SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9NVS2

- RT18A_HUMAN

UniProt

Q9NVS2 - RT18A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

28S ribosomal protein S18a, mitochondrial

Gene
MRPS18A
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

GO - Molecular functioni

  1. structural constituent of ribosome Source: UniProtKB

GO - Biological processi

  1. translation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Ribonucleoprotein, Ribosomal protein

Names & Taxonomyi

Protein namesi
Recommended name:
28S ribosomal protein S18a, mitochondrial
Short name:
MRP-S18-a
Short name:
Mrps18a
Short name:
S18mt-a
Alternative name(s):
28S ribosomal protein S18-3, mitochondrial
Short name:
MRP-S18-3
Gene namesi
Name:MRPS18A
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:14515. MRPS18A.

Subcellular locationi

Mitochondrion 1 Publication

GO - Cellular componenti

  1. mitochondrial small ribosomal subunit Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31003.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transit peptidei1 – 3434Mitochondrion By similarityAdd
BLAST
Chaini35 – 19616228S ribosomal protein S18a, mitochondrialPRO_0000030625Add
BLAST

Proteomic databases

MaxQBiQ9NVS2.
PaxDbiQ9NVS2.
PRIDEiQ9NVS2.

PTM databases

PhosphoSiteiQ9NVS2.

Expressioni

Gene expression databases

ArrayExpressiQ9NVS2.
BgeeiQ9NVS2.
CleanExiHS_MRPS18A.
GenevestigatoriQ9NVS2.

Organism-specific databases

HPAiHPA035450.
HPA035451.

Interactioni

Subunit structurei

Component of the mitochondrial ribosome small subunit (28S) which comprises a 12S rRNA and about 30 distinct proteins.

Protein-protein interaction databases

BioGridi120468. 3 interactions.
IntActiQ9NVS2. 1 interaction.
MINTiMINT-3075179.
STRINGi9606.ENSP00000361206.

Structurei

3D structure databases

ProteinModelPortaliQ9NVS2.
SMRiQ9NVS2. Positions 84-131.

Family & Domainsi

Sequence similaritiesi

Belongs to the ribosomal protein S18P family.By similarity

Keywords - Domaini

Transit peptide

Phylogenomic databases

eggNOGiNOG249629.
HOGENOMiHOG000139370.
HOVERGENiHBG058800.
KOiK02963.
OrthoDBiEOG70089X.
PhylomeDBiQ9NVS2.
TreeFamiTF315738.

Family and domain databases

Gene3Di4.10.640.10. 1 hit.
InterProiIPR001648. Ribosomal_S18.
[Graphical view]
PfamiPF01084. Ribosomal_S18. 1 hit.
[Graphical view]
ProDomiPD002239. Ribosomal_S18. 1 hit.
[Graphical view] [Entries sharing at least one domain]
SUPFAMiSSF46911. SSF46911. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9NVS2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAALKALVSG CGRLLRGLLA GPAATSWSRL PARGFREVVE TQEGKTTIIE    50
GRITATPKES PNPPNPSGQC PICRWNLKHK YNYDDVLLLS QFIRPHGGML 100
PRKITGLCQE EHRKIEECVK MAHRAGLLPN HRPRLPEGVV PKSKPQLNRY 150
LTRWAPGSVK PIYKKGPRWN RVRMPVGSPL LRDNVCYSRT PWKLYH 196
Length:196
Mass (Da):22,184
Last modified:October 1, 2000 - v1
Checksum:iCC086B8FC27242D6
GO
Isoform 2 (identifier: Q9NVS2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     125-125: A → AGRRPWGPRG...QRLSPLPRHS

Show »
Length:270
Mass (Da):30,540
Checksum:i2EEB47D86FC277F0
GO
Isoform 3 (identifier: Q9NVS2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-196: LLPNHRPRLPEGVVPKSKPQLNRYLTRWAPGSVKPIYKKGPRWNRVRMPVGSPLLRDNVCYSRTPWKLYH → T

Note: No experimental confirmation available.

Show »
Length:127
Mass (Da):14,030
Checksum:iC5BA5F97CADB7D87
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei125 – 1251A → AGRRPWGPRGAEGCRHSLPT QLPHVSAPPGRKVDIRSVNY THHPMPTFPLPWAFPLAPSE LQRELQRLSPLPRHS in isoform 2. VSP_041245
Alternative sequencei127 – 19670LLPNH…WKLYH → T in isoform 3. VSP_043496Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB049952 mRNA. Translation: BAB41005.1.
DQ884400 mRNA. Translation: ABI63367.1.
AK001410 mRNA. Translation: BAA91675.1.
AK300757 mRNA. Translation: BAG62423.1.
AL136131 Genomic DNA. Translation: CAC19510.1.
AL136131 Genomic DNA. Translation: CAI19964.1.
CH471081 Genomic DNA. Translation: EAX04225.1.
BC010364 mRNA. Translation: AAH10364.1.
CCDSiCCDS4906.1. [Q9NVS2-1]
CCDS55006.1. [Q9NVS2-3]
RefSeqiNP_001180272.1. NM_001193343.1. [Q9NVS2-3]
NP_060605.1. NM_018135.3. [Q9NVS2-1]
XP_006715197.1. XM_006715134.1. [Q9NVS2-2]
UniGeneiHs.520149.

