Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9NVS2 (RT18A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 110. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
28S ribosomal protein S18a, mitochondrial

Short name=MRP-S18-a
Short name=Mrps18a
Short name=S18mt-a
Alternative name(s):
28S ribosomal protein S18-3, mitochondrial
Short name=MRP-S18-3
Gene names
Name:MRPS18A
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length196 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

Subcellular location

Mitochondrion Ref.7.

Sequence similarities

Belongs to the ribosomal protein S18P family. UniProtKB P80382

Ontologies

Keywords
   Cellular componentMitochondrion
   Coding sequence diversityAlternative splicing
   DomainTransit peptide
   Molecular functionRibonucleoprotein
Ribosomal protein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processtranslation

Non-traceable author statement Ref.7. Source: UniProtKB

   Cellular_componentmitochondrial small ribosomal subunit

Inferred from direct assay Ref.7. Source: UniProtKB

   Molecular_functionstructural constituent of ribosome

Non-traceable author statement Ref.7. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9NVS2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9NVS2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: A → AGRRPWGPRG...QRLSPLPRHS
Isoform 3 (identifier: Q9NVS2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     127-196: LLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH → T
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Transit peptide1 – 3434Mitochondrion By similarity
Chain35 – 19616228S ribosomal protein S18a, mitochondrial
PRO_0000030625

Natural variations

Alternative sequence1251A → AGRRPWGPRGAEGCRHSLPT QLPHVSAPPGRKVDIRSVNY THHPMPTFPLPWAFPLAPSE LQRELQRLSPLPRHS in isoform 2.
VSP_041245
Alternative sequence127 – 19670LLPNH…WKLYH → T in isoform 3.
VSP_043496

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified October 1, 2000. Version 1.
Checksum: CC086B8FC27242D6

FASTA19622,184
        10         20         30         40         50         60 
MAALKALVSG CGRLLRGLLA GPAATSWSRL PARGFREVVE TQEGKTTIIE GRITATPKES 

        70         80         90        100        110        120 
PNPPNPSGQC PICRWNLKHK YNYDDVLLLS QFIRPHGGML PRKITGLCQE EHRKIEECVK 

       130        140        150        160        170        180 
MAHRAGLLPN HRPRLPEGVV PKSKPQLNRY LTRWAPGSVK PIYKKGPRWN RVRMPVGSPL 

       190 
LRDNVCYSRT PWKLYH 

« Hide

Isoform 2 [UniParc].

Checksum: 2EEB47D86FC277F0
Show »

FASTA27030,540
Isoform 3 [UniParc].

Checksum: C5BA5F97CADB7D87
Show »

FASTA12714,030

References

« Hide 'large scale' references
[1]"Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28S small subunit."
Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K.
J. Biol. Chem. 276:33181-33195(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[2]"A computer system platform used to predict novel genes."
Yu Z., Zheng Z., Tang T., Fu Y.
Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
[4]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Prostate.
[7]"The small subunit of the mammalian mitochondrial ribosome: identification of the full complement of ribosomal proteins present."
Koc E.C., Burkhart W., Blackburn K., Moseley A., Spremulli L.L.
J. Biol. Chem. 276:19363-19374(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION.
[8]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB049952 mRNA. Translation: BAB41005.1.
DQ884400 mRNA. Translation: ABI63367.1.
AK001410 mRNA. Translation: BAA91675.1.
AK300757 mRNA. Translation: BAG62423.1.
AL136131 Genomic DNA. Translation: CAC19510.1.
AL136131 Genomic DNA. Translation: CAI19964.1.
CH471081 Genomic DNA. Translation: EAX04225.1.
BC010364 mRNA. Translation: AAH10364.1.
CCDSCCDS4906.1. [Q9NVS2-1]
CCDS55006.1. [Q9NVS2-3]
RefSeqNP_001180272.1. NM_001193343.1. [Q9NVS2-3]
NP_060605.1. NM_018135.3. [Q9NVS2-1]
XP_006715197.1. XM_006715134.1. [Q9NVS2-2]
UniGeneHs.520149.

3D structure databases

ProteinModelPortalQ9NVS2.
SMRQ9NVS2. Positions 84-131.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120468. 3 interactions.
IntActQ9NVS2. 1 interaction.
MINTMINT-3075179.
STRING9606.ENSP00000361206.

PTM databases

PhosphoSiteQ9NVS2.

Polymorphism databases

DMDM24212201.

Proteomic databases

MaxQBQ9NVS2.
PaxDbQ9NVS2.
PRIDEQ9NVS2.

Protocols and materials databases

DNASU55168.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000372116; ENSP00000361188; ENSG00000096080. [Q9NVS2-3]
ENST00000372133; ENSP00000361206; ENSG00000096080. [Q9NVS2-1]
GeneID55168.
KEGGhsa:55168.
UCSCuc003ovy.2. human. [Q9NVS2-1]
uc003ovz.2. human. [Q9NVS2-3]
uc003owa.2. human. [Q9NVS2-2]

Organism-specific databases

CTD55168.
GeneCardsGC06M043639.
HGNCHGNC:14515. MRPS18A.
HPAHPA035450.
HPA035451.
MIM611981. gene.
neXtProtNX_Q9NVS2.
PharmGKBPA31003.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG249629.
HOGENOMHOG000139370.
HOVERGENHBG058800.
KOK02963.
OrthoDBEOG70089X.
PhylomeDBQ9NVS2.
TreeFamTF315738.

Gene expression databases

ArrayExpressQ9NVS2.
BgeeQ9NVS2.
CleanExHS_MRPS18A.
GenevestigatorQ9NVS2.

Family and domain databases

Gene3D4.10.640.10. 1 hit.
InterProIPR001648. Ribosomal_S18.
[Graphical view]
PfamPF01084. Ribosomal_S18. 1 hit.
[Graphical view]
ProDomPD002239. Ribosomal_S18. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SUPFAMSSF46911. SSF46911. 1 hit.
ProtoNetSearch...

Other

GeneWikiMRPS18A.
GenomeRNAi55168.
NextBio58945.
PROQ9NVS2.
SOURCESearch...

Entry information

Entry nameRT18A_HUMAN
AccessionPrimary (citable) accession number: Q9NVS2
Secondary accession number(s): A6XND3, Q5QPA4
Entry history
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Ribosomal proteins

Ribosomal proteins families and list of entries

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM