence conflicti430 – 4301E → D in CAG33533. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358230 mRNA. Translation: AAQ88597.1.
AK001138 mRNA. Translation: BAA91517.1.
AK021440 mRNA. Translation: BAB13825.1.
AK297604 mRNA. Translation: BAG59989.1.
AK300231 mRNA. Translation: BAG61999.1.
AK300306 mRNA. Translation: BAG62059.1.
AK304477 mRNA. Translation: BAG65290.1.
CR457252 mRNA. Translation: CAG33533.1.
BX641056 mRNA. Translation: CAE46029.1.
CR749228 mRNA. Translation: CAH18084.1.
AL109945 Genomic DNA. Translation: CAI22889.1.
AL109945 Genomic DNA. Translation: CAI22890.1.
CH471059 Genomic DNA. Translation: EAX07526.1.
BC026322 mRNA. Translation: AAH26322.1.
BC028381 mRNA. Translation: AAH28381.1.
CCDSiCCDS363.2. [Q9NW68-1]
CCDS44101.1. [Q9NW68-9]
CCDS44102.1. [Q9NW68-8]
CCDS44103.1. [Q9NW68-7]
RefSeqiNP_001137360.1. NM_001143888.1. [Q9NW68-7]
NP_001137361.1. NM_001143889.1. [Q9NW68-8]
NP_001137362.1. NM_001143890.1. [Q9NW68-9]
NP_060515.3. NM_018045.6. [Q9NW68-1]
XP_005271042.1. XM_005270985.1. [Q9NW68-3]
UniGeneiHs.353454.

Genome annotation databases

EnsembliENST00000341071; ENSP00000344816; ENSG00000160058. [Q9NW68-3]
ENST00000419121; ENSP00000405752; ENSG00000160058. [Q9NW68-8]
ENST00000444377; ENSP00000414103; ENSG00000160058. [Q9NW68-2]
ENST00000446293; ENSP00000397759; ENSG00000160058. [Q9NW68-7]
ENST00000455895; ENSP00000412173; ENSG00000160058. [Q9NW68-1]
ENST00000526031; ENSP00000432382; ENSG00000160058. [Q9NW68-9]
GeneIDi55108.
KEGGihsa:55108.
UCSCiuc001bvh.4. human. [Q9NW68-1]
uc001bvi.3. human. [Q9NW68-3]
uc001bvj.3. human. [Q9NW68-4]
uc010ohg.2. human. [Q9NW68-7]
uc010ohh.2. human. [Q9NW68-8]
uc010ohi.2. human. [Q9NW68-9]

Polymorphism databases

DMDMi74753009.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY358230 mRNA. Translation: AAQ88597.1 .
AK001138 mRNA. Translation: BAA91517.1 .
AK021440 mRNA. Translation: BAB13825.1 .
AK297604 mRNA. Translation: BAG59989.1 .
AK300231 mRNA. Translation: BAG61999.1 .
AK300306 mRNA. Translation: BAG62059.1 .
AK304477 mRNA. Translation: BAG65290.1 .
CR457252 mRNA. Translation: CAG33533.1 .
BX641056 mRNA. Translation: CAE46029.1 .
CR749228 mRNA. Translation: CAH18084.1 .
AL109945 Genomic DNA. Translation: CAI22889.1 .
AL109945 Genomic DNA. Translation: CAI22890.1 .
CH471059 Genomic DNA. Translation: EAX07526.1 .
BC026322 mRNA. Translation: AAH26322.1 .
BC028381 mRNA. Translation: AAH28381.1 .
CCDSi CCDS363.2. [Q9NW68-1 ]
CCDS44101.1. [Q9NW68-9 ]
CCDS44102.1. [Q9NW68-8 ]
CCDS44103.1. [Q9NW68-7 ]
RefSeqi NP_001137360.1. NM_001143888.1. [Q9NW68-7 ]
NP_001137361.1. NM_001143889.1. [Q9NW68-8 ]
NP_001137362.1. NM_001143890.1. [Q9NW68-9 ]
NP_060515.3. NM_018045.6. [Q9NW68-1 ]
XP_005271042.1. XM_005270985.1. [Q9NW68-3 ]
UniGenei Hs.353454.

3D structure databases

ProteinModelPortali Q9NW68.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120418. 4 interactions.
IntActi Q9NW68. 5 interactions.
MINTi MINT-8343011.
STRINGi 9606.ENSP00000397759.

PTM databases

PhosphoSitei Q9NW68.

Polymorphism databases

DMDMi 74753009.

Proteomic databases

MaxQBi Q9NW68.
PaxDbi Q9NW68.
PRIDEi Q9NW68.

Protocols and materials databases

DNASUi 55108.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000341071 ; ENSP00000344816 ; ENSG00000160058 . [Q9NW68-3 ]
ENST00000419121 ; ENSP00000405752 ; ENSG00000160058 . [Q9NW68-8 ]
ENST00000444377 ; ENSP00000414103 ; ENSG00000160058 . [Q9NW68-2 ]
ENST00000446293 ; ENSP00000397759 ; ENSG00000160058 . [Q9NW68-7 ]
ENST00000455895 ; ENSP00000412173 ; ENSG00000160058 . [Q9NW68-1 ]
ENST00000526031 ; ENSP00000432382 ; ENSG00000160058 . [Q9NW68-9 ]
GeneIDi 55108.
KEGGi hsa:55108.
UCSCi uc001bvh.4. human. [Q9NW68-1 ]
uc001bvi.3. human. [Q9NW68-3 ]
uc001bvj.3. human. [Q9NW68-4 ]
uc010ohg.2. human. [Q9NW68-7 ]
uc010ohh.2. human. [Q9NW68-8 ]
uc010ohi.2. human. [Q9NW68-9 ]

Organism-specific databases

CTDi 55108.
GeneCardsi GC01M032833.
HGNCi HGNC:25501. BSDC1.
HPAi HPA031358.
HPA031360.
neXtProti NX_Q9NW68.
PharmGKBi PA142672548.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG249350.
HOVERGENi HBG106482.
OMAi EDVEWED.
OrthoDBi EOG71G9V2.
PhylomeDBi Q9NW68.
TreeFami TF313210.

Miscellaneous databases

ChiTaRSi BSDC1. human.
GenomeRNAii 55108.
NextBioi 58721.
PROi Q9NW68.

Gene expression databases

ArrayExpressi Q9NW68.
Bgeei Q9NW68.
CleanExi HS_BSDC1.
Genevestigatori Q9NW68.

Family and domain databases

InterProi IPR005607. BSD.
[Graphical view ]
Pfami PF03909. BSD. 1 hit.
[Graphical view ]
SMARTi SM00751. BSD. 1 hit.
[Graphical view ]
PROSITEi PS50858. BSD. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4; 5; 7; 8 AND 9).
    Tissue: Brain, Embryo, Placenta and Uterus.
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Prostate.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-92 AND SER-418, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiBSDC1_HUMAN
AccessioniPrimary (citable) accession number: Q9NW68
Secondary accession number(s): B4DMS7
, B4DTI7, B4DTP7, B4E2X8, Q49AT8, Q68DY6, Q6IAA3, Q6MZK1, Q6UXS1, Q9HAL9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi