Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9NVS2

- RT18A_HUMAN

UniProt

Q9NVS2 - RT18A_HUMAN

Protein

28S ribosomal protein S18a, mitochondrial

Gene

MRPS18A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 111 (01 Oct 2014)
      Sequence version 1 (01 Oct 2000)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. structural constituent of ribosome Source: UniProtKB

    GO - Biological processi

    1. translation Source: UniProtKB

    Keywords - Molecular functioni

    Ribonucleoprotein, Ribosomal protein

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    28S ribosomal protein S18a, mitochondrial
    Short name:
    MRP-S18-a
    Short name:
    Mrps18a
    Short name:
    S18mt-a
    Alternative name(s):
    28S ribosomal protein S18-3, mitochondrial
    Short name:
    MRP-S18-3
    Gene namesi
    Name:MRPS18A
    OrganismiHomo sapiens (Human)Imported
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:14515. MRPS18A.

    Subcellular locationi

    Mitochondrion 1 Publication

    GO - Cellular componenti

    1. mitochondrial small ribosomal subunit Source: UniProtKB

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA31003.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transit peptidei1 – 3434MitochondrionBy similarityAdd
    BLAST
    Chaini35 – 19616228S ribosomal protein S18a, mitochondrialPRO_0000030625Add
    BLAST

    Proteomic databases

    MaxQBiQ9NVS2.
    PaxDbiQ9NVS2.
    PRIDEiQ9NVS2.

    PTM databases

    PhosphoSiteiQ9NVS2.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9NVS2.
    BgeeiQ9NVS2.
    CleanExiHS_MRPS18A.
    GenevestigatoriQ9NVS2.

    Organism-specific databases

    HPAiHPA035450.
    HPA035451.

    Interactioni

    Subunit structurei

    Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

    Protein-protein interaction databases

    BioGridi120468. 3 interactions.
    IntActiQ9NVS2. 1 interaction.
    MINTiMINT-3075179.
    STRINGi9606.ENSP00000361206.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9NVS2.
    SMRiQ9NVS2. Positions 84-131.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the ribosomal protein S18P family.By similarity

    Keywords - Domaini

    Transit peptide

    Phylogenomic databases

    eggNOGiNOG249629.
    HOGENOMiHOG000139370.
    HOVERGENiHBG058800.
    KOiK02963.
    OrthoDBiEOG70089X.
    PhylomeDBiQ9NVS2.
    TreeFamiTF315738.

    Family and domain databases

    Gene3Di4.10.640.10. 1 hit.
    InterProiIPR001648. Ribosomal_S18.
    [Graphical view]
    PfamiPF01084. Ribosomal_S18. 1 hit.
    [Graphical view]
    ProDomiPD002239. Ribosomal_S18. 1 hit.
    [Graphical view] [Entries sharing at least one domain]
    SUPFAMiSSF46911. SSF46911. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9NVS2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAALKALVSG CGRLLRGLLA GPAATSWSRL PARGFREVVE TQEGKTTIIE    50
    GRITATPKES PNPPNPSGQC PICRWNLKHK YNYDDVLLLS QFIRPHGGML 100
    PRKITGLCQE EHRKIEECVK MAHRAGLLPN HRPRLPEGVV PKSKPQLNRY 150
    LTRWAPGSVK PIYKKGPRWN RVRMPVGSPL LRDNVCYSRT PWKLYH 196
    Length:196
    Mass (Da):22,184
    Last modified:October 1, 2000 - v1
    Checksum:iCC086B8FC27242D6
    GO
    Isoform 2 (identifier: Q9NVS2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         125-125: A → AGRRPWGPRG...QRLSPLPRHS

    Show »
    Length:270
    Mass (Da):30,540
    Checksum:i2EEB47D86FC277F0
    GO
    Isoform 3 (identifier: Q9NVS2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         127-196: LLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH → T

    Note: No experimental confirmation available.

    Show »
    Length:127
    Mass (Da):14,030
    Checksum:iC5BA5F97CADB7D87
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei125 – 1251A → AGRRPWGPRGAEGCRHSLPT QLPHVSAPPGRKVDIRSVNY THHPMPTFPLPWAFPLAPSE LQRELQRLSPLPRHS in isoform 2. 1 PublicationVSP_041245
    Alternative sequencei127 – 19670LLPNH…WKLYH → T in isoform 3. 1 PublicationVSP_043496Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB049952 mRNA. Translation: BAB41005.1.
    DQ884400 mRNA. Translation: ABI63367.1.
    AK001410 mRNA. Translation: BAA91675.1.
    AK300757 mRNA. Translation: BAG62423.1.
    AL136131 Genomic DNA. Translation: CAC19510.1.
    AL136131 Genomic DNA. Translation: CAI19964.1.
    CH471081 Genomic DNA. Translation: EAX04225.1.
    BC010364 mRNA. Translation: AAH10364.1.
    CCDSiCCDS4906.1. [Q9NVS2-1]
    CCDS55006.1. [Q9NVS2-3]
    RefSeqiNP_001180272.1. NM_001193343.1. [Q9NVS2-3]
    NP_060605.1. NM_018135.3. [Q9NVS2-1]
    XP_006715197.1. XM_006715134.1. [Q9NVS2-2]
    UniGeneiHs.520149.

