Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

39S ribosomal protein S18a, mitochondrial

Gene

MRPS18A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Miscellaneous

There are 3 mitochondrial isoforms of bS18 in mammalia, localizing to 3 distinct sites in the mitoribosome. bS18m (bs18c) binds to the same site as bacterial bS18, mS40 (bS18b) binds to a novel location of the 28S small subunit, and mL66 (bS18a, this protein) binds to the 39S large subunit.1 Publication

GO - Molecular functioni

  • structural constituent of ribosome Source: UniProtKB

GO - Biological processi

  • mitochondrial translation Source: UniProtKB
  • mitochondrial translational elongation Source: Reactome
  • mitochondrial translational termination Source: Reactome
  • translation Source: UniProtKB

Keywordsi

Molecular functionRibonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiR-HSA-5368286. Mitochondrial translation initiation.
R-HSA-5389840. Mitochondrial translation elongation.
R-HSA-5419276. Mitochondrial translation termination.

Names & Taxonomyi

Protein namesi
Recommended name:
39S ribosomal protein S18a, mitochondrial
Short name:
MRP-S18-a
Short name:
Mrps18a
Short name:
S18mt-a
Alternative name(s):
39S ribosomal protein S18-3, mitochondrial
Short name:
MRP-S18-3
Mitochondrial large ribosomal subunit protein bS18a1 Publication
Mitochondrial large ribosomal subunit protein mL661 Publication
Gene namesi
Name:MRPS18A
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000096080.11.
HGNCiHGNC:14515. MRPS18A.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000096080.
PharmGKBiPA31003.

Polymorphism and mutation databases

BioMutaiMRPS18A.
DMDMi24212201.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transit peptidei1 – 34MitochondrionBy similarityAdd BLAST34
ChainiPRO_000003062535 – 19639S ribosomal protein S18a, mitochondrialAdd BLAST162

Proteomic databases

EPDiQ9NVS2.
MaxQBiQ9NVS2.
PaxDbiQ9NVS2.
PeptideAtlasiQ9NVS2.
PRIDEiQ9NVS2.
TopDownProteomicsiQ9NVS2-1. [Q9NVS2-1]
Q9NVS2-2. [Q9NVS2-2]

PTM databases

PhosphoSitePlusiQ9NVS2.
SwissPalmiQ9NVS2.

Expressioni

Gene expression databases

BgeeiENSG00000096080.
CleanExiHS_MRPS18A.
ExpressionAtlasiQ9NVS2. baseline and differential.
GenevisibleiQ9NVS2. HS.

Organism-specific databases

HPAiHPA035450.
HPA035451.

Interactioni

Subunit structurei

Component of the mitochondrial large ribosomal subunit (mt-LSU). Mature mammalian 55S mitochondrial ribosomes consist of a small (28S) and a large (39S) subunit. The 28S small subunit contains a 12S ribosomal RNA (12S mt-rRNA) and 30 different proteins. The 39S large subunit contains a 16S rRNA (16S mt-rRNA), a copy of mitochondrial valine transfer RNA (mt-tRNA(Val)), which plays an integral structural role, and 52 different proteins. mL66 forms a zinc-binding site with uL10m.2 Publications

Protein-protein interaction databases

BioGridi120468. 33 interactors.
CORUMiQ9NVS2.
IntActiQ9NVS2. 8 interactors.
MINTiMINT-3075179.
STRINGi9606.ENSP00000361206.

Structurei

Secondary structure

1196
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi36 – 40Combined sources5
Beta strandi48 – 53Combined sources6
Helixi73 – 75Combined sources3
Helixi86 – 89Combined sources4
Helixi90 – 92Combined sources3
Helixi102 – 105Combined sources4
Helixi109 – 123Combined sources15
Turni124 – 126Combined sources3
Beta strandi148 – 151Combined sources4
Helixi156 – 158Combined sources3
Helixi168 – 170Combined sources3
Helixi179 – 181Combined sources3
Beta strandi182 – 184Combined sources3
Beta strandi188 – 190Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40r1-196[»]
3J9Melectron microscopy3.50r1-196[»]
5OOLelectron microscopy3.06r1-196[»]
5OOMelectron microscopy3.03r1-196[»]
ProteinModelPortaliQ9NVS2.
SMRiQ9NVS2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiKOG3162. Eukaryota.
COG0238. LUCA.
GeneTreeiENSGT00390000006493.
HOGENOMiHOG000139370.
HOVERGENiHBG058800.
InParanoidiQ9NVS2.
KOiK02963.
PhylomeDBiQ9NVS2.
TreeFamiTF315738.

