Q9NVS2 (RT18A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: 28S ribosomal protein S18a, mitochondrial Short name=MRP-S18-a Short name=Mrps18a Short name=S18mt-a Alternative name(s): 28S ribosomal protein S18-3, mitochondrial Short name=MRP-S18-3 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 196 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subunit structure | Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins. |
| Subcellular location | |
| Sequence similarities | Belongs to the ribosomal protein S18P family. UniProtKB P80382 |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | Transit peptide |
| Molecular function | Ribonucleoprotein Ribosomal protein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | translation Non-traceable author statement Ref.7. Source: UniProtKB |
| Cellular_component | mitochondrial small ribosomal subunit Inferred from direct assay Ref.7. Source: UniProtKB |
| Molecular_function | structural constituent of ribosome Non-traceable author statement Ref.7. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9NVS2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9NVS2-2) The sequence of this isoform differs from the canonical sequence as follows: 125-125: A → AGRRPWGPRG...QRLSPLPRHS | ||||||
| Isoform 3 (identifier: Q9NVS2-3) The sequence of this isoform differs from the canonical sequence as follows: 127-196: LLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH → T | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 34 | 34 | Mitochondrion By similarity | ||||||
| Chain | 35 – 196 | 162 | 28S ribosomal protein S18a, mitochondrial | PRO_0000030625 | |||||
Natural variations | |||||||||
| Alternative sequence | 125 | 1 | A → AGRRPWGPRGAEGCRHSLPT QLPHVSAPPGRKVDIRSVNY THHPMPTFPLPWAFPLAPSE LQRELQRLSPLPRHS in isoform 2. | VSP_041245 | |||||
| Alternative sequence | 127 – 196 | 70 | LLPNH…WKLYH → T in isoform 3. | VSP_043496 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28S small subunit." Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K. J. Biol. Chem. 276:33181-33195(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "A computer system platform used to predict novel genes." Yu Z., Zheng Z., Tang T., Fu Y. Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). |
| [4] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Prostate. |
| [7] | "The small subunit of the mammalian mitochondrial ribosome: identification of the full complement of ribosomal proteins present." Koc E.C., Burkhart W., Blackburn K., Moseley A., Spremulli L.L. J. Biol. Chem. 276:19363-19374(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB049952 mRNA. Translation: BAB41005.1. DQ884400 mRNA. Translation: ABI63367.1. AK001410 mRNA. Translation: BAA91675.1. AK300757 mRNA. Translation: BAG62423.1. AL136131 Genomic DNA. Translation: CAC19510.1. AL136131 Genomic DNA. Translation: CAI19964.1. CH471081 Genomic DNA. Translation: EAX04225.1. BC010364 mRNA. Translation: AAH10364.1. |
| IPI | IPI00018691. IPI00513805. IPI00642295. |
| RefSeq | NP_001180272.1. NM_001193343.1. NP_060605.1. NM_018135.3. |
| UniGene | Hs.520149. |
3D structure databases | |
| ProteinModelPortal | Q9NVS2. |
| SMR | Q9NVS2. Positions 84-132. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000361206. |
PTM databases | |
| PhosphoSite | Q9NVS2. |
Polymorphism databases | |
| DMDM | 24212201. |
Proteomic databases | |
| PaxDb | Q9NVS2. |
| PRIDE | Q9NVS2. |
Protocols and materials databases | |
| DNASU | 55168. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000372116; ENSP00000361188; ENSG00000096080. ENST00000372133; ENSP00000361206; ENSG00000096080. |
| GeneID | 55168. |
| KEGG | hsa:55168. |
| UCSC | uc003ovy.2. human. uc003owa.2. human. |
Organism-specific databases | |
| CTD | 55168. |
| GeneCards | GC06M043639. |
| HGNC | HGNC:14515. MRPS18A. |
| HPA | HPA035450. HPA035451. |
| MIM | 611981. gene. |
| neXtProt | NX_Q9NVS2. |
| PharmGKB | PA31003. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG249629. |
| HOGENOM | HOG000139370. |
| HOVERGEN | HBG058800. |
| KO | K02963. |
| OMA | HRPRLPE. |
| OrthoDB | EOG4CNQS4. |
| PhylomeDB | Q9NVS2. |
Gene expression databases | |
| ArrayExpress | Q9NVS2. |
| Bgee | Q9NVS2. |
| CleanEx | HS_MRPS18A. |
| Genevestigator | Q9NVS2. |
| GermOnline | ENSG00000096080. Homo sapiens. |
Family and domain databases | |
| Gene3D | 4.10.640.10. 1 hit. |
| InterPro | IPR001648. Ribosomal_S18. [Graphical view] |
| Pfam | PF01084. Ribosomal_S18. 1 hit. [Graphical view] |
| ProDom | PD002239. Ribosomal_S18. 1 hit. [Graphical view] [Entries sharing at least one domain] |
| SUPFAM | SSF46911. Ribosomal_S18. 1 hit. |
| PROSITE | PS00057. RIBOSOMAL_S18. False negative. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 55168. |
| NextBio | 58945. |
| SOURCE | Search... |
Entry information
| Entry name | RT18A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9NVS2 Secondary accession number(s): A6XND3, Q5QPA4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Ribosomal proteins Ribosomal proteins families and list of entries |
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
