Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

28S ribosomal protein S18a, mitochondrial

Gene

MRPS18A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. structural constituent of ribosome Source: UniProtKB

GO - Biological processi

  1. mitochondrial translation Source: Reactome
  2. mitochondrial translational elongation Source: Reactome
  3. mitochondrial translational initiation Source: Reactome
  4. mitochondrial translational termination Source: Reactome
  5. organelle organization Source: Reactome
  6. translation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein, Ribosomal protein

Enzyme and pathway databases

ReactomeiREACT_267634. Mitochondrial translation initiation.
REACT_268133. Mitochondrial translation elongation.
REACT_268261. Mitochondrial translation termination.

Names & Taxonomyi

Protein namesi
Recommended name:
28S ribosomal protein S18a, mitochondrial
Short name:
MRP-S18-a
Short name:
Mrps18a
Short name:
S18mt-a
Alternative name(s):
28S ribosomal protein S18-3, mitochondrial
Short name:
MRP-S18-3
Gene namesi
Name:MRPS18A
OrganismiHomo sapiens (Human)Imported
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:14515. MRPS18A.

Subcellular locationi

  1. Mitochondrion 1 Publication

GO - Cellular componenti

  1. mitochondrial inner membrane Source: Reactome
  2. mitochondrial small ribosomal subunit Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31003.

Polymorphism and mutation databases

BioMutaiMRPS18A.
DMDMi24212201.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 3434MitochondrionBy similarityAdd
BLAST
Chaini35 – 19616228S ribosomal protein S18a, mitochondrialPRO_0000030625Add
BLAST

Proteomic databases

MaxQBiQ9NVS2.
PaxDbiQ9NVS2.
PRIDEiQ9NVS2.

PTM databases

PhosphoSiteiQ9NVS2.

Expressioni

Gene expression databases

BgeeiQ9NVS2.
CleanExiHS_MRPS18A.
ExpressionAtlasiQ9NVS2. baseline and differential.
GenevestigatoriQ9NVS2.

Organism-specific databases

HPAiHPA035450.
HPA035451.

Interactioni

Subunit structurei

Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

Protein-protein interaction databases

BioGridi120468. 15 interactions.
IntActiQ9NVS2. 1 interaction.
MINTiMINT-3075179.
STRINGi9606.ENSP00000361206.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40r1-196[»]
SMRiQ9NVS2. Positions 39-196.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the ribosomal protein S18P family.By similarity

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiNOG249629.
GeneTreeiENSGT00390000006493.
HOGENOMiHOG000139370.
HOVERGENiHBG058800.
InParanoidiQ9NVS2.
KOiK02963.
OrthoDBiEOG70089X.
PhylomeDBiQ9NVS2.
TreeFamiTF315738.

Family and domain databases

Gene3Di4.10.640.10. 1 hit.
InterProiIPR001648. Ribosomal_S18.
[Graphical view]
PfamiPF01084. Ribosomal_S18. 1 hit.
[Graphical view]
ProDomiPD002239. Ribosomal_S18. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SUPFAMiSSF46911. SSF46911. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9NVS2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAALKALVSG CGRLLRGLLA GPAATSWSRL PARGFREVVE TQEGKTTIIE
60 70 80 90 100
GRITATPKES PNPPNPSGQC PICRWNLKHK YNYDDVLLLS QFIRPHGGML
110 120 130 140 150
PRKITGLCQE EHRKIEECVK MAHRAGLLPN HRPRLPEGVV PKSKPQLNRY
160 170 180 190
LTRWAPGSVK PIYKKGPRWN RVRMPVGSPL LRDNVCYSRT PWKLYH
Length:196
Mass (Da):22,184
Last modified:October 1, 2000 - v1
Checksum:iCC086B8FC27242D6
GO
Isoform 2 (identifier: Q9NVS2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: A → AGRRPWGPRG...QRLSPLPRHS

Show »
Length:270
Mass (Da):30,540
Checksum:i2EEB47D86FC277F0
GO
Isoform 3 (identifier: Q9NVS2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-196: LLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH → T

Note: No experimental confirmation available.

Show »
Length:127
Mass (Da):14,030
Checksum:iC5BA5F97CADB7D87
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei125 – 1251A → AGRRPWGPRGAEGCRHSLPT QLPHVSAPPGRKVDIRSVNY THHPMPTFPLPWAFPLAPSE LQRELQRLSPLPRHS in isoform 2. 1 PublicationVSP_041245
Alternative sequencei127 – 19670LLPNH…WKLYH → T in isoform 3. 1 PublicationVSP_043496Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB049952 mRNA. Translation: BAB41005.1.
DQ884400 mRNA. Translation: ABI63367.1.
AK001410 mRNA. Translation: BAA91675.1.
AK300757 mRNA. Translation: BAG62423.1.
AL136131 Genomic DNA. Translation: CAC19510.1.
AL136131 Genomic DNA. Translation: CAI19964.1.
CH471081 Genomic DNA. Translation: EAX04225.1.
BC010364 mRNA. Translation: AAH10364.1.
CCDSiCCDS4906.1. [Q9NVS2-1]
CCDS55006.1. [Q9NVS2-3]
RefSeqiNP_001180272.1. NM_001193343.1. [Q9NVS2-3]
NP_060605.1. NM_018135.3. [Q9NVS2-1]
XP_006715197.1. XM_006715134.1. [Q9NVS2-2]
UniGeneiHs.520149.