Genome annotation databases

EnsembliENST00000372116; ENSP00000361188; ENSG00000096080. [Q9NVS2-3]
ENST00000372133; ENSP00000361206; ENSG00000096080. [Q9NVS2-1]
GeneIDi55168.
KEGGihsa:55168.
UCSCiuc003ovy.2. human. [Q9NVS2-1]
uc003ovz.2. human. [Q9NVS2-3]
uc003owa.2. human. [Q9NVS2-2]

Polymorphism databases

DMDMi24212201.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB049952 mRNA. Translation: BAB41005.1 .
DQ884400 mRNA. Translation: ABI63367.1 .
AK001410 mRNA. Translation: BAA91675.1 .
AK300757 mRNA. Translation: BAG62423.1 .
AL136131 Genomic DNA. Translation: CAC19510.1 .
AL136131 Genomic DNA. Translation: CAI19964.1 .
CH471081 Genomic DNA. Translation: EAX04225.1 .
BC010364 mRNA. Translation: AAH10364.1 .
CCDSi CCDS4906.1. [Q9NVS2-1 ]
CCDS55006.1. [Q9NVS2-3 ]
RefSeqi NP_001180272.1. NM_001193343.1. [Q9NVS2-3 ]
NP_060605.1. NM_018135.3. [Q9NVS2-1 ]
XP_006715197.1. XM_006715134.1. [Q9NVS2-2 ]
UniGenei Hs.520149.

3D structure databases

ProteinModelPortali Q9NVS2.
SMRi Q9NVS2. Positions 84-131.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120468. 3 interactions.
IntActi Q9NVS2. 1 interaction.
MINTi MINT-3075179.
STRINGi 9606.ENSP00000361206.

PTM databases

PhosphoSitei Q9NVS2.

Polymorphism databases

DMDMi 24212201.

Proteomic databases

MaxQBi Q9NVS2.
PaxDbi Q9NVS2.
PRIDEi Q9NVS2.

Protocols and materials databases

DNASUi 55168.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000372116 ; ENSP00000361188 ; ENSG00000096080 . [Q9NVS2-3 ]
ENST00000372133 ; ENSP00000361206 ; ENSG00000096080 . [Q9NVS2-1 ]
GeneIDi 55168.
KEGGi hsa:55168.
UCSCi uc003ovy.2. human. [Q9NVS2-1 ]
uc003ovz.2. human. [Q9NVS2-3 ]
uc003owa.2. human. [Q9NVS2-2 ]

Organism-specific databases

CTDi 55168.
GeneCardsi GC06M043639.
HGNCi HGNC:14515. MRPS18A.
HPAi HPA035450.
HPA035451.
MIMi 611981. gene.
neXtProti NX_Q9NVS2.
PharmGKBi PA31003.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG249629.
HOGENOMi HOG000139370.
HOVERGENi HBG058800.
KOi K02963.
OrthoDBi EOG70089X.
PhylomeDBi Q9NVS2.
TreeFami TF315738.

Miscellaneous databases

GeneWikii MRPS18A.
GenomeRNAii 55168.
NextBioi 58945.
PROi Q9NVS2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9NVS2.
Bgeei Q9NVS2.
CleanExi HS_MRPS18A.
Genevestigatori Q9NVS2.

Family and domain databases

Gene3Di 4.10.640.10. 1 hit.
InterProi IPR001648. Ribosomal_S18.
[Graphical view ]
Pfami PF01084. Ribosomal_S18. 1 hit.
[Graphical view ]
ProDomi PD002239. Ribosomal_S18. 1 hit.
[Graphical view ] [Entries sharing at least one domain ]
SUPFAMi SSF46911. SSF46911. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Proteomic analysis of the mammalian mitochondrial ribosome. Identification of protein components in the 28S small subunit."
    Suzuki T., Terasaki M., Takemoto-Hori C., Hanada T., Ueda T., Wada A., Watanabe K.
    J. Biol. Chem. 276:33181-33195(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "A computer system platform used to predict novel genes."
    Yu Z., Zheng Z., Tang T., Fu Y.
    Submitted (JUL-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
  4. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Prostate.
  7. "The small subunit of the mammalian mitochondrial ribosome: identification of the full complement of ribosomal proteins present."
    Koc E.C., Burkhart W., Blackburn K., Moseley A., Spremulli L.L.
    J. Biol. Chem. 276:19363-19374(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiRT18A_HUMAN
AccessioniPrimary (citable) accession number: Q9NVS2
Secondary accession number(s): A6XND3, Q5QPA4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 19, 2002
Last sequence update: October 1, 2000
Last modified: July 9, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Ribosomal proteins
    Ribosomal proteins families and list of entries
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi