Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NW68 (BSDC1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 91. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
BSD domain-containing protein 1
Gene names
Name:BSDC1
ORF Names:UNQ2494/PRO5781
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length430 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Contains 1 BSD domain.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NW68-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NW68-2)

The sequence of this isoform differs from the canonical sequence as follows:
     386-386: G → ETRSQFTVDFLWKISVTLLEPLGQSASPLFSNLPFPRLKHGHQ
     387-430: Missing.
Isoform 3 (identifier: Q9NW68-3)

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: A → AIAACSRGACFLCPFSIQ
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR
Isoform 4 (identifier: Q9NW68-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR
Isoform 5 (identifier: Q9NW68-5)

The sequence of this isoform differs from the canonical sequence as follows:
     146-173: WLSQFCLEEKKGEISELLVGSPSIRALY → CQPELWAQILVAPCWPSWASAHTWEGAL
     174-430: Missing.
Note: No experimental confirmation available.
Isoform 6 (identifier: Q9NW68-6)

The sequence of this isoform differs from the canonical sequence as follows:
     1-359: Missing.
     360-385: EAPTDLRVFELNSDSGKSTPSNNGKK → MLSPQLHPLQVPLPCLLLLFTLWLVVP
     421-430: LEDVEWEDWE → VSGPGGSEGSEPNGPGCESSPQPAQLSPQEGPCSCLR
Note: No experimental confirmation available.
Isoform 7 (identifier: Q9NW68-7)

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: A → AIAACSRGACFLCPFSIQ
Isoform 8 (identifier: Q9NW68-8)

The sequence of this isoform differs from the canonical sequence as follows:
     64-120: TEGSSGATEKMKKGLSDFLGVISDTFAPSPDKTIDCDVITLMGTPSGTAEPYDGTKA → A
Isoform 9 (identifier: Q9NW68-9)

The sequence of this isoform differs from the canonical sequence as follows:
     25-119: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 430430BSD domain-containing protein 1
PRO_0000282639

Regions

Domain146 – 19853BSD

Amino acid modifications

Modified residue921Phosphoserine Ref.8
Modified residue4181Phosphoserine Ref.8

Natural variations

Alternative sequence1 – 359359Missing in isoform 6.
VSP_024216
Alternative sequence1 – 104104Missing in isoform 4.
VSP_024217
Alternative sequence25 – 11995Missing in isoform 9.
VSP_041672
Alternative sequence631A → AIAACSRGACFLCPFSIQ in isoform 3 and isoform 7.
VSP_024218
Alternative sequence64 – 12057TEGSS…DGTKA → A in isoform 8.
VSP_041673
Alternative sequence146 – 17328WLSQF…IRALY → CQPELWAQILVAPCWPSWAS AHTWEGAL in isoform 5.
VSP_024219
Alternative sequence174 – 430257Missing in isoform 5.
VSP_024220
Alternative sequence360 – 38526EAPTD…NNGKK → MLSPQLHPLQVPLPCLLLLF TLWLVVP in isoform 6.
VSP_024221
Alternative sequence3861G → ETRSQFTVDFLWKISVTLLE PLGQSASPLFSNLPFPRLKH GHQ in isoform 2.
VSP_024222
Alternative sequence387 – 43044Missing in isoform 2.
VSP_024223
Alternative sequence421 – 43010LEDVEWEDWE → VSGPGGSEGSEPNGPGCESS PQPAQLSPQEGPCSCLR in isoform 3, isoform 4 and isoform 6.
VSP_024224

Experimental info

Sequence conflict1281D → G in CAH18084. Ref.4
Sequence conflict1371D → G in AAH26322. Ref.7
Sequence conflict1431F → L in BAB13825. Ref.2
Sequence conflict1491Q → K in AAH26322. Ref.7
Sequence conflict2501P → H in AAH26322. Ref.7
Sequence conflict2871T → A in AAH26322. Ref.7
Sequence conflict4301E → D in CAG33533. Ref.3

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: 4031A3DC18A33646

FASTA43047,163
        10         20         30         40         50         60 
MAEGEDVGWW RSWLQQSYQA VKEKSSEALE FMKRDLTEFT QVVQHDTACT IAATASVVKE 

        70         80         90        100        110        120 
KLATEGSSGA TEKMKKGLSD FLGVISDTFA PSPDKTIDCD VITLMGTPSG TAEPYDGTKA 

       130        140        150        160        170        180 
RLYSLQSDPA TYCNEPDGPP ELFDAWLSQF CLEEKKGEIS ELLVGSPSIR ALYTKMVPAA 

       190        200        210        220        230        240 
VSHSEFWHRY FYKVHQLEQE QARRDALKQR AEQSISEEPG WEEEEEELMG ISPISPKEAK 

       250        260        270        280        290        300 
VPVAKISTFP EGEPGPQSPC EENLVTSVEP PAEVTPSESS ESISLVTQIA NPATAPEARV 

       310        320        330        340        350        360 
LPKDLSQKLL EASLEEQGLA VDVGETGPSP PIHSKPLTPA GHTGGPEPRP PARVETLREE 

       370        380        390        400        410        420 
APTDLRVFEL NSDSGKSTPS NNGKKGSSTD ISEDWEKDFD LDMTEEEVQM ALSKVDASGE 

       430 
LEDVEWEDWE 

« Hide

Isoform 2 [UniParc].

Checksum: CAF6314F34758FBC
Show »

FASTA42846,860
Isoform 3 [UniParc].