    Genome annotation databases

    EnsembliENST00000372116; ENSP00000361188; ENSG00000096080. [Q9NVS2-3]
    ENST00000372133; ENSP00000361206; ENSG00000096080. [Q9NVS2-1]
    GeneIDi55168.
    KEGGihsa:55168.
    UCSCiuc003ovy.2. human. [Q9NVS2-1]
    uc003ovz.2. human. [Q9NVS2-3]
    uc003owa.2. human. [Q9NVS2-2]

    Polymorphism databases

    DMDMi24212201.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB049952 mRNA. Translation: BAB41005.1 .
    DQ884400 mRNA. Translation: ABI63367.1 .
    AK001410 mRNA. Translation: BAA91675.1 .
    AK300757 mRNA. Translation: BAG62423.1 .
    AL136131 Genomic DNA. Translation: CAC19510.1 .
    AL136131 Genomic DNA. Translation: CAI19964.1 .
    CH471081 Genomic DNA. Translation: EAX04225.1 .
    BC010364 mRNA. Translation: AAH10364.1 .
    CCDSi CCDS4906.1. [Q9NVS2-1 ]
    CCDS55006.1. [Q9NVS2-3 ]
    RefSeqi NP_001180272.1. NM_001193343.1. [Q9NVS2-3 ]
    NP_060605.1. NM_018135.3. [Q9NVS2-1 ]
    XP_006715197.1. XM_006715134.1. [Q9NVS2-2 ]
    UniGenei Hs.520149.

    3D structure databases

    ProteinModelPortali Q9NVS2.
    SMRi Q9NVS2. Positions 84-131.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120468. 3 interactions.
    IntActi Q9NVS2. 1 interaction.
    MINTi MINT-3075179.
    STRINGi 9606.ENSP00000361206.

    PTM databases

    PhosphoSitei Q9NVS2.

    Polymorphism databases

    DMDMi 24212201.

    Proteomic databases

    MaxQBi Q9NVS2.
    PaxDbi Q9NVS2.
    PRIDEi Q9NVS2.

    Protocols and materials databases

    DNASUi 55168.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372116 ; ENSP00000361188 ; ENSG00000096080 . [Q9NVS2-3 ]
    ENST00000372133 ; ENSP00000361206 ; ENSG00000096080 . [Q9NVS2-1 ]
    GeneIDi 55168.
    KEGGi hsa:55168.
    UCSCi uc003ovy.2. human. [Q9NVS2-1 ]
    uc003ovz.2. human. [Q9NVS2-3 ]
    uc003owa.2. human. [Q9NVS2-2 ]

    Organism-specific databases

    CTDi 55168.
    GeneCardsi GC06M043639.
    HGNCi HGNC:14515. MRPS18A.
    HPAi HPA035450.
    HPA035451.
    MIMi 611981. gene.
    neXtProti NX_Q9NVS2.
    PharmGKBi PA31003.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG249629.
    HOGENOMi HOG000139370.
    HOVERGENi HBG058800.
    KOi K02963.
    OrthoDBi EOG70089X.
    PhylomeDBi Q9NVS2.
    TreeFami TF315738.

    Miscellaneous databases

    GeneWikii MRPS18A.
    GenomeRNAii 55168.
    NextBioi 58945.
    PROi Q9NVS2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9NVS2.
    Bgeei Q9NVS2.
    CleanExi HS_MRPS18A.
    Genevestigatori Q9NVS2.

    Family and domain databases

    Gene3Di 4.10.640.10. 1 hit.
    InterProi IPR001648. Ribosomal_S18.
    [Graphical view ]
    Pfami PF01084. Ribosomal_S18. 1 hit.
    [Graphical view ]
    ProDomi PD002239. Ribosomal_S18. 1 hit.
    [Graphical view ] [Entries sharing at least one domain ]
    SUPFAMi SSF46911. SSF46911. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28S small subunit."
      Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K.
      J. Biol. Chem. 276:33181-33195(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    2. "A computer system platform used to predict novel genes."
      Yu Z., Zheng Z., Tang T., Fu Y.
      Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    4. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Prostate.
    7. "The small subunit of the mammalian mitochondrial ribosome: identification of the full complement of ribosomal proteins present."
      Koc E.C., Burkhart W., Blackburn K., Moseley A., Spremulli L.L.
      J. Biol. Chem. 276:19363-19374(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION.
    8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiRT18A_HUMAN
    AccessioniPrimary (citable) accession number: Q9NVS2
    Secondary accession number(s): A6XND3, Q5QPA4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 19, 2002
    Last sequence update: October 1, 2000
    Last modified: October 1, 2014
    This is version 111 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. Ribosomal proteins
      Ribosomal proteins families and list of entries
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3