Family and domain databases

Gene3Di4.10.640.10. 1 hit.
InterProiView protein in InterPro
IPR001648. Ribosomal_S18.
IPR036870. Ribosomal_S18_sf.
PfamiView protein in Pfam
PF01084. Ribosomal_S18. 1 hit.
ProDomiView protein in ProDom or Entries sharing at least one domain
PD002239. Ribosomal_S18. 1 hit.
SUPFAMiSSF46911. SSF46911. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NVS2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALKALVSG CGRLLRGLLA GPAATSWSRL PARGFREVVE TQEGKTTIIE
60 70 80 90 100
GRITATPKES PNPPNPSGQC PICRWNLKHK YNYDDVLLLS QFIRPHGGML
110 120 130 140 150
PRKITGLCQE EHRKIEECVK MAHRAGLLPN HRPRLPEGVV PKSKPQLNRY
160 170 180 190
LTRWAPGSVK PIYKKGPRWN RVRMPVGSPL LRDNVCYSRT PWKLYH
Length:196
Mass (Da):22,184
Last modified:October 1, 2000 - v1
Checksum:iCC086B8FC27242D6
GO
Isoform 2 (identifier: Q9NVS2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: A → AGRRPWGPRG...QRLSPLPRHS

Show »
Length:270
Mass (Da):30,540
Checksum:i2EEB47D86FC277F0
GO
Isoform 3 (identifier: Q9NVS2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-196: LLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH → T

Note: No experimental confirmation available.
Show »
Length:127
Mass (Da):14,030
Checksum:iC5BA5F97CADB7D87
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_041245125A → AGRRPWGPRGAEGCRHSLPT QLPHVSAPPGRKVDIRSVNY THHPMPTFPLPWAFPLAPSE LQRELQRLSPLPRHS in isoform 2. 1 Publication1
Alternative sequenceiVSP_043496127 – 196LLPNH…WKLYH → T in isoform 3. 1 PublicationAdd BLAST70

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB049952 mRNA. Translation: BAB41005.1.
DQ884400 mRNA. Translation: ABI63367.1.
AK001410 mRNA. Translation: BAA91675.1.
AK300757 mRNA. Translation: BAG62423.1.
AL136131 Genomic DNA. Translation: CAC19510.1.
AL136131 Genomic DNA. Translation: CAI19964.1.
CH471081 Genomic DNA. Translation: EAX04225.1.
BC010364 mRNA. Translation: AAH10364.1.
CCDSiCCDS4906.1. [Q9NVS2-1]
CCDS55006.1. [Q9NVS2-3]
RefSeqiNP_001180272.1. NM_001193343.1. [Q9NVS2-3]
NP_060605.1. NM_018135.3. [Q9NVS2-1]
XP_006715197.1. XM_006715134.2. [Q9NVS2-2]
UniGeneiHs.520149.

Genome annotation databases

EnsembliENST00000372116; ENSP00000361188; ENSG00000096080. [Q9NVS2-3]
ENST00000372133; ENSP00000361206; ENSG00000096080. [Q9NVS2-1]
GeneIDi55168.
KEGGihsa:55168.
UCSCiuc003ovy.3. human. [Q9NVS2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRT18A_HUMAN
AccessioniPrimary (citable) accession number: Q9NVS2
Secondary accession number(s): A6XND3, Q5QPA4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 1, 2000
Last modified: November 22, 2017
This is version 139 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Ribosomal proteins
    Ribosomal proteins families and list of entries
  5. SIMILARITY comments
    Index of protein domains and families