Checksum: AE097F0DE5C2D6E4
Show »

FASTA47451,167
Isoform 4 [UniParc].

Checksum: 8E2AE07789DDEE97
Show »

FASTA35337,994
Isoform 5 [UniParc].

Checksum: 56B1ADA0DEBEFC6F
Show »

FASTA17318,901
Isoform 6 [UniParc].

Checksum: 7676A2A4241391BC
Show »

FASTA9910,525
Isoform 7 [UniParc].

Checksum: A18E2B7A4B640F92
Show »

FASTA44748,932
Isoform 8 [UniParc].

Checksum: B3126EBBE72FC029
Show »

FASTA37441,412
Isoform 9 [UniParc].

Checksum: B95AAECFDBBF6B00
Show »

FASTA33537,160

References

[1]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 4; 5; 7; 8 AND 9).
Tissue: Brain, Embryo, Placenta and Uterus.
[3]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
Tissue: Prostate.
[5]"The DNA sequence and biological annotation of human chromosome 1."
Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. expand/collapse author list , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Brain.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-92 AND SER-418, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[10]"System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY358230 mRNA. Translation: AAQ88597.1.
AK001138 mRNA. Translation: BAA91517.1.
AK021440 mRNA. Translation: BAB13825.1.
AK297604 mRNA. Translation: BAG59989.1.
AK300231 mRNA. Translation: BAG61999.1.
AK300306 mRNA. Translation: BAG62059.1.
AK304477 mRNA. Translation: BAG65290.1.
CR457252 mRNA. Translation: CAG33533.1.
BX641056 mRNA. Translation: CAE46029.1.
CR749228 mRNA. Translation: CAH18084.1.
AL109945 Genomic DNA. Translation: CAI22889.1.
AL109945 Genomic DNA. Translation: CAI22890.1.
CH471059 Genomic DNA. Translation: EAX07526.1.
BC026322 mRNA. Translation: AAH26322.1.
BC028381 mRNA. Translation: AAH28381.1.
CCDSCCDS363.2. [Q9NW68-1]
CCDS44101.1. [Q9NW68-9]
CCDS44102.1. [Q9NW68-8]
CCDS44103.1. [Q9NW68-7]
RefSeqNP_001137360.1. NM_001143888.1. [Q9NW68-7]
NP_001137361.1. NM_001143889.1. [Q9NW68-8]
NP_001137362.1. NM_001143890.1. [Q9NW68-9]
NP_060515.3. NM_018045.6. [Q9NW68-1]
XP_005271042.1. XM_005270985.1. [Q9NW68-3]
UniGeneHs.353454.

3D structure databases

ProteinModelPortalQ9NW68.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120418. 4 interactions.
IntActQ9NW68. 5 interactions.
MINTMINT-8343011.
STRING9606.ENSP00000397759.

PTM databases

PhosphoSiteQ9NW68.

Polymorphism databases

DMDM74753009.

Proteomic databases

MaxQBQ9NW68.
PaxDbQ9NW68.
PRIDEQ9NW68.

Protocols and materials databases

DNASU55108.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000341071; ENSP00000344816; ENSG00000160058. [Q9NW68-3]
ENST00000419121; ENSP00000405752; ENSG00000160058. [Q9NW68-8]
ENST00000444377; ENSP00000414103; ENSG00000160058. [Q9NW68-2]
ENST00000446293; ENSP00000397759; ENSG00000160058. [Q9NW68-7]
ENST00000455895; ENSP00000412173; ENSG00000160058. [Q9NW68-1]
ENST00000526031; ENSP00000432382; ENSG00000160058. [Q9NW68-9]
GeneID55108.
KEGGhsa:55108.
UCSCuc001bvh.4. human. [Q9NW68-1]
uc001bvi.3. human. [Q9NW68-3]
uc001bvj.3. human. [Q9NW68-4]
uc010ohg.2. human. [Q9NW68-7]
uc010ohh.2. human. [Q9NW68-8]
uc010ohi.2. human. [Q9NW68-9]

Organism-specific databases

CTD55108.
GeneCardsGC01M032833.
HGNCHGNC:25501. BSDC1.
HPAHPA031358.
HPA031360.
neXtProtNX_Q9NW68.
PharmGKBPA142672548.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG249350.
HOVERGENHBG106482.
OMAEDVEWED.
OrthoDBEOG71G9V2.
PhylomeDBQ9NW68.
TreeFamTF313210.

Gene expression databases

ArrayExpressQ9NW68.
BgeeQ9NW68.
CleanExHS_BSDC1.
GenevestigatorQ9NW68.

Family and domain databases

InterProIPR005607. BSD.
[Graphical view]
PfamPF03909. BSD. 1 hit.
[Graphical view]
SMARTSM00751. BSD. 1 hit.
[Graphical view]
PROSITEPS50858. BSD. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSBSDC1. human.
GenomeRNAi55108.
NextBio58721.
PROQ9NW68.

Entry information

Entry nameBSDC1_HUMAN
AccessionPrimary (citable) accession number: Q9NW68
Secondary accession number(s): B4DMS7 expand/collapse secondary AC list , B4DTI7, B4DTP7, B4E2X8, Q49AT8, Q68DY6, Q6IAA3, Q6MZK1, Q6UXS1, Q9HAL9
Entry history
Integrated into UniProtKB/Swiss-Prot: April 3, 2007
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 91 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 1

Human chromosome 1: entries, gene names and cross-references to MIM