Genome annotation databases

GeneIDi55168.
KEGGihsa:55168.
UCSCiuc003ovy.2. human. [Q9NVS2-1]
uc003ovz.2. human. [Q9NVS2-3]
uc003owa.2. human. [Q9NVS2-2]

Polymorphism and mutation databases

BioMutaiMRPS18A.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB049952 mRNA. Translation: BAB41005.1.
DQ884400 mRNA. Translation: ABI63367.1.
AK001410 mRNA. Translation: BAA91675.1.
AK300757 mRNA. Translation: BAG62423.1.
AL136131 Genomic DNA. Translation: CAC19510.1.
AL136131 Genomic DNA. Translation: CAI19964.1.
CH471081 Genomic DNA. Translation: EAX04225.1.
BC010364 mRNA. Translation: AAH10364.1.
CCDSiCCDS4906.1. [Q9NVS2-1]
CCDS55006.1. [Q9NVS2-3]
RefSeqiNP_001180272.1. NM_001193343.1. [Q9NVS2-3]
NP_060605.1. NM_018135.3. [Q9NVS2-1]
XP_006715197.1. XM_006715134.1. [Q9NVS2-2]
UniGeneiHs.520149.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3J7Yelectron microscopy3.40r1-196[»]
SMRiQ9NVS2. Positions 39-196.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120468. 15 interactions.
IntActiQ9NVS2. 1 interaction.
MINTiMINT-3075179.
STRINGi9606.ENSP00000361206.

PTM databases

PhosphoSiteiQ9NVS2.

Polymorphism and mutation databases

BioMutaiMRPS18A.
DMDMi24212201.

Proteomic databases

MaxQBiQ9NVS2.
PaxDbiQ9NVS2.
PRIDEiQ9NVS2.

Protocols and materials databases

DNASUi55168.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi55168.
KEGGihsa:55168.
UCSCiuc003ovy.2. human. [Q9NVS2-1]
uc003ovz.2. human. [Q9NVS2-3]
uc003owa.2. human. [Q9NVS2-2]

Organism-specific databases

CTDi55168.
GeneCardsiGC06M043639.
HGNCiHGNC:14515. MRPS18A.
HPAiHPA035450.
HPA035451.
MIMi611981. gene.
neXtProtiNX_Q9NVS2.
PharmGKBiPA31003.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG249629.
GeneTreeiENSGT00390000006493.
HOGENOMiHOG000139370.
HOVERGENiHBG058800.
InParanoidiQ9NVS2.
KOiK02963.
OrthoDBiEOG70089X.
PhylomeDBiQ9NVS2.
TreeFamiTF315738.

Enzyme and pathway databases

ReactomeiREACT_267634. Mitochondrial translation initiation.
REACT_268133. Mitochondrial translation elongation.
REACT_268261. Mitochondrial translation termination.

Miscellaneous databases

GeneWikiiMRPS18A.
GenomeRNAii55168.
NextBioi58945.
PROiQ9NVS2.
SOURCEiSearch...

Gene expression databases

BgeeiQ9NVS2.
CleanExiHS_MRPS18A.
ExpressionAtlasiQ9NVS2. baseline and differential.
GenevestigatoriQ9NVS2.

Family and domain databases

Gene3Di4.10.640.10. 1 hit.
InterProiIPR001648. Ribosomal_S18.
[Graphical view]
PfamiPF01084. Ribosomal_S18. 1 hit.
[Graphical view]
ProDomiPD002239. Ribosomal_S18. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SUPFAMiSSF46911. SSF46911. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28S small subunit."
    Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K.
    J. Biol. Chem. 276:33181-33195(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "A computer system platform used to predict novel genes."
    Yu Z., Zheng Z., Tang T., Fu Y.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Prostate.
  7. "The small subunit of the mammalian mitochondrial ribosome: identification of the full complement of ribosomal proteins present."
    Koc E.C., Burkhart W., Blackburn K., Moseley A., Spremulli L.L.
    J. Biol. Chem. 276:19363-19374(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRT18A_HUMAN
AccessioniPrimary (citable) accession number: Q9NVS2
Secondary accession number(s): A6XND3, Q5QPA4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 1, 2000
Last modified: April 29, 2015
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. Ribosomal proteins
    Ribosomal proteins families and list of entries